Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_666.2633533516560.0
YNL025C (SSN8)32333211731e-162
CAGL0M06875g33934611721e-162
Sklu_2251.929932910891e-150
ADL207W36033210671e-145
Kwal_27.1149429933110071e-137
KLLA0E08151g3043329581e-130
KLLA0E06666g3982911286e-08
Kwal_27.10641376246930.001
YPR025C (CCL1)393255920.002
CAGL0K05115g367251920.002
Scas_672.12374160870.007
AFR567W144968720.56
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_666.26
         (335 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_666.26                                                           642   0.0  
YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C ...   456   e-162
CAGL0M06875g complement(699260..700279) highly similar to sp|P47...   456   e-162
Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement        424   e-150
ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH] complement(...   415   e-145
Kwal_27.11494                                                         392   e-137
KLLA0E08151g complement(737811..738725) similar to sp|P47821 Sac...   373   e-130
KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyce...    54   6e-08
Kwal_27.10641                                                          40   0.001
YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C ...    40   0.002
CAGL0K05115g complement(497262..498365) similar to sp|P37366 Sac...    40   0.002
Scas_672.12                                                            38   0.007
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    32   0.56 

>Scas_666.26
          Length = 335

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/335 (92%), Positives = 310/335 (92%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60
           MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM
Sbjct: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60

Query: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120
           RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV
Sbjct: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120

Query: 121 REVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXX 180
           REVN           ACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVT           
Sbjct: 121 REVNLYLLVTTTVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTEFEFYLLEELE 180

Query: 181 XXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240
              IVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS
Sbjct: 181 SYLIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240

Query: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300
           CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT
Sbjct: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300

Query: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSSISN 335
           IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSSISN
Sbjct: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSSISN 335

>YNL025C (SSN8) [4561] chr14 complement(584318..585289) Cyclin C
           homolog, component of RNA polymerase holoenzyme complex
           and Kornberg's mediator (SRB) subcomplex [972 bp, 323
           aa]
          Length = 323

 Score =  456 bits (1173), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/332 (67%), Positives = 254/332 (76%), Gaps = 11/332 (3%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60
           MSGS+WTSTQRH+WQ+TK SLAKERQKLW+LECQLFPQGLNI MD+ +       NG I 
Sbjct: 1   MSGSFWTSTQRHHWQYTKASLAKERQKLWLLECQLFPQGLNIVMDSKQ-------NG-IE 52

Query: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120
           +  TKNIPITHRDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ ALATAHIYLSRFL++ SV
Sbjct: 53  QSITKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHIYLSRFLIKASV 112

Query: 121 REVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXX 180
           RE+N           ACKVEECPQYIRTLVSEAR+LWPEF+PPDPTKVT           
Sbjct: 113 REINLYMLVTTCVYLACKVEECPQYIRTLVSEARTLWPEFIPPDPTKVTEFEFYLLEELE 172

Query: 181 XXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240
              IVHHPY+ L+QIV+ LK  PFQ+ L++DDLQNCWSLINDSYI D +L+YPPHIIA++
Sbjct: 173 SYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVA 232

Query: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300
           CLFITI+   I      G++            +N  S  Q  FN +MA+S VDLEEVMDT
Sbjct: 233 CLFITIS---IHGKPTKGSSLASAASEAIRDPKNSSSPVQIAFNRFMAESLVDLEEVMDT 289

Query: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSS 332
           IQEQITLYDHWDKYHE W+KFLLHTLYLRP+S
Sbjct: 290 IQEQITLYDHWDKYHEQWIKFLLHTLYLRPAS 321

>CAGL0M06875g complement(699260..700279) highly similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8, start by
           similarity
          Length = 339

 Score =  456 bits (1172), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 223/346 (64%), Positives = 262/346 (75%), Gaps = 22/346 (6%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTI- 59
           MSGSYWTS QR  WQ TK SLA+ERQ+LW++ECQLFPQGLNI +D+ KPNS+D+SNG   
Sbjct: 1   MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVDS-KPNSADSSNGNAA 59

Query: 60  ----------MRPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHI 109
                     +  TTKNIPITHRDLHYD+DYNLRIYCYFLIMKLGRRLNIRQ ALATAHI
Sbjct: 60  NNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLGRRLNIRQYALATAHI 119

Query: 110 YLSRFLLRTSVREVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVT 169
           YLSRFLL+ SVREVN           ACKVEECPQYIRTLVSEARSLWPEF+PPDPTKVT
Sbjct: 120 YLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKVT 179

Query: 170 XXXXXXXXXXXXXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDAN 229
                         IVHHPY+ +EQIVE LK EPF+L  T+D+LQNCWSLINDS+I D +
Sbjct: 180 EFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDELQNCWSLINDSFINDVH 239

Query: 230 LIYPPHIIAMSCLFITIALKNIDANVGNGNTKNDNL---ITRALSGENGMSKTQEVFNLY 286
           L Y PHIIAM+CLFIT++++         NTK  +L   +T  L+ ++ ++  Q+ F  +
Sbjct: 240 LTYAPHIIAMACLFITVSIQ-------GSNTKELSLTSAVTETLTSQSSLTPQQQTFFRF 292

Query: 287 MAQSQVDLEEVMDTIQEQITLYDHWDKYHEPWVKFLLHTLYLRPSS 332
           +A+S VDLEEVMDTIQ+QI LYDHWD+YHEPW+K+LLHTLYLRP S
Sbjct: 293 LAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLRPLS 338

>Sklu_2251.9 YNL025C, Contig c2251 9078-9977 reverse complement
          Length = 299

 Score =  424 bits (1089), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 202/329 (61%), Positives = 241/329 (73%), Gaps = 31/329 (9%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60
           MS SYW STQRH WQ+T+ SLA+ERQ LW++ECQLFP GL+I M+  K       NG   
Sbjct: 1   MSASYWESTQRHKWQYTRESLARERQNLWLMECQLFPHGLSIVMENSK-------NGGQQ 53

Query: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120
           +  T+NIPI+H+DLHYD+DYNLRIYCYFLIMKLGRRLNIRQCALATAH+YLSRFLL+ S+
Sbjct: 54  QSITRNIPISHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVYLSRFLLKASI 113

Query: 121 REVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXX 180
           REVN           ACKVEECPQ+IRTLV+EARSLWPEFVPPDPTKVT           
Sbjct: 114 REVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQ 173

Query: 181 XXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240
              IVHHPYR +E IV +L+ EP+QL L+ +DLQN WSLINDSYITD +L+YPPH+IAM+
Sbjct: 174 SYLIVHHPYRSMEHIVSSLREEPYQLALSPEDLQNSWSLINDSYITDLHLMYPPHVIAMA 233

Query: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300
           C+FIT+ LK                          +S  Q+ FN +MA+SQVDL+EVM+ 
Sbjct: 234 CMFITVCLK------------------------KSVSHRQQTFNRFMAESQVDLQEVMNV 269

Query: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLR 329
           IQ+ ITLYDHWDKY+EPW+KFLLHT+YLR
Sbjct: 270 IQDLITLYDHWDKYNEPWIKFLLHTVYLR 298

>ADL207W [1534] [Homologous to ScYNL025C (SSN8) - SH]
           complement(339219..340301) [1083 bp, 360 aa]
          Length = 360

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/332 (60%), Positives = 235/332 (70%), Gaps = 31/332 (9%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60
           MS SYW S+QR+ WQ+++ SLA+ RQKLW+LECQL+PQG NI M+           G   
Sbjct: 29  MSASYWDSSQRNKWQYSRESLARTRQKLWMLECQLYPQGTNILMEG---------GGKDA 79

Query: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120
           +P TKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLN+RQ ALATAH+YL+RF L+ S+
Sbjct: 80  QPVTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNVRQYALATAHVYLARFCLKASI 139

Query: 121 REVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXX 180
           REVN           ACKVEECPQ+IRTLV+EARSLWPEFVPPDPTKVT           
Sbjct: 140 REVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLIEELQ 199

Query: 181 XXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240
              IVH+PYR +EQI   L+  P+ L L+ DDLQN WSLINDSYITD +L+YPPH+IAM+
Sbjct: 200 SYMIVHYPYRAMEQIAAALRRPPYNLVLSPDDLQNSWSLINDSYITDVHLLYPPHVIAMA 259

Query: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300
           CLFIT+ L++                        G    QE FN +MA SQVDL EVMDT
Sbjct: 260 CLFITVCLRS----------------------AAGARDLQETFNRFMADSQVDLHEVMDT 297

Query: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSS 332
           IQ+ ITLYDHWDKY+EPW+KFLLH LYLRP +
Sbjct: 298 IQDFITLYDHWDKYNEPWIKFLLHNLYLRPHA 329

>Kwal_27.11494
          Length = 299

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 195/331 (58%), Positives = 230/331 (69%), Gaps = 32/331 (9%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60
           MS SYW STQR  WQ+T+  L +ER +LW+LECQLFPQGL +TM+        N+ GT  
Sbjct: 1   MSASYWESTQRLKWQYTREGLFRERHQLWLLECQLFPQGLTVTME--------NNKGT-G 51

Query: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120
            P ++NIPITH D+HY +D+NLRIYCYFLIMKLGRRLNIRQ ALATAH+YL+RFLLR SV
Sbjct: 52  EPVSRNIPITHIDMHYGKDFNLRIYCYFLIMKLGRRLNIRQYALATAHVYLARFLLRASV 111

Query: 121 REVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXX 180
           REVN           ACKVEECPQ+IRTLV+EARSLWPEFVPPDPTKVT           
Sbjct: 112 REVNLYLLVTTCIYLACKVEECPQHIRTLVNEARSLWPEFVPPDPTKVTEFEFYLLEELQ 171

Query: 181 XXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240
              +VHHPYR +EQIV  L+ EP+ L L+A DLQN WSLINDSYITD +L+ PPH+IAM+
Sbjct: 172 SYLVVHHPYRAMEQIVTALRAEPYNLTLSATDLQNSWSLINDSYITDLHLLVPPHVIAMA 231

Query: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300
            L I + L+                              QE FN +MA+SQVDL EVMDT
Sbjct: 232 SLLIIVCLQR-----------------------PHRPAHQETFNNFMAKSQVDLAEVMDT 268

Query: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPS 331
           IQ+ ITLYD+WDKY+EPW+KFLLH LYLR +
Sbjct: 269 IQDLITLYDYWDKYNEPWIKFLLHCLYLRSA 299

>KLLA0E08151g complement(737811..738725) similar to sp|P47821
           Saccharomyces cerevisiae YNL025c SSN8 DNA-directed RNA
           polymerase II holoenzyme and Kornberg s mediator (SRB)
           subcomplex subunit, cyclin C homolog singleton, start by
           similarity
          Length = 304

 Score =  373 bits (958), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 225/332 (67%), Gaps = 32/332 (9%)

Query: 1   MSGSYWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIM 60
           MS SYW S+QRH W++T+ SLAKE+QKLW+LECQLFPQGLN+T+   K N          
Sbjct: 1   MSASYWDSSQRHKWKYTRESLAKEKQKLWLLECQLFPQGLNVTIHDSKAN---------- 50

Query: 61  RPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLRTSV 120
           +  T NIP+T RDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCAL TAH+YLSRFLLR SV
Sbjct: 51  KQVTTNIPVTQRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALVTAHVYLSRFLLRASV 110

Query: 121 REVNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXX 180
           REVN           ACKVEECPQ+IRTLV+EARSLWPEF+PPD TKVT           
Sbjct: 111 REVNLYLLITTCIYLACKVEECPQHIRTLVNEARSLWPEFIPPDVTKVTEFEFYLIEELQ 170

Query: 181 XXXIVHHPYRPLEQIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMS 240
              IVHHPYR LEQI + L  E +   L+ D+LQ  WSLINDSY TD +L+Y PH+IA+S
Sbjct: 171 SYLIVHHPYRSLEQIEKALSSEKYNYKLSDDELQKIWSLINDSYTTDVHLLYSPHVIAIS 230

Query: 241 CLFITIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYMAQSQVDLEEVMDT 300
           CLF    +     +    +TK  N+                  N+++A++QV+LE+VM  
Sbjct: 231 CLFAVSCI----IHKPEDSTKRANI------------------NMFIAETQVNLEQVMFI 268

Query: 301 IQEQITLYDHWDKYHEPWVKFLLHTLYLRPSS 332
           +QE I+LYDHWDKY+E  ++ LLH LYLR  +
Sbjct: 269 LQELISLYDHWDKYNELRIRALLHELYLRQQT 300

>KLLA0E06666g 605566..606762 similar to sgd|S0006229 Saccharomyces
           cerevisiae YPR025c CCL1 TFIIH subunit (transcription
           initiation factor), cyclin C component, start by
           similarity
          Length = 398

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 101/291 (34%), Gaps = 27/291 (9%)

Query: 5   YWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIMRPTT 64
           Y  S+Q   W FTK  L   R+ L         + L   +      S +  N        
Sbjct: 58  YRHSSQYRLWSFTKEQLESRRRALNAKVVDKVNEKLQDIISKHNDLSQEELNAI----NE 113

Query: 65  KNIPITHRDLHYDRDYNLRIYCYFL--IMKLGRRLNIRQCALATAHIYLSRFLLRTSVRE 122
           K +P+T  +        L+   +F   +      LN+     ATA  +  RF L  S  E
Sbjct: 114 KAVPVTMEE-------ELKFVNFFAKKVQSFCHSLNLPTEVCATAISFFRRFFLVNSTME 166

Query: 123 VNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXXXX 182
           ++           ACK E     I     + +S         PT +              
Sbjct: 167 IHPKHILLASIFLACKSENYFIGIEAFAKKTKS--------QPTTILKYEFDVLESLQFT 218

Query: 183 XIVHHPYRPLEQI---VETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIAM 239
            + HHPYRPL      ++ +      LN       NC   I ++ +TD    Y P  I +
Sbjct: 219 LLNHHPYRPLHGFFLDIQYILHGKVDLNYMGQIYTNCKRRITETLLTDVVYHYTPPQITL 278

Query: 240 SCLFI---TIALKNIDANVGNGNTKNDNLITRALSGENGMSKTQEVFNLYM 287
           +CL I    + LK ++   G+   +  +  T  L  E   S T+   NL +
Sbjct: 279 ACLLIDDEALTLKYLEVKFGSPPEEQKDSETEGLKTEETPSDTKLPSNLKL 329

>Kwal_27.10641
          Length = 376

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 88/246 (35%), Gaps = 26/246 (10%)

Query: 5   YWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIMRPTT 64
           Y  S+Q   W FT   L + R +          Q L    D     S++   G       
Sbjct: 29  YRHSSQYRLWSFTPERLTQMRHETNARARTKIEQDLRAFRDMNPDLSAEELAGI----DE 84

Query: 65  KNIPITHRDLHYDRDYNLRIYCYF--LIMKLGRRLNIRQCALATAHIYLSRFLLRTSVRE 122
           K +P++  +        + +  YF  +++    ++N+     ATA  +  +F L  SV E
Sbjct: 85  KAVPVSAEE-------EILLVNYFARMLLSFANKMNLPTEVAATAISFFRKFYLSNSVAE 137

Query: 123 VNXXXXXXXXXXXACKVEECPQYIRTLVSEARSLWPEFVPPDPTKVTXXXXXXXXXXXXX 182
           ++           ACK E     + +   +AR+          T+               
Sbjct: 138 LSPKEIFHTALFFACKSENYFIGVESFAKKARTT---------TEAVLKHEFRLLESLNF 188

Query: 183 XIV-HHPYRPLEQI---VETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYPPHIIA 238
            I+ HHPY+ L      ++T+      +        +C   I D+ +TDA   Y P  I 
Sbjct: 189 TIMNHHPYKALHGFFLDIQTVLAGKVDMKYMGQVYTDCKKFITDALLTDAVYFYTPPQIT 248

Query: 239 MSCLFI 244
           ++ L +
Sbjct: 249 LATLLM 254

>YPR025C (CCL1) [5459] chr16 complement(613372..614553) Cyclin C
           component of RNA polymerase transcription initiation
           factor TFIIH, required for PolII transcription, for
           nucleotide excision repair, and for activity of Kin28p
           [1182 bp, 393 aa]
          Length = 393

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 95/255 (37%), Gaps = 45/255 (17%)

Query: 5   YWTSTQRHNWQFTKTSLAKER-----QKLWILECQL--FPQGLNITMDAPKPNSSDNSNG 57
           Y  S+Q   W +TK  L ++R     + +  +E  L  F +  N+T +            
Sbjct: 49  YRHSSQYRMWSYTKDQLQEKRVDTNARAIAYIEENLLKFREAHNLTEEE----------- 97

Query: 58  TIMRPTTKNIPITHRDLHYDRDYNLRIYCYFLIMKLGRRLNIRQCALATAHIYLSRFLLR 117
            I     K IP+T      + + +L  +    +  + + LN+    +ATA  +  RF L 
Sbjct: 98  -IKVLEAKAIPLT-----MEEELDLVNFYAKKVQVIAQHLNLPTEVVATAISFFRRFFLE 151

Query: 118 TSVREVNXXXXXXXXXXXACKVEECPQYIRTLVSEARS-----LWPEFVPPDPTKVTXXX 172
            SV +++           ACK E     + +   +A+S     L  EF   +  K +   
Sbjct: 152 NSVMQIDPKSIVHTTIFLACKSENYFISVDSFAQKAKSTRDSVLKFEFKLLESLKFS--- 208

Query: 173 XXXXXXXXXXXIVHHPYRPLEQI---VETLKMEPFQLNLTADDLQNCWSLINDSYITDAN 229
                      + HHPY+PL      ++ +      LN        C   I  + +TD  
Sbjct: 209 ----------LLNHHPYKPLHGFFLDIQNVLYGKVDLNYMGQIYDRCKKRITAALLTDVV 258

Query: 230 LIYPPHIIAMSCLFI 244
             Y P  I ++ L I
Sbjct: 259 YFYTPPQITLATLLI 273

>CAGL0K05115g complement(497262..498365) similar to sp|P37366
           Saccharomyces cerevisiae YPR025c Cyclin, hypothetical
           start
          Length = 367

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 96/251 (38%), Gaps = 35/251 (13%)

Query: 5   YWTSTQRHNWQFTKTSLAKERQKLWILECQLFPQGLNITMDAPKPNSSDNSNGTIMRPTT 64
           Y  S+Q   W FT   L ++R +       +  + L    +  K   + +    I    +
Sbjct: 37  YRHSSQFRLWSFTPDKLLQKRTETNARAVVVIEEKLRAFKEKHKDELTPDVAKVI---DS 93

Query: 65  KNIPITHRDLHYDRDYNLRIYCYFL--IMKLGRRLNIRQCALATAHIYLSRFLLRTSVRE 122
           K  PIT  +        L++  ++   +  + +++++    +AT+  +  RF L  SV E
Sbjct: 94  KATPITTEE-------ELKLVNFYAQKVQVIAQKMSLPTEVVATSISFFRRFFLENSVLE 146

Query: 123 VNXXXXXXXXXXXACKVEECPQYIRTLVSEARS-----LWPEFVPPDPTKVTXXXXXXXX 177
           V            ACK E     + +   +A++     L  EF   +  K T        
Sbjct: 147 VEPKDIVHTTIFLACKSENYFISVNSFAEKAKATKETILKYEFKLLETLKFT-------- 198

Query: 178 XXXXXXIVHHPYRPLE----QIVETLKMEPFQLNLTADDLQNCWSLINDSYITDANLIYP 233
                 + HHPY+PL      I +TL  +   L       + C   I ++ +TDA   Y 
Sbjct: 199 -----LMNHHPYKPLHGFFLDIQKTLHGK-IDLKYMGKIYEKCKKRITEALLTDAVYFYT 252

Query: 234 PHIIAMSCLFI 244
           P  I ++ L I
Sbjct: 253 PPQITLATLMI 263

>Scas_672.12
          Length = 374

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 62/160 (38%), Gaps = 21/160 (13%)

Query: 93  LGRRLNIRQCALATAHIYLSRFLLRTSVREVNXXXXXXXXXXXACKVEECPQYIRTLVSE 152
           + + LN+    +AT+  +  +F L  SV + +           ACK E     + +   +
Sbjct: 135 ISQHLNLPTEIIATSISFFKKFFLENSVMQYDPKSLVHTTIFLACKAENYFISVDSFAKK 194

Query: 153 ARS-----LWPEFVPPDPTKVTXXXXXXXXXXXXXXIVHHPYRPLEQI---VETLKMEPF 204
           A+S     L  EF   +  K +              ++HHPY+PL      ++ +     
Sbjct: 195 AKSNREAILKYEFKLLESLKFS-------------LLIHHPYKPLHGFFLDIQNVLHGKV 241

Query: 205 QLNLTADDLQNCWSLINDSYITDANLIYPPHIIAMSCLFI 244
            LN        C   I ++ +TD   ++ P  I ++ L I
Sbjct: 242 DLNYMGQIYDKCKKKITEAILTDVVYLFTPPQITLAILMI 281

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 254  NVGNGNTKNDNLITRALSGENG---MSKTQEVFNLYMAQSQVDLEEVMDTIQEQITLYDH 310
            NV N +   D++  R LSG+     ++ T EVF L     +  +EEV++ I  + ++Y  
Sbjct: 1080 NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYAR 1139

Query: 311  W--DKYHE 316
               D+ HE
Sbjct: 1140 MSPDEKHE 1147

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,587,043
Number of extensions: 427871
Number of successful extensions: 1259
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1260
Number of HSP's successfully gapped: 15
Length of query: 335
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 233
Effective length of database: 13,065,073
Effective search space: 3044162009
Effective search space used: 3044162009
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)