Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_665.301439143969070.0
YOR291W1472117745740.0
CAGL0M11308g1452119444700.0
Kwal_26.92071469117143150.0
KLLA0B08217g1439116941510.0
AFR567W1449116941340.0
CAGL0L01419g12147407912e-86
YEL031W (SPF1)12157967841e-85
KLLA0E22352g12067957761e-84
AFR354C12108027635e-83
Scas_583.14*8755615661e-59
CAGL0A00517g11228523202e-29
Kwal_14.14989398623183e-29
YGL006W (PMC1)11738423141e-28
CAGL0I04312g9518553112e-28
YGL167C (PMR1)9508182942e-26
KLLA0A03157g9388542906e-26
KLLA0A08910g12808292908e-26
AEL301W9578092872e-25
CAGL0J01870g9468352862e-25
YDR040C (ENA1)10918482844e-25
ADL079C11667972836e-25
YDR039C (ENA2)10918602819e-25
YDR038C (ENA5)10918612819e-25
AGL097C10968482801e-24
KLLA0E14630g10828312737e-24
KLLA0F20658g10828272738e-24
Scas_707.48*7417532701e-23
Kwal_23.316011008522702e-23
YIL048W (NEO1)11516682658e-23
Kwal_23.578911337872585e-22
Sklu_2193.111437922433e-20
KLLA0A04015g13438302381e-19
Kwal_47.1754712404172381e-19
Scas_704.3811617502372e-19
Kwal_26.707013158512301e-18
CAGL0L00715g11445362272e-18
KLLA0C08393g11486582237e-18
CAGL0G06270g13285542164e-17
Scas_499.33462102042e-16
CAGL0K12034g10873162102e-16
ADR350W13112981986e-15
AFL011W12423071888e-14
YAL026C (DRS2)13553811834e-13
Scas_297.18002521815e-13
YDR093W (DNF2)16123261781e-12
AGR120C15474151772e-12
CAGL0L11814g15763331762e-12
KLLA0C17644g15763221727e-12
YER166W (DNF1)15713341663e-11
CAGL0G08085g15783301664e-11
Scas_636.1615543271621e-10
Scas_576.815913221602e-10
Scas_89.12712101505e-10
YGL008C (PMA1)9182731555e-10
Scas_710.419042481467e-09
KLLA0A09031g8993101432e-08
YMR162C (DNF3)16562541404e-08
Kwal_23.355615972511405e-08
KLLA0E01650g15502531395e-08
AGL085C9093021395e-08
CAGL0A00495g9022691378e-08
YPL036W (PMA2)9472741342e-07
CAGL0H04477g16262531342e-07
Scas_688.19133491305e-07
Scas_669.316381841298e-07
AFL191W15751981281e-06
Kwal_47.175228992691252e-06
Scas_569.0d4681011215e-06
KLLA0D04092g11523001182e-05
Kwal_55.21575989731000.002
CAGL0M08602g101249960.005
YBR295W (PCA1)1216244960.006
KLLA0F07447g97551950.007
Scas_505.4102570930.012
Scas_615.994275900.024
AGL041C1233251890.042
ACR086C810124870.060
YDR270W (CCC2)100473860.076
Scas_227.0d30723695.4
KLLA0C17292g1898165698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_665.30
         (1439 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_665.30                                                          2665   0.0  
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...  1766   0.0  
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...  1726   0.0  
Kwal_26.9207                                                         1666   0.0  
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...  1603   0.0  
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...  1597   0.0  
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...   309   2e-86
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...   306   1e-85
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...   303   1e-84
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...   298   5e-83
Scas_583.14*                                                          222   1e-59
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   127   2e-29
Kwal_14.1498                                                          127   3e-29
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   125   1e-28
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   124   2e-28
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   117   2e-26
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   116   6e-26
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   116   8e-26
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   115   2e-25
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   114   2e-25
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   114   4e-25
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   113   6e-25
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   112   9e-25
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   112   9e-25
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   112   1e-24
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   109   7e-24
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...   109   8e-24
Scas_707.48*                                                          108   1e-23
Kwal_23.3160                                                          108   2e-23
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   106   8e-23
Kwal_23.5789                                                          103   5e-22
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          98   3e-20
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    96   1e-19
Kwal_47.17547                                                          96   1e-19
Scas_704.38                                                            96   2e-19
Kwal_26.7070                                                           93   1e-18
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    92   2e-18
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    91   7e-18
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    88   4e-17
Scas_499.3                                                             83   2e-16
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    86   2e-16
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    81   6e-15
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    77   8e-14
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    75   4e-13
Scas_297.1                                                             74   5e-13
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    73   1e-12
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    73   2e-12
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    72   2e-12
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    71   7e-12
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    69   3e-11
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    69   4e-11
Scas_636.16                                                            67   1e-10
Scas_576.8                                                             66   2e-10
Scas_89.1                                                              62   5e-10
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    64   5e-10
Scas_710.41                                                            61   7e-09
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    60   2e-08
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    59   4e-08
Kwal_23.3556                                                           59   5e-08
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    58   5e-08
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    58   5e-08
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    57   8e-08
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    56   2e-07
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    56   2e-07
Scas_688.1                                                             55   5e-07
Scas_669.3                                                             54   8e-07
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    54   1e-06
Kwal_47.17522                                                          53   2e-06
Scas_569.0d                                                            51   5e-06
KLLA0D04092g complement(344666..348124) some similarities with s...    50   2e-05
Kwal_55.21575                                                          43   0.002
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    42   0.005
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    42   0.006
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    41   0.007
Scas_505.4                                                             40   0.012
Scas_615.9                                                             39   0.024
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    39   0.042
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    38   0.060
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    38   0.076
Scas_227.0d                                                            31   5.4  
KLLA0C17292g 1512447..1518143 similar to sp|P37297 Saccharomyces...    31   8.0  

>Scas_665.30
          Length = 1439

 Score = 2665 bits (6907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1317/1439 (91%), Positives = 1317/1439 (91%)

Query: 1    SESEESSDNGRSTYXXXXXXXXXXXXXSTEDXXXXXXXXXXXXXXYQTEYLKPQYHEKFY 60
            SESEESSDNGRSTY             STED              YQTEYLKPQYHEKFY
Sbjct: 1    SESEESSDNGRSTYNNDDLNANNGNNLSTEDTHSHHKKTTTSGGGYQTEYLKPQYHEKFY 60

Query: 61   PSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFGXXXXXXXXXPSYKVK 120
            PSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFG         PSYKVK
Sbjct: 61   PSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFGLLYLLLRWLPSYKVK 120

Query: 121  LIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDDPFQEIDGINDESYQX 180
            LIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDDPFQEIDGINDESYQ 
Sbjct: 121  LIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDDPFQEIDGINDESYQH 180

Query: 181  XXXXXXXVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSS 240
                   VTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSS
Sbjct: 181  RHHHYHHVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTDPDWVDLSSTLRGLSS 240

Query: 241  GVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLI 300
            GVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLI
Sbjct: 241  GVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLI 300

Query: 301  SILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTV 360
            SILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTV
Sbjct: 301  SILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTV 360

Query: 361  FPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNG 420
            FPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNG
Sbjct: 361  FPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNG 420

Query: 421  TTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIA 480
            TTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIA
Sbjct: 421  TTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIA 480

Query: 481  LFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCI 540
            LFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCI
Sbjct: 481  LFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCI 540

Query: 541  SPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFS 600
            SPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFS
Sbjct: 541  SPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFS 600

Query: 601  LNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHS 660
            LNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHS
Sbjct: 601  LNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHS 660

Query: 661  TYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVI 720
            TYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVI
Sbjct: 661  TYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVI 720

Query: 721  VKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTW 780
            VKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTW
Sbjct: 721  VKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTW 780

Query: 781  LYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVG 840
            LYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVG
Sbjct: 781  LYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVG 840

Query: 841  RQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAIT 900
            RQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAIT
Sbjct: 841  RQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAIT 900

Query: 901  GDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGAN 960
            GDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGAN
Sbjct: 901  GDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGAN 960

Query: 961  DCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYS 1020
            DCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYS
Sbjct: 961  DCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYS 1020

Query: 1021 AIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKI 1080
            AIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKI
Sbjct: 1021 AIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKI 1080

Query: 1081 LIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAV 1140
            LIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAV
Sbjct: 1081 LIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDNTILFFISNFQYILTAV 1140

Query: 1141 ILSVGPPYREPMSRNIGFXXXXXXXXXXXXWLMFIDSSSFLGKKFQLTEISFKFKLFILI 1200
            ILSVGPPYREPMSRNIGF            WLMFIDSSSFLGKKFQLTEISFKFKLFILI
Sbjct: 1141 ILSVGPPYREPMSRNIGFIVDVIISIVLSIWLMFIDSSSFLGKKFQLTEISFKFKLFILI 1200

Query: 1201 WVVINYFVQLYVPGXXXXXXXXXXXXXXXXXXXXEQQEMYVVXSITNISMAIDLQXXXXX 1260
            WVVINYFVQLYVPG                    EQQEMYVV SITNISMAIDLQ     
Sbjct: 1201 WVVINYFVQLYVPGSLKKCFKKKRSSKKYKVLLKEQQEMYVV*SITNISMAIDLQDDGHH 1260

Query: 1261 XXXXXXXIMRRSTGPRXXXXXXXXXXXXXXXXXXILGNQPNTETYSGVTFETVPSSIVSF 1320
                   IMRRSTGPR                  ILGNQPNTETYSGVTFETVPSSIVSF
Sbjct: 1261 SEDDEGHIMRRSTGPRASFASTRTTSTSTTLAASILGNQPNTETYSGVTFETVPSSIVSF 1320

Query: 1321 HHPRSFQSSNIFGTSVGSSTLGRRGRDTEPLITXXXXXXXXXXXXXXXNPQFHFFTEDQI 1380
            HHPRSFQSSNIFGTSVGSSTLGRRGRDTEPLIT               NPQFHFFTEDQI
Sbjct: 1321 HHPRSFQSSNIFGTSVGSSTLGRRGRDTEPLITSHSPSPIRRSRSSSRNPQFHFFTEDQI 1380

Query: 1381 NNAEGTSTLENTDYNTPWDATPSYEQERLYGTSNRTSRRSSIYGMSPRSSISHTRSQYG 1439
            NNAEGTSTLENTDYNTPWDATPSYEQERLYGTSNRTSRRSSIYGMSPRSSISHTRSQYG
Sbjct: 1381 NNAEGTSTLENTDYNTPWDATPSYEQERLYGTSNRTSRRSSIYGMSPRSSISHTRSQYG 1439

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 1766 bits (4574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 833/1177 (70%), Positives = 988/1177 (83%), Gaps = 19/1177 (1%)

Query: 47   QTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFGX 106
             +EYLKP YHEKFYP    +L+YQRFYI EEDLV+GIA Y TSKF   IYN  C ++FG 
Sbjct: 276  HSEYLKPDYHEKFYPQYAPNLHYQRFYIAEEDLVIGIAAYQTSKFWYIIYNLCCFLTFGL 335

Query: 107  XXXXXXXXPSYKVKLIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDD- 165
                    P  KVKL G KVPL KAEWVV+ENEFGEF I+PI R+WYNRP+ST+LP ++ 
Sbjct: 336  VYLLTRWLPHLKVKLYGVKVPLAKAEWVVIENEFGEFVIQPIDRQWYNRPLSTVLPFENY 395

Query: 166  --PFQEIDGINDESYQXXXXXXXXVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNW 223
              P  E + IN   +           E NPN+PILITF+YRYI FIYSP++D+FKTNNNW
Sbjct: 396  PNPSYEPNDINLSHHH--------ANEINPNVPILITFEYRYIKFIYSPLDDLFKTNNNW 447

Query: 224  TDPDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSII 283
             DPDWVDLS+   GL+ GVQEDR LAF  NQINLR+KT +E+LFNEVLHPFYVFQ+FSII
Sbjct: 448  IDPDWVDLSTVSNGLTKGVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSII 507

Query: 284  LWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSA 343
            LW +DEYYYYA CIFLIS+LSI D+L E ++  ++LA+MSHF C+VRV RD+FWT ++S+
Sbjct: 508  LWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSS 567

Query: 344  DLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDF 403
            +LVPGDIYE+SDP++T+ PCDS+LLS DCIVNESMLTGESVPVSKFPA  ETM QL DDF
Sbjct: 568  ELVPGDIYEVSDPNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATEETMYQLCDDF 627

Query: 404  QNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGF 463
            Q+TQISS++SKSFL+NGT IIRARI  GQ+AALAMVVRTGFSTTKGSLVRSMVFPKPTGF
Sbjct: 628  QSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGF 687

Query: 464  KFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTI 523
            KFY DSFKYIG M+LIA+FGF +SC+QFIK+GLDK+TMILRALDIITIVVPPALPATLTI
Sbjct: 688  KFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITIVVPPALPATLTI 747

Query: 524  GTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSF 583
            GT FALSRLK+KGIFCISPTR+NI GKID++CFDKTGTLTE+GLDVLGVQ+  P+     
Sbjct: 748  GTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQ 807

Query: 584  QFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQ 643
            +F +L+ D+ ++FPKFSLNDCSSP D++++NFF+SLLTCHSLR VD  L+GDPLDFKMFQ
Sbjct: 808  KFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQ 867

Query: 644  FTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLG 703
            FT WS+EEDFQ++ FHS YE R  D+  PEN +IIPAVVHP+S + ENTF DNDPHNFLG
Sbjct: 868  FTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLG 927

Query: 704  IIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHK 763
            ++RSFEFLSELRRMSVIVK +N+DVYW+FTKGAPEVI++ICNK+TLPA+FEE+L  YTH 
Sbjct: 928  VVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHN 987

Query: 764  GYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASI 823
            GYRVIACAG+ LP+ TWLYSQKVSREEVESN+EFLGFIIF+NKLKKET++TL++LQ+A+I
Sbjct: 988  GYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQNKLKKETSETLKSLQDANI 1047

Query: 824  RTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRT 883
            RT+MCTGDN+LTAISVGR+  LI+  +VYVPS+ +    G+  I+WRDV+  D  LD++T
Sbjct: 1048 RTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKT 1107

Query: 884  LLPI---NNSSST----SYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPD 936
            L P+   NNS  +    +YTLA++GD+FR++F DE N I E+Y+N +LL  +IYARMSPD
Sbjct: 1108 LKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDE-NEIPEEYLNEILLNSSIYARMSPD 1166

Query: 937  EKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVFDISCVL 996
            EKHELM QLQ+L+YTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTS++F+ISCVL
Sbjct: 1167 EKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFNISCVL 1226

Query: 997  DVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIF 1056
            DVI+EGRA LVTSF+CFQYMSLYSAIQFITIT+LYSRGSNLGDFQFLYIDLLLIVPIAI 
Sbjct: 1227 DVIREGRAALVTSFACFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAIC 1286

Query: 1057 MSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGD 1116
            MSWSK Y+KI KKRPSANLVSPKIL+PLL S+ +V LFQ IPWIIVQ   WY+KPIVGGD
Sbjct: 1287 MSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFLFQFIPWIIVQKMSWYIKPIVGGD 1346

Query: 1117 DVVESSDNTILFFISNFQYILTAVILSVGPPYREPMSRNIGFXXXXXXXXXXXXWLMFID 1176
            D V+SSDNT+LFF+SNFQYILTA++LSVGPPYREPMS+N  F             LM +D
Sbjct: 1347 DAVQSSDNTVLFFVSNFQYILTAIVLSVGPPYREPMSKNFEFIVDITVSIGASLLLMTLD 1406

Query: 1177 SSSFLGKKFQLTEISFKFKLFILIWVVINYFVQLYVP 1213
            + S+LGK  QLT IS  F +FI++WV++NY+ QLY+P
Sbjct: 1407 TESYLGKMLQLTPISNSFTMFIIVWVILNYYAQLYIP 1443

 Score =  122 bits (307), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 81/119 (68%), Gaps = 9/119 (7%)

Query: 1298 NQPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRGR---DTEPLITX 1354
            +Q N+E Y+G TFE VPSSIVSFHHP SFQSSN+  +   S  L +RGR   ++EPL+  
Sbjct: 45   DQNNSEPYAGATFEAVPSSIVSFHHPHSFQSSNL-PSPHSSGNLEQRGRRLTESEPLV-- 101

Query: 1355 XXXXXXXXXXXXXXNP-QFHFFTEDQINNAEGTSTLENTDYNTPWDATPSYEQERLYGT 1412
                          NP  F FFT++QI+NAEG STLENTDY+  WDATP+YEQ+R+YGT
Sbjct: 102  --LSSAEQSRSSSRNPSHFRFFTQEQISNAEGASTLENTDYDMAWDATPAYEQDRIYGT 158

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 1726 bits (4470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 809/1194 (67%), Positives = 974/1194 (81%), Gaps = 8/1194 (0%)

Query: 49   EYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFGXXX 108
            E+LKPQYH+KFYP   AD + QR YI+EED+V+ IAGY TSKF + +YN +CI + G   
Sbjct: 267  EFLKPQYHDKFYPEFKADRHIQRAYISEEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLF 326

Query: 109  XXXXXXPSYKVKLIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDDPFQ 168
                  P YKV+++G K PL KAEW+VLENE GEF+IE   REWYNR +STIL LD   +
Sbjct: 327  LIGKWLPKYKVRIVGRKAPLAKAEWLVLENEHGEFTIEEPTREWYNRTLSTILMLDSKTE 386

Query: 169  EIDGINDESYQXXXXXXXXVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTDPDW 228
                   E ++         +E+NPN+PILI+FQYRYI F+YSP++DIFKTNNNW D DW
Sbjct: 387  T------EEFEHGFQRHHHTSEENPNLPILISFQYRYIKFVYSPLDDIFKTNNNWVDFDW 440

Query: 229  VDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLD 288
            VDL +T +GLSSG+QEDR+LAFD NQINL++KT +++LF+EVLHPFY+FQ+ SIILWSLD
Sbjct: 441  VDLETTSKGLSSGIQEDRVLAFDKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLD 500

Query: 289  EYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPG 348
            EYYYYAGCIFLIS+LSI+DTL+ET++  ++LA+MSHF CEVRV R+ FW++++S++LVPG
Sbjct: 501  EYYYYAGCIFLISLLSILDTLIETKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPG 560

Query: 349  DIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQI 408
            DIYEISDP+L + PCDS+LLSGDCIVNESMLTGESVPVSK+PA  ET+LQL DDFQ+TQI
Sbjct: 561  DIYEISDPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQI 620

Query: 409  SSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYED 468
            S++LSKSFLFNGTT+IRA+IP G S ALAM VRTGFSTTKGSL+RSMVFPKP+GFKFY D
Sbjct: 621  STFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSD 680

Query: 469  SFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFA 528
            SFKYIG MA+IA FGFSISCI FIK+GLDKRTMILRALDIITIVVPPALPATLTIGT FA
Sbjct: 681  SFKYIGFMAIIAFFGFSISCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFA 740

Query: 529  LSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADL 588
            L+RLK+KGIFCI+PTRVNIGGKID++CFDKTGTLTE+GLDVLGV++   ++ N   F+DL
Sbjct: 741  LNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFSDL 800

Query: 589  VQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWS 648
            + D H +FPKFSL DCS+P DY+ +NF ISLLTCHSLRVVD EL+GDPLDFKMFQFT WS
Sbjct: 801  ISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWS 860

Query: 649  YEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSF 708
            YEEDFQ  +FHS YEER      PEN DIIPA+VHPN +D  N F+ NDP+N LGIIRSF
Sbjct: 861  YEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSF 920

Query: 709  EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVI 768
            EFLSELRRMSVIVKP+NE+VYWA+TKGAPEVI  ICN ATLP++++++LN+YTH GYRVI
Sbjct: 921  EFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILNFYTHSGYRVI 980

Query: 769  ACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMC 828
            ACAG+ LP+NTWLYSQKV REEVESNMEFLGFIIF+NKLK  T+ TL  L+ A+IRTVMC
Sbjct: 981  ACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMC 1040

Query: 829  TGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPIN 888
            TGDNVLTAISVG++C LI   +VYVP++   D T Q  I W ++ N +  LD+ TL PI+
Sbjct: 1041 TGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPID 1100

Query: 889  NSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRL 948
            + S   YTLAITG++FRIIF +++N  SE+Y+N +LLKG+I+ARMSPDEKHEL+EQLQ++
Sbjct: 1101 DYSG-PYTLAITGEVFRIIFSNQDN-YSEEYVNEILLKGSIFARMSPDEKHELVEQLQKM 1158

Query: 949  NYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVT 1008
            +YTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTS++FDI+CVLDVIKEGRA LVT
Sbjct: 1159 DYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFDITCVLDVIKEGRASLVT 1218

Query: 1009 SFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVK 1068
            SF+CFQYMSLYSAIQFI+IT+LYSRGSNLGDFQFLYIDLLLI+PIA+ MSWSKPY ++ K
Sbjct: 1219 SFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIPIAVTMSWSKPYHELAK 1278

Query: 1069 KRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDNTILF 1128
            KRPSANLVSPKIL+PL+  IV + LFQ +PWI +QG  WY+KPIVGGDD V+SSDNT+LF
Sbjct: 1279 KRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIKPIVGGDDAVQSSDNTVLF 1338

Query: 1129 FISNFQYILTAVILSVGPPYREPMSRNIGFXXXXXXXXXXXXWLMFIDSSSFLGKKFQLT 1188
            +ISNFQYILT+V+LS+GPPYREP+  N+ +             +M ++  S LG   QLT
Sbjct: 1339 YISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLVSFVIMLVNPDSKLGNLLQLT 1398

Query: 1189 EISFKFKLFILIWVVINYFVQLYVPGXXXXXXXXXXXXXXXXXXXXEQQEMYVV 1242
             I     + I IW ++NY+V  +VP                     +Q + YVV
Sbjct: 1399 SIPTGLIILIPIWCMLNYYVLTHVPPKVKQYFRKQRSSKLYKNILRDQSQQYVV 1452

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 91/148 (61%), Gaps = 11/148 (7%)

Query: 1295 ILGNQPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRG---RDTEPL 1351
            ++ +  N+E+Y+G  FE VPSSIVSFH P SFQSS++ G+S+ S+ L R      +TEPL
Sbjct: 35   VIIDHNNSESYAGAAFEAVPSSIVSFHRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPL 94

Query: 1352 ITXXXXXXXXXXXXXXXNPQFHFFTEDQINNAEGTSTLENTDYNTPWDATPSYEQERLYG 1411
                             N  F FFT++Q++ AEG +TLENTDY+  WDA P+YEQE   G
Sbjct: 95   -----YQGNDHSRSSSNNRNFRFFTDEQVSQAEGIATLENTDYDIDWDAAPAYEQENRAG 149

Query: 1412 TSNRTSRRSSIYGMSPRSSISHTRSQYG 1439
             S   SRRSSI  +S RSS+S   S YG
Sbjct: 150  -SYMGSRRSSIRDISRRSSLS--TSPYG 174

>Kwal_26.9207
          Length = 1469

 Score = 1666 bits (4315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 785/1171 (67%), Positives = 937/1171 (80%), Gaps = 14/1171 (1%)

Query: 46   YQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFG 105
            Y  EYLKPQYH++F+P N+  L +QRFYI EEDLVVGIAG+ TSKF    Y  + +++ G
Sbjct: 281  YHAEYLKPQYHDRFFPQNIPHLQFQRFYIAEEDLVVGIAGFRTSKFGKICYYLMSVITLG 340

Query: 106  XXXXXXXXXPSYKVKLIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLD- 164
                     P YKV+L G K  L KAEWVV+ENEFGE SI  + R WYNRP+ST+L +D 
Sbjct: 341  LFYLLLRWVPRYKVRLCGKKTHLAKAEWVVVENEFGELSIIEVSRRWYNRPLSTLLSMDK 400

Query: 165  --DPFQEIDGINDESYQXXXXXXXXVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNN 222
              D  ++I   +   +          +++NPNIPI+I+F YRY   IYSP+ED+FK N+N
Sbjct: 401  IADITEDIPNHHQRHHHE--------SKENPNIPIMISFSYRYFNLIYSPIEDLFKINSN 452

Query: 223  WTDPDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSI 282
            WTD DW+ LSS  +GL + V EDR+LAF  N INL+ KT  E+LF+EVLHPFYVFQIFSI
Sbjct: 453  WTDADWLSLSSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILFDEVLHPFYVFQIFSI 512

Query: 283  ILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNS 342
            +LW  D YYYYA CIF+IS+LSI+DTLVET++T + LA++SH  CEVRV+RD FW  V+S
Sbjct: 513  LLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSS 572

Query: 343  ADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDD 402
            ++LVPGD+YEISDPSL+ FPCDSLLLSGDCIVNESMLTGESVPVSK PA  ET+ QLL+D
Sbjct: 573  SELVPGDVYEISDPSLSTFPCDSLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLED 632

Query: 403  FQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTG 462
            FQ TQIS++L+KSFLFNGT IIR RI   QS ALAMVVRTGFSTTKGSL+RSM+FPKP+G
Sbjct: 633  FQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSG 692

Query: 463  FKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLT 522
            FKFYEDSFKYIG M LIAL GFSISCI FI++GL  + MILRALDIITIVVPPALPATL+
Sbjct: 693  FKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMILRALDIITIVVPPALPATLS 752

Query: 523  IGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNS 582
            IG  FA++RLKKKGIFCI+PTRVN+ GKID++CFDKTGTLTE+GLDVLGV +  P  H +
Sbjct: 753  IGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQN 812

Query: 583  FQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMF 642
            F+F  L+ +V  LF K+SLNDC SP D++++NF +SLLTCHSLRVVD EL+GDPLDFKMF
Sbjct: 813  FRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMF 872

Query: 643  QFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFL 702
            QFT WSY EDFQ+ +FHS  EER + + LPEN  I PAVVHPN+   EN F +NDPHN L
Sbjct: 873  QFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLL 932

Query: 703  GIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTH 762
            G+IRSFEF+SELRRMSVIVKP  E+V+W FTKGAPEVI++ICNK+TLPAN+E++L  YTH
Sbjct: 933  GVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTH 992

Query: 763  KGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEAS 822
             GYRVIACAG+ LP+ TW ++QKVSREEVESNMEFLGF++FENKLK  T  TL +LQ+A 
Sbjct: 993  NGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDAG 1052

Query: 823  IRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSR 882
            IR++MCTGDNVLTAISVGR+  LI    V+VP + +     +  IIWRDVD+ D  LD  
Sbjct: 1053 IRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGV 1112

Query: 883  TLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELM 942
            TL P+N SS   YT+A+TGD+FR++F + N  + E YIN VLLK +IYARMSPDEKHEL+
Sbjct: 1113 TLEPMNGSS--DYTIAVTGDVFRLLFKN-NEVLPESYINMVLLKSSIYARMSPDEKHELV 1169

Query: 943  EQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEG 1002
             QLQ L+Y VGFCGDGANDCGALKAADVG+SLSEAEASVAAPFTS VF+ISC+LDVIKEG
Sbjct: 1170 GQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVFEISCILDVIKEG 1229

Query: 1003 RACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKP 1062
            RA L TSFSCFQYMSLYSAIQF+T+T+LYSRG NLGDFQFLYIDL LIVPIAIFMSWSKP
Sbjct: 1230 RASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQFLYIDLFLIVPIAIFMSWSKP 1289

Query: 1063 YDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESS 1122
            Y K+VKKRPSANLVSPKIL PL+A+I ++L+FQ  PW++VQ   WY  P+VGGDD V+SS
Sbjct: 1290 YHKLVKKRPSANLVSPKILAPLVANIAIILVFQATPWLVVQAMRWYQAPVVGGDDAVQSS 1349

Query: 1123 DNTILFFISNFQYILTAVILSVGPPYREPMSRNIGFXXXXXXXXXXXXWLMFIDSSSFLG 1182
            DNT+LFF SNFQY+LTA++LSVGPPYREPMS+N+GF             LM +   S LG
Sbjct: 1350 DNTVLFFFSNFQYVLTAIVLSVGPPYREPMSKNLGFITDVVISIILNVVLMMVPVDSTLG 1409

Query: 1183 KKFQLTEISFKFKLFILIWVVINYFVQLYVP 1213
            K FQLT+IS  FK ++LIW V+NYF QLY+P
Sbjct: 1410 KVFQLTDISSGFKGYLLIWAVLNYFAQLYIP 1440

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 77/125 (61%), Gaps = 7/125 (5%)

Query: 1301 NTETYSGVTFETVPSSIVSFHHPRSFQS--SNIFGTSVGSSTLGRRGRDTEPLITXXXXX 1358
            +TE Y+G TFETVPSSIVSFHHP SF +  +++  ++  S+ L  R  + E L++     
Sbjct: 45   STEAYAGATFETVPSSIVSFHHPHSFHTNGNSMLESASNSNELHSRSHEAESLLS--SRH 102

Query: 1359 XXXXXXXXXXNPQFHFFTEDQINNAEG-TSTLENTDYNTPWDATPSYEQERL--YGTSNR 1415
                       P F +F+E++I  AEG +STLE+ DY+  WD TP+YEQERL  +  S R
Sbjct: 103  SYSRSQGPSRTPNFRYFSEEEIELAEGVSSTLESADYDINWDGTPTYEQERLHYHNPSGR 162

Query: 1416 TSRRS 1420
            +S RS
Sbjct: 163  SSIRS 167

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 1603 bits (4151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 764/1169 (65%), Positives = 924/1169 (79%), Gaps = 23/1169 (1%)

Query: 46   YQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFG 105
            Y +E+LKPQYH +F+P+NV  L+YQRFYI EEDLVV IAGY TS+F+   Y  +CI++ G
Sbjct: 264  YHSEFLKPQYHSRFFPNNVPYLHYQRFYIAEEDLVVAIAGYRTSRFRLQCYYLLCIITLG 323

Query: 106  XXXXXXXXXPSYKVKLIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDD 165
                     P+ +VK+IG K PLGKAEWVV+ENEFGE ++E +KR WYNRP+ST+L ++ 
Sbjct: 324  LAFLVFRWKPTMRVKMIGEKTPLGKAEWVVVENEFGELTVESVKRRWYNRPLSTVL-MET 382

Query: 166  PFQEIDGINDESYQXXXXXXXXVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTD 225
                I       Y          TE NPN+PILI+FQYRY T +YSP++DIF++N+NW D
Sbjct: 383  NEDRIGTPESRHYHHHE------TEWNPNLPILISFQYRYFTLVYSPIDDIFRSNSNWAD 436

Query: 226  PDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILW 285
            PDW+DL     GL+S +QEDR LAF  N +NL+ KTV E+LF+E LHPFYVFQIFSIILW
Sbjct: 437  PDWLDLEVVQHGLTSSIQEDRTLAFGKNSVNLKQKTVTEILFDEALHPFYVFQIFSIILW 496

Query: 286  SLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADL 345
              D+YYYYAGCIFLIS+LSI+DT++ET++  + LAD+SHF CEVRV++D FWT VNS+DL
Sbjct: 497  LADDYYYYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDL 556

Query: 346  VPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQN 405
            VPGD++EISDPSL V PCD++L+SGDCIVNESMLTGESVPVSK+ A   TM QLL DF++
Sbjct: 557  VPGDLFEISDPSLVVLPCDAVLISGDCIVNESMLTGESVPVSKYAATEATMAQLLQDFKS 616

Query: 406  TQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKF 465
            +Q+SS++SKSFLFNGT IIR R   GQ  ALA+V+RTGFSTTKGSLVRSMVFPKP GFKF
Sbjct: 617  SQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKF 676

Query: 466  YEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGT 525
            YEDSFKYIG M LIA+FGFSISCIQFI++GL+ + MILRALDIITIVVPPALPATLTIGT
Sbjct: 677  YEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGT 736

Query: 526  GFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNS-FQ 584
             FAL RLKKKGIFCISPTRVN+GGK+D++CFDKTGTLTE GLDVLG+    P   ++  Q
Sbjct: 737  SFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQ 796

Query: 585  FADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQF 644
             +DL+ D  ++  K +L+DC+S  +++AKNF +SLLTCHSL+ +D EL+GDPLD KMF+F
Sbjct: 797  LSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEF 856

Query: 645  TKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGI 704
            TKW+YEE          YE  +  NA  +   I PAVVHP S      FI+NDP N +G+
Sbjct: 857  TKWAYEEG---------YESWKFKNA-EDKTGISPAVVHPTS---NCNFIENDPDNLIGV 903

Query: 705  IRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKG 764
            IRSFEFLSELRRMSVIVK   E+ YW+FTKGAPEVI  ICN AT+P +F E+L++YTH G
Sbjct: 904  IRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLHHYTHNG 963

Query: 765  YRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIR 824
            +R+IACAG+ LP+++WLYSQKVSREEVE N+EFLGFI+FENKLK  T   L+ LQ A+IR
Sbjct: 964  FRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIR 1023

Query: 825  TVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTL 884
            TVMCTGDNVLTA+SVGR   LI S++V++P L +     +  + WRDVD     LD+ TL
Sbjct: 1024 TVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTL 1083

Query: 885  LPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQ 944
             P+N+    SYTLAITGDIFRI+F ++   + +DYI+TVL+KG+IYARMSPDEKHEL+EQ
Sbjct: 1084 KPLNDPEK-SYTLAITGDIFRILFRND-EILPDDYISTVLMKGSIYARMSPDEKHELVEQ 1141

Query: 945  LQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRA 1004
            LQ+L+Y VGFCGDGANDCGALKAA++GISLSEAEASVAAPFTS VFDISCVLDVIKEGRA
Sbjct: 1142 LQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDISCVLDVIKEGRA 1201

Query: 1005 CLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYD 1064
             LVTSFSCFQYMSLYSAIQFITIT+LYSRGSNLGDFQFLYIDLLLIVPIAI MSWSKP  
Sbjct: 1202 SLVTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLLIVPIAISMSWSKPNS 1261

Query: 1065 KIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDN 1124
            K+VKKRPSANLVSPKIL+PL  +I ++L+FQ++PWI VQ   WYMKP+VGGDD V+SSDN
Sbjct: 1262 KLVKKRPSANLVSPKILVPLCLNITLILIFQLLPWIAVQYTSWYMKPVVGGDDAVQSSDN 1321

Query: 1125 TILFFISNFQYILTAVILSVGPPYREPMSRNIGFXXXXXXXXXXXXWLMFIDSSSFLGKK 1184
            T+LFF+SNFQYILTAV+LS GPPYREPM +NIGF             LM+++  ++LG+ 
Sbjct: 1322 TVLFFVSNFQYILTAVVLSQGPPYREPMIKNIGFILDISLSMLVSFGLMYLNVQTWLGEL 1381

Query: 1185 FQLTEISFKFKLFILIWVVINYFVQLYVP 1213
             QLT IS  FK  IL     NY+   Y+P
Sbjct: 1382 LQLTNISDTFKWLILTTAAANYYASKYIP 1410

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 78/125 (62%), Gaps = 6/125 (4%)

Query: 1299 QPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSST-LGRRGRDTEPLITXXXX 1357
            Q NTE YSG   ETVPSSIVSF+HP SFQSS  +G S GSST L RRGR +E        
Sbjct: 43   QNNTEPYSGAAVETVPSSIVSFYHPHSFQSSG-YGASAGSSTNLERRGRSSEH-DPLLLS 100

Query: 1358 XXXXXXXXXXXNPQFHFFTEDQINNAEG-TSTLENTDYNTPWDATPSYEQERLY--GTSN 1414
                          F FFTE+Q+ NAEG TS++EN DY+  WDA P+YEQERL+    S+
Sbjct: 101  TTTSRRSSSSRGRGFQFFTEEQVENAEGITSSVENADYDMDWDAIPTYEQERLHIQPRSS 160

Query: 1415 RTSRR 1419
            +TS R
Sbjct: 161  KTSLR 165

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 1597 bits (4134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 753/1169 (64%), Positives = 930/1169 (79%), Gaps = 19/1169 (1%)

Query: 46   YQTEYLKPQYHEKFYPSNVADLYYQRFYITEEDLVVGIAGYSTSKFKNAIYNFICIVSFG 105
            Y  EYLKP+YH++FYP NV  L+ QRFYI EED+VVGIAGY TS +K  IYN  C ++ G
Sbjct: 270  YHAEYLKPRYHDRFYPRNVPHLHMQRFYIAEEDMVVGIAGYRTSAWKTYIYNIFCCLTLG 329

Query: 106  XXXXXXXXXPSYKVKLIGTKVPLGKAEWVVLENEFGEFSIEPIKREWYNRPISTILPLDD 165
                     P YKVK  G+K  LGKAEWVV+EN++ E SI  +KR WYNRP+ST+LPL  
Sbjct: 330  MLYILCKWIPRYKVKFCGSKTFLGKAEWVVVENQYSELSIINVKRIWYNRPLSTVLPLKR 389

Query: 166  PFQEIDGINDESYQXXXXXXXXVTEKNPNIPILITFQYRYITFIYSPVEDIFKTNNNWTD 225
                   +N   Y          +E+NPNIPILI+F+YRY+T IYSP+ DIF+TN NW D
Sbjct: 390  GL-----LNSRHYHHE-------SEENPNIPILISFEYRYLTLIYSPLTDIFQTNTNWAD 437

Query: 226  PDWVDLSSTLRGLSSGVQEDRILAFDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILW 285
            PDW DLS   RGL + + EDR++AF  N INLR KT +++LF+E LHPFY+FQIFSIILW
Sbjct: 438  PDWTDLSLVSRGLPNNIHEDRMIAFGKNSINLRQKTTSQILFDEALHPFYIFQIFSIILW 497

Query: 286  SLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADL 345
              D YYYYA CIF+IS+LS++DTLVET+++ + L+++S F C+VRV+RD FW+ V S+DL
Sbjct: 498  MFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDL 557

Query: 346  VPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQN 405
            VPGDIYE++DPSL++ PCDS+L+SGDC+VNESMLTGESVPVSK  A  ETMLQLLDDF +
Sbjct: 558  VPGDIYELTDPSLSLLPCDSILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMD 617

Query: 406  TQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKF 465
            TQ+SS++SKSFLFNGT +IR R   GQS AL MV RTGFSTTKGSLVRSMVFPKPTGFKF
Sbjct: 618  TQLSSFVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKF 677

Query: 466  YEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGT 525
            YEDSFKYIG +++IALFGF++S IQF+++GLDKRTMILRALDIIT+VVPPALPA+L+IGT
Sbjct: 678  YEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDIITVVVPPALPASLSIGT 737

Query: 526  GFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQF 585
            GFAL+RLKKKGIFCISPTRVN+GGKID++CFDKTGTLTE+GLDVLGV +  P      + 
Sbjct: 738  GFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDVLGVHVVQP-LQQEMKI 796

Query: 586  ADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFT 645
            + LV DV  L    SL+DC S RD +AKNF +SLLTCHSLR+VD EL+GDP DFKM QFT
Sbjct: 797  SKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDGELLGDPFDFKMVQFT 856

Query: 646  KWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGII 705
            KWS EE+   ++ HS YEER   + +PEN    PA+VHP+    +  FI+ +P N +GI+
Sbjct: 857  KWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSG---KGRFIEREPSNVIGIV 913

Query: 706  RSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGY 765
            RSFEFLS LRRMSVIVKP +E+V+ +FTKGAPEVI ++C+K TLP ++E +L++YTH GY
Sbjct: 914  RSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGY 973

Query: 766  RVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRT 825
            RVIACAG+ L R +WLYSQKVSREE+ESN+EFLGFIIFENKLK  T +TL++L  A IRT
Sbjct: 974  RVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRT 1033

Query: 826  VMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSII-WRDVDNMDDTLDSRTL 884
            +MCTGDNVLTAISVGR+  L++S +V+V  + +ID++ +  II W++V N  DTLDS TL
Sbjct: 1034 IMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTL 1093

Query: 885  LPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQ 944
             P++  +   YTLA+TG++FR++F  + + I E+ IN +LLK +IYARMSPDEKHEL+E+
Sbjct: 1094 RPLSGDTD-DYTLAVTGEVFRLLFKTDKSQI-EEVINNILLKTSIYARMSPDEKHELVER 1151

Query: 945  LQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRA 1004
            LQ + Y VGFCGDGANDCGALKAAD+GISLSEAEASVAAPFTS++F+ISCVLDV+KEGRA
Sbjct: 1152 LQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLFEISCVLDVMKEGRA 1211

Query: 1005 CLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYD 1064
             LVTSF+CFQYMSLYSA QF+TI +LYSRGSNLGDFQFLYIDL LIVP+A+FMSWSKPY+
Sbjct: 1212 ALVTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDLFLIVPLAVFMSWSKPYE 1271

Query: 1065 KIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVGGDDVVESSDN 1124
             + KKRP+ANLVSPKILIPLL  IV++ +FQ++PW+ VQ  +WY +P+VG D+ V SSDN
Sbjct: 1272 VLAKKRPTANLVSPKILIPLLVHIVILFVFQLVPWLAVQHMKWYRQPVVGDDEHVASSDN 1331

Query: 1125 TILFFISNFQYILTAVILSVGPPYREPMSRNIGFXXXXXXXXXXXXWLMFIDSSSFLGKK 1184
            TILFF+SNFQYIL AV+LSVGPPYREPMS+N+GF             +MF+   S LG+ 
Sbjct: 1332 TILFFVSNFQYILVAVVLSVGPPYREPMSKNVGFIADVLVSLVASCRIMFLSPDSTLGRL 1391

Query: 1185 FQLTEISFKFKLFILIWVVINYFVQLYVP 1213
            FQLTE S  F L I+ WV +NY+ QLY+P
Sbjct: 1392 FQLTEASHPFCLLIIGWVFLNYYAQLYIP 1420

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 84/145 (57%), Gaps = 6/145 (4%)

Query: 1299 QPNTETYSGVTFETVPSSIVSFHHPRSFQSSNIFGTSVGSSTLGRRGRDTEP-LITXXXX 1357
            Q N+E Y+G +FE VPSSIVSFHHP S++ S  FG SV      RR   +E  L++    
Sbjct: 42   QRNSEAYAGASFEAVPSSIVSFHHPHSYR-SGAFG-SVDMLERSRRNTGSESVLLSPVRS 99

Query: 1358 XXXXXXXXXXXNPQFHFFTEDQINNAEG-TSTLENTDYNTPWDATPSYEQERLYGT--SN 1414
                          F FF+E Q+ NAEG  STLE TDY+T WDATP+YEQERL+    S+
Sbjct: 100  RTSEISRTPSRATHFRFFSEQQLENAEGAASTLEYTDYDTDWDATPAYEQERLHMNPRSS 159

Query: 1415 RTSRRSSIYGMSPRSSISHTRSQYG 1439
            R+S R+   G  P S+ + +   YG
Sbjct: 160  RSSLRNGSVGRGPSSTRAQSIQSYG 184

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score =  309 bits (791), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 216/740 (29%), Positives = 356/740 (48%), Gaps = 98/740 (13%)

Query: 250 FDSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTL 309
           + +N+ ++ + T  EL     + P +VFQ+F + LW LDEY+Y +    L  ILS+    
Sbjct: 175 YGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWYLS-LFNLFMILSMEAAS 233

Query: 310 VETRRTQ-KSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSL-TVFPCDSLL 367
           V  R T  K    M      + V RD  W  + + +L+P D+  +   +  +  PCD +L
Sbjct: 234 VFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLIL 293

Query: 368 LSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRAR 427
           + G CIVNE+ML+GES P+ K        ++L    +  QI      S L  GT +++  
Sbjct: 294 VDGTCIVNEAMLSGESTPLLK------ESIRLRPGNEELQIEGTDKISVLHGGTKVLQVT 347

Query: 428 IPYG--------QSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALI 479
            P             A+A+V +TGF T++GSLVR M++         +++  +I  + + 
Sbjct: 348 TPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYFILFLLIF 407

Query: 480 ALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFC 539
           A+       ++  K+G  +  +IL  + IIT VVPP LP  LT+    +LS L K  ++C
Sbjct: 408 AVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVNSSLSALSKFYVYC 467

Query: 540 ISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKF 599
             P R+   G+ID+ CFDKTGTLT   L   G+             A L  D   +   +
Sbjct: 468 TEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGL-------------AGLSSDPKDIRHLY 514

Query: 600 SLNDCSSPRDYRAKNFFISLLTCHSL-RVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEF 658
           S  DC +          + +   H+L R+ D E++GDP++    +  KW+ E+   +K F
Sbjct: 515 SATDCPNSTS-------LVVGAAHALVRLEDGEIVGDPMEKATLKALKWTVEKG--DKVF 565

Query: 659 HSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMS 718
                                                N+ +  + I+R F+F S L+R S
Sbjct: 566 -------------------------------------NEKNGQVTILRRFQFSSALKRSS 588

Query: 719 VIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRN 778
            +   +++   ++  KGAPE I +     T+PAN++E+   +T  G RV+A A + L + 
Sbjct: 589 SVA--THDGKLYSAVKGAPETIRE--RLFTIPANYDEIYKSFTRSGSRVLALASKKLEKM 644

Query: 779 TWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAIS 838
           +    +   RE  E ++EF GF+IF   LK +  +T+Q L E++ R VM TGDN LTA+ 
Sbjct: 645 SQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVH 704

Query: 839 VGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSS----TS 894
           V ++  ++K + + V   + +D+     +++R   N+++TL    ++  ++         
Sbjct: 705 VAKEVGIVKGETLIV---DMVDNGNDDKLVFR---NVEETLSFEFVVSKDSFEKYGIFDK 758

Query: 895 YTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGF 954
           Y LA+TG     + G          +  ++    IYAR+SP +K  ++  L+ + Y    
Sbjct: 759 YDLAVTGHALEALKGHHQ-------LQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLM 811

Query: 955 CGDGANDCGALKAADVGISL 974
           CGDG ND GALK A VG++L
Sbjct: 812 CGDGTNDVGALKQAHVGVAL 831

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 111/239 (46%), Gaps = 18/239 (7%)

Query: 973  SLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYS 1032
            +L   +AS AAPFTS++ ++S V ++I++GR  LV +   ++ ++L   I   +++++Y 
Sbjct: 950  TLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 1009

Query: 1033 RGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVL 1092
             G   GD Q     LLL V   + +S  KP  K+ K RP A + +  I+  +L+  VV  
Sbjct: 1010 AGVKFGDGQATTSGLLLSVCF-LSISRGKPLQKLSKARPQAGIFNVYIMGSILSQFVV-- 1066

Query: 1093 LFQIIPWIIVQGEEWYMKPIVGGDDV----VESSDNTILFFISNFQYILTAVILSVGPPY 1148
               I   I +  E + ++P     D+      S  NT +F I   Q + T  +   G P+
Sbjct: 1067 --HIGTLIYLTNEIYRLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPF 1124

Query: 1149 REPMSRNIGFXXXXXXXXXXXXWLMFIDSSSFL-----GKKFQLTEISFKFKLFILIWV 1202
            RE +  N G              L    ++ F+       KF   E  FK KL I ++V
Sbjct: 1125 RENIRSNKGMYYGLLGVTG----LALASATEFIPELNEAMKFVPMEDDFKMKLTITLFV 1179

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score =  306 bits (784), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 232/796 (29%), Positives = 376/796 (47%), Gaps = 112/796 (14%)

Query: 201 FQYRYITFIYSPVEDIFKTNNNWTD--PDWVDLSSTLRGLSSGVQEDRILAFDSNQINLR 258
           FQ++   F++   E +F +     D  P   D     +G S  +   + L +  N  ++ 
Sbjct: 128 FQFQKKRFLWHENEQVFSSPKFLVDESPKIGDFQKC-KGHSGDLTHLKRL-YGENSFDIP 185

Query: 259 VKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQ-K 317
           + T  EL     + P +VFQ+F + LW LDE++YY+    L  I+S+    V  R T  K
Sbjct: 186 IPTFMELFKEHAVAPLFVFQVFCVALWLLDEFWYYS-LFNLFMIISMEAAAVFQRLTALK 244

Query: 318 SLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSL-TVFPCDSLLLSGDCIVNE 376
               M      + VFR++ W  + + +L+P D+  I+  +  +  PCD +LL G  IVNE
Sbjct: 245 EFRTMGIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAIVNE 304

Query: 377 SMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQS--- 433
           +ML+GES P+ K        ++L     N Q+      + L  GT  ++   P  +S   
Sbjct: 305 AMLSGESTPLLK------ESIKLRPSEDNLQLDGVDKIAVLHGGTKALQVTPPEHKSDIP 358

Query: 434 -----AALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISC 488
                 ALA+V +TGF T++GSLVR M++         +++  +I  + + A+       
Sbjct: 359 PPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIASWYVW 418

Query: 489 IQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIG 548
           ++  K+G  +  +IL  + IIT VVPP LP  LT+    +L+ L K  ++C  P R+   
Sbjct: 419 VEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFA 478

Query: 549 GKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPR 608
           G+ID+ CFDKTGTLT   L   G+      S N          +  L+     +   +P 
Sbjct: 479 GRIDVCCFDKTGTLTGEDLVFEGLAGISADSEN----------IRHLY-----SAAEAP- 522

Query: 609 DYRAKNFFISLLTCHSL-RVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRH 667
               ++  + +   H+L ++ D +++GDP++    +   W+ E        +S Y E   
Sbjct: 523 ----ESTILVIGAAHALVKLEDGDIVGDPMEKATLKAVGWAVERK------NSNYREGTG 572

Query: 668 DNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNED 727
                                             L IIR F+F S L+R + I   S+ D
Sbjct: 573 K---------------------------------LDIIRRFQFSSALKRSASIA--SHND 597

Query: 728 VYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVS 787
             +A  KGAPE I +    + +P N++E+   +T  G RV+A A + LP+ +      ++
Sbjct: 598 ALFAAVKGAPETIRE--RLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMSQSKIDDLN 655

Query: 788 REEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIK 847
           R++VES + F GF+IF   LK +  +T++ L E+S R++M TGDN LTA+ V ++  ++ 
Sbjct: 656 RDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVF 715

Query: 848 SKKVYVPSLEEIDSTGQTSIIWRDV--------DNMDDTLDSRTLLPINNSSSTSYTLAI 899
            + +    L+    +    +++RDV        D   DT D   L          Y +A+
Sbjct: 716 GETLI---LDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLF-------DRYDIAV 765

Query: 900 TGDIFRIIFGDENNSISEDYINTVLLKGT-IYARMSPDEKHELMEQLQRLNYTVGFCGDG 958
           TG     +   E +S   D     LL+ T +YAR+SP +K  L+  L+ + Y    CGDG
Sbjct: 766 TGYALNAL---EGHSQLRD-----LLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDG 817

Query: 959 ANDCGALKAADVGISL 974
            ND GALK A VGI+L
Sbjct: 818 TNDVGALKQAHVGIAL 833

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 97/195 (49%), Gaps = 9/195 (4%)

Query: 968  ADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITI 1027
             D   +L   +AS AAPFTS++ ++S V ++I++GR  LV +   ++ ++L   I   ++
Sbjct: 947  GDEAPALKLGDASCAAPFTSKLANVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSL 1006

Query: 1028 TVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLAS 1087
            +++Y  G   GD Q     LLL V   + +S  KP +K+ K+RP + + +  I+  +L+ 
Sbjct: 1007 SIIYMAGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKQRPQSGIFNVYIMGSILSQ 1065

Query: 1088 IVVVLLFQIIPWIIVQGEEWYMKPIVGGDDV----VESSDNTILFFISNFQYILTAVILS 1143
              V     I   + +  E + ++P     D+      S  NT +F I   Q + T  +  
Sbjct: 1066 FAV----HIATLVYITTEIYKLEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNY 1121

Query: 1144 VGPPYREPMSRNIGF 1158
             G P+RE +  N G 
Sbjct: 1122 QGEPFRENIRSNKGM 1136

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score =  303 bits (776), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 227/795 (28%), Positives = 382/795 (48%), Gaps = 111/795 (13%)

Query: 201 FQYRYITFIYSPVEDIFKTNNNWTD--PDWVDLSSTLRGLSSGVQEDRILAFDSNQINLR 258
           FQ++   F++     +F +     D  P   +  ++ +GL+  +   + L +  N  ++ 
Sbjct: 127 FQFQKKRFLWHEETQVFSSPKFLVDGSPKIAEFQNS-KGLNGDLTHHKRL-YGENSFDIP 184

Query: 259 VKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQ-K 317
           + T  EL     + PF++FQ+F + LW  D+ +YY+    L  I+++  T V  R T  K
Sbjct: 185 IPTFLELFKEHAVAPFFIFQLFCVALWLFDDLWYYS-LFNLFMIVAMEATSVFQRLTTLK 243

Query: 318 SLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSL-TVFPCDSLLLSGDCIVNE 376
               M      + VFRD  W  + +  L P D+  I+  +  +  PCD LL+ G CIVNE
Sbjct: 244 EFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLIDGSCIVNE 303

Query: 377 SMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSA-- 434
           +ML+GES P+ K        ++L       Q+      + L  GT  ++   P  ++   
Sbjct: 304 AMLSGESTPLLK------ESIKLRPANDQLQLDGVDKNAVLHGGTKALQVTAPENRTGVI 357

Query: 435 ------ALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISC 488
                 ALA+V +TGF T++GSLVR M+F         +++  +I  + + A+       
Sbjct: 358 TPPDGGALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKEALYFILFLLIFAIVASWYVW 417

Query: 489 IQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIG 548
            +  ++G  +  +IL  + IIT VVPP LP  LT+    +L+ L K  ++C  P R+   
Sbjct: 418 KEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPYA 477

Query: 549 GKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPR 608
           G+ID+ CFDKTGTLT   L   G+       H+         D+  L    S ND S   
Sbjct: 478 GRIDVCCFDKTGTLTAEDLVFEGLA----GLHDG-------SDIRTL---KSANDAS--- 520

Query: 609 DYRAKNFFISLLTCHSL-RVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRH 667
               +    ++   H+L ++ D E++GDP++    + + W+   DF++            
Sbjct: 521 ----QEVLSAIGAAHALVKLDDGEIVGDPMEKATLKASSWTV--DFKD------------ 562

Query: 668 DNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNED 727
                        VV    AD             + I+R F+F S L+R + I   SN  
Sbjct: 563 -------------VVKRAGADN------------IRILRRFQFSSSLKRSASIASQSNR- 596

Query: 728 VYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVS 787
            ++A  KGAPE I +  N  ++P++++++   +T  G RV+A A + LP+ +      + 
Sbjct: 597 -FFAAVKGAPETIRERLN--SVPSDYDDIYKSFTRSGSRVLALAYKDLPKMSNSQIDNID 653

Query: 788 REEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIK 847
           R+E+E+ + F  F++F   LK +  +T++ L E+S R++M TGDN LTA+ V ++  ++ 
Sbjct: 654 RDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVD 713

Query: 848 SKKVYVPSLEEIDSTGQTSIIWRDVD-------NMD-DTLDSRTLLPINNSSSTSYTLAI 899
            + + +   E ID +   +++ RDV+       N D DT D + +          Y LA+
Sbjct: 714 RETLILD--EPIDGSSH-ALVMRDVNETIVKPFNPDADTFDEKEIF-------QKYDLAV 763

Query: 900 TGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGA 959
           TG   +++ G +        +  V+    IYAR+SP +K  ++  L+ + Y    CGDG 
Sbjct: 764 TGHALKLLQGHKQ-------LRDVIRHTWIYARVSPSQKEFILITLKDMGYQTLMCGDGT 816

Query: 960 NDCGALKAADVGISL 974
           ND GALK A VGI+L
Sbjct: 817 NDVGALKQAHVGIAL 831

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 98/190 (51%), Gaps = 9/190 (4%)

Query: 973  SLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYS 1032
            SL   +AS AAPFTS++ +++ V ++I++GR  L+ +   ++ ++L   I   +++V+Y 
Sbjct: 949  SLKLGDASCAAPFTSKLANVNAVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYL 1008

Query: 1033 RGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVL 1092
             G   GD Q     LLL V   + +S  KP +K+ K+RP   + +    I ++ SI+   
Sbjct: 1009 AGVKFGDGQATVSGLLLSVCF-LSISRGKPLEKLSKERPQPGIFN----IYIMGSILGQF 1063

Query: 1093 LFQIIPWIIVQGEEWYMKPIVGGDDV----VESSDNTILFFISNFQYILTAVILSVGPPY 1148
               I+  + +  E + ++P     D+    V S  NT +F +   Q + T V+   G P+
Sbjct: 1064 AVHILTLVYITTEIYKIEPREPQVDLEKEFVPSLLNTGIFMVQLAQQVSTFVVNYQGEPF 1123

Query: 1149 REPMSRNIGF 1158
            RE +  N G 
Sbjct: 1124 RENIKNNKGM 1133

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score =  298 bits (763), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 225/802 (28%), Positives = 383/802 (47%), Gaps = 123/802 (15%)

Query: 201 FQYRYITFIYSPVEDIFKTNNNWTD--PDWVDLSSTLRGLSSGVQEDRILAFDSNQINLR 258
           FQ++   F++      F +     D  P    L  + RGLS  +   ++L +  N  ++ 
Sbjct: 128 FQFQKKRFLWQADLQAFSSPKFLVDEEPKLGKLQQS-RGLSGDLTHMKLL-YGENTFDIP 185

Query: 259 VKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAG----CIFLISILSIVDTLVETRR 314
           V +  EL     + PF+VFQIF + LW  D+ +Y +      IF +  +S+   L     
Sbjct: 186 VPSFLELFKEHAVEPFFVFQIFCVALWLFDQMWYLSLFNLFMIFAMEAVSVFQRLT---- 241

Query: 315 TQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEIS----DPSLTVFPCDSLLLSG 370
           T K    M      + VFRD  W  + + +L+P D+  ++    D +L+   CD +L+ G
Sbjct: 242 TLKEFKTMGIKPYGINVFRDSKWQLLQTNELLPMDLISVTRTDEDSALS---CDMILVDG 298

Query: 371 DCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPY 430
            CIVNE+ML+GES P+ K        ++L    +  Q+      S L  GT +++   P 
Sbjct: 299 TCIVNEAMLSGESTPLLK------ESVKLRSSEEKLQVEGLDKNSVLHGGTKVLQVTAPE 352

Query: 431 GQSA---------ALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL 481
             S+         ALA+V +TGF T++G+LVR M++         +++  +I  + + A+
Sbjct: 353 KGSSSIPAPPDGGALAVVSKTGFETSQGALVRVMIYSSERVSVGNKEALYFILFLLIFAI 412

Query: 482 FGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCIS 541
                  ++  ++G  +  +IL  + IIT VVP  LP  LT+    +L+ L K  ++C  
Sbjct: 413 AASWYVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKFYVYCTE 472

Query: 542 PTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSL 601
           P R+ + G+ID+ CFDKTGTLT  G D++   L   +  N        Q V+ LF     
Sbjct: 473 PFRIPLAGRIDVCCFDKTGTLT--GEDLVFEGLAGLAGKN--------QPVNHLF----- 517

Query: 602 NDCSSPRDYRAKNFFISLLTCHSL-RVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHS 660
                P D    N  I     H+L R+ D+E++GDP++      T W             
Sbjct: 518 KGTEVPLD---TNLVIG--AAHALVRLDDDEVVGDPMEKATLAATGW------------- 559

Query: 661 TYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVI 720
                         + +  ++ +    D             + I+R F+F S L+R S I
Sbjct: 560 -------------KVGVKDSLSNEKVGD-------------ISILRRFQFSSALKRSSTI 593

Query: 721 VKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTW 780
              + +  +++  KGAPE I +  ++  +P +++++   +T  G RV+A A + LP  + 
Sbjct: 594 AVHNKQ--HYSAVKGAPETIRERLSQ--VPTDYDQVYKSFTRAGSRVLALASKKLPSMSI 649

Query: 781 LYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVG 840
              +K+ RE VES++EF GF++F   LK +  +T++ L E+S R +M TGDN LTA+ V 
Sbjct: 650 KQIEKLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVA 709

Query: 841 RQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNM--------DDTLDSRTLLPINNSSS 892
           ++  +++ + + +   E ID +   ++++R+++           DT +   L        
Sbjct: 710 KEVAIVERETLILD--EPIDGSSH-ALVFRNIEETIVNPFNPEKDTFEHSKLF------- 759

Query: 893 TSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTV 952
             Y +A+TG   +++ G          +N ++    +YAR+SP +K  +M  L+ + Y  
Sbjct: 760 AKYDIAVTGHALQLLSGHSQ-------LNELIRHTWVYARVSPAQKEFIMNSLKDMGYQT 812

Query: 953 GFCGDGANDCGALKAADVGISL 974
             CGDG ND GALK A VGI+L
Sbjct: 813 LMCGDGTNDVGALKQAHVGIAL 834

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 99/205 (48%), Gaps = 13/205 (6%)

Query: 958  GANDCGALKAADVGISLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMS 1017
            G ND      +D   +L   +AS AAPFTS++ ++S V ++I++GR  L+ +   ++ ++
Sbjct: 942  GLND----SESDDAPTLKLGDASCAAPFTSKLANVSAVTNIIRQGRCALINTIQMYKILA 997

Query: 1018 LYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVS 1077
            L   I   +++V+Y  G   GD Q   +  LLI    + +S  +P +K+ K+RP   + +
Sbjct: 998  LNCLITAYSLSVIYLAGVKFGDVQ-ATVSGLLITVCFLSISRGQPLEKLSKERPQPGIFN 1056

Query: 1078 PKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKP----IVGGDDVVESSDNTILFFISNF 1133
              I+  +L    V     I     +  E ++++P    I    D   S  NT +F I   
Sbjct: 1057 VYIMGSILGQFAV----HIAALAYINREIYFLEPREPQIDLEKDFSPSLLNTGIFLIQLA 1112

Query: 1134 QYILTAVILSVGPPYREPMSRNIGF 1158
            Q + T  +   G P+RE +  N G 
Sbjct: 1113 QQVSTFAVNYQGEPFRENIRSNKGM 1137

>Scas_583.14*
          Length = 875

 Score =  222 bits (566), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 162/561 (28%), Positives = 264/561 (47%), Gaps = 111/561 (19%)

Query: 434 AALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGV------MALIALFGFSIS 487
            AL +V +TGF T +GSLVR M++           S + +GV      M ++ L  F++ 
Sbjct: 18  GALVVVTKTGFETYQGSLVRVMIY-----------SAERVGVDNKEALMFILFLLNFAVV 66

Query: 488 C-----IQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISP 542
                 ++  K+G  +  +IL  + IIT VVPP LP  LT+    +L+ L K  ++C  P
Sbjct: 67  ASWYVWVEGTKMGRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEP 126

Query: 543 TRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLN 602
            R+ + G+ID+ CFDKTGTLT   L   G+             +D  +DV  LF   S  
Sbjct: 127 FRIPLAGRIDVCCFDKTGTLTGEDLVFEGLA----------GLSDKSEDVRHLF---SSE 173

Query: 603 DCSSPRDYRAKNFFISLLTCHSL-RVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHST 661
           D S       +   + +   H+L ++ D E++GDP++    +   W  E           
Sbjct: 174 DAS-------QETILVVGAAHALVKLDDGEIVGDPMEKATLKALGWKVEG---------- 216

Query: 662 YEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIV 721
                                        N F        L I+R F+F S L+R S + 
Sbjct: 217 -----------------------------NDFTSRPKTGKLQILRRFQFSSALKRSSSVA 247

Query: 722 KPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWL 781
             S++D  +   KGAPE I +    A +P N++E+   +T  G RV+A A + LP  +  
Sbjct: 248 --SHKDKLFTAVKGAPETIRE--RLAVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSSK 303

Query: 782 YSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGR 841
               + R+E+E+ + F GF++F   LK +  +T++ L E++ R++M TGDN LTA+ V +
Sbjct: 304 QLDDLDRDEIETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAK 363

Query: 842 QCNLIKSKKVYVPSLEEIDSTGQTSIIWRDV--------DNMDDTLDSRTLLPINNSSST 893
           +  ++  + +    L++ ++ G   +++ +V        D   D  D R L         
Sbjct: 364 EVAIVTGETLI---LDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELF-------D 413

Query: 894 SYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVG 953
            Y +A+TG    ++   E++S  +D I        +YAR+SP +K  ++  L+ + Y   
Sbjct: 414 KYDIAVTGYALNLL---EDHSQLKDLIRHTW----VYARVSPSQKEFILNNLKEMGYQTL 466

Query: 954 FCGDGANDCGALKAADVGISL 974
            CGDG ND GALK A VG++L
Sbjct: 467 MCGDGTNDVGALKQAHVGVAL 487

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 93/190 (48%), Gaps = 9/190 (4%)

Query: 973  SLSEAEASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYS 1032
            +L   +AS AAPFTS++  +S V ++I++GR  LV +   ++ ++L   I   +++++Y 
Sbjct: 610  TLKLGDASCAAPFTSKLSKVSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYM 669

Query: 1033 RGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVL 1092
             G   GD Q     LLL V   + +S  KP  K+ K+RP   + +  I+  +L+   V  
Sbjct: 670  AGVKFGDAQATVSGLLLSVCF-LSISRGKPIQKLSKQRPQKGIFNVYIMGSILSQFAV-- 726

Query: 1093 LFQIIPWIIVQGEEWYMKPIVGGDDV----VESSDNTILFFISNFQYILTAVILSVGPPY 1148
               I   + +  E + ++P     D+      S  NT +F I   Q + T  +   G P+
Sbjct: 727  --HIFTLVYITREIYILEPREPQVDLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPF 784

Query: 1149 REPMSRNIGF 1158
            RE +  N G 
Sbjct: 785  RENIRNNRGM 794

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 188/852 (22%), Positives = 321/852 (37%), Gaps = 183/852 (21%)

Query: 328  EVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVS 387
            +V V RD   + ++  +L+ GD+ ++   +  V P D +L+ G+C  +ES LTGES  + 
Sbjct: 158  QVVVVRDAAESLISIHNLLVGDLLKLQ--TGDVVPADCVLVRGECETDESALTGESNTIK 215

Query: 388  KFPAEPETMLQL------LDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVR 441
            K P               + D   +  S     S   +   I  +R+  G ++A+  V  
Sbjct: 216  KLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAI--VTN 273

Query: 442  TGFSTTKGSLVRSMV-----FPKPTGFKFYEDSFKYIGVMALIALF-------------- 482
             G ++  G  + S+       P         D+    G +A I LF              
Sbjct: 274  VGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPS 333

Query: 483  GFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISP 542
            G     +   + G     + + A+ +I + VP  LP  +T+   FA +R+ K G      
Sbjct: 334  GGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVL 393

Query: 543  TRVNIGGKIDILCFDKTGTLTEN------------GLDVLGVQLCVPSSHN---SFQFAD 587
                  G    +C DKTGTLTEN            G D +G     PS  N     + +D
Sbjct: 394  RSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGAD---PSKSNLVFKKKCSD 450

Query: 588  LVQDVHKLFPKFSLNDCS-SPRDYRAKNFFISLLTCHSLRVV------------DNE--L 632
            L++ V  ++    LN  +   +DY+  N + S+      R++            D+E  L
Sbjct: 451  LLRTV--IYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENL 508

Query: 633  IGDPLDFKMFQFTKWSYEE---DFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADP 689
            +    + +   +     E        K F   +   +     PE +  +  +V       
Sbjct: 509  LAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETIVQ------ 562

Query: 690  ENTFIDNDPHNFLGIIRSFEFLSELRRMSVIV------KPSNEDVYWAFTKGAPEVITQI 743
                           I  FE     R+ S IV      K +    +  + KGA E++ + 
Sbjct: 563  ---------------IIPFE---SSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKA 604

Query: 744  CNKATL------------PANFEEMLNYYTHKGYRVIACAGRVLPRNTW----LYSQKVS 787
            C    +              + EE +        R I+ A      N W    L   + S
Sbjct: 605  CTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENS 664

Query: 788  REEV--------ESNMEFL---GFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTA 836
             E +        + ++E L     +  ++ L++    ++   Q+A +   M TGDN+LTA
Sbjct: 665  HEALAVKLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTA 724

Query: 837  ISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYT 896
             ++ R C ++ SK                                     +N+S+     
Sbjct: 725  KAIARNCGILSSKS------------------------------------LNDSAC---- 744

Query: 897  LAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCG 956
             A+ G  FR         +S+     +L K  + AR SP++K  L+  L+ +   V   G
Sbjct: 745  -AMEGPAFR--------KLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTG 795

Query: 957  DGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGR--ACLVTSFS 1011
            DG ND  ALK ADVG S+      VA   +  +    D S +++ IK GR  A  +  F 
Sbjct: 796  DGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFI 855

Query: 1012 CFQYMSLYSAI--QFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKK 1069
             FQ +   +A+   F+T  +     S L   Q L+++L++    A+ ++  KP   I+ +
Sbjct: 856  QFQLIVNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDR 915

Query: 1070 RP---SANLVSP 1078
            +P   S  L++P
Sbjct: 916  KPKGRSTPLITP 927

>Kwal_14.1498
          Length = 939

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 197/862 (22%), Positives = 344/862 (39%), Gaps = 170/862 (19%)

Query: 279  IFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFAC-EVRVFRDEFW 337
            + S I+ ++D+    A  I L  ++ +    V+  R++KSL  ++     +  + R    
Sbjct: 101  VISFIMGNIDD----AVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQE 156

Query: 338  TNVNSADLVPGDI--YEISDPSLTVFPCDSLLLSG-DCIVNESMLTGESVPVSKFPAEPE 394
            + + ++ LVPGD+  + + D      P D  ++   D  + ES LTGE+ PV K  A   
Sbjct: 157  SKLLASVLVPGDVVRFRVGDR----IPADLRIIEAVDLSIEESNLTGENEPVHKSTA--- 209

Query: 395  TMLQLLDDFQNTQISSYLSKS----FLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGS 450
                +  +F    + S +  S      F GT +   R  +G+     +V+ T  +T  G 
Sbjct: 210  ---TVNKEFYKENLGSIVPVSERSCIAFMGTLV---REGHGR----GIVIGTAKNTAFGK 259

Query: 451  LVRSM-VFPKP-TGFKFYEDSF-KYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALD 507
            +   M    KP T  +   D   K +  M+ I +    I C+  +  G     M   ++ 
Sbjct: 260  VFEMMNAIEKPKTPLQTAMDKLGKDLSFMSFIVI---GIICLIGVIQGRSWLEMFQISVS 316

Query: 508  IITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGL 567
            +    +P  LP  +T+     + R+ K+         V   G ++++C DKTGTLT N +
Sbjct: 317  LAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVETLGSVNVICSDKTGTLTANHM 376

Query: 568  DVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRV 627
             V  V  C+ S  N      L +     F K      +   D RA        T  +  +
Sbjct: 377  SVNKV-WCLGSMSNKSNILKLDKATSGSFKK------NLTEDLRA--------TLRTGNL 421

Query: 628  VDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSA 687
             +N              + +S+E        H+ Y     D AL E       V+H    
Sbjct: 422  CNN--------------STYSHE--------HAKYLGNPTDIALLE-------VLHKFGL 452

Query: 688  DPENTFIDNDPHNFLGIIRSFE--FLSELRRMSVIVKPSNEDVYWAFTKGAPEVI----T 741
            +      D  P     + RS E  F S+ + M+V VK +N   +    KGA E I    T
Sbjct: 453  E------DERPQ----VTRSDEISFNSKRKFMAVKVKEANGK-FVVHVKGAYEKILEKST 501

Query: 742  QICNK----ATLPANFEEML----NYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVES 793
               N       L +N  + +    +     G R +A A   L       S+K++ +++ +
Sbjct: 502  HFINAENKVVKLDSNLRQAITDSADALASDGLRTLAFAQLELSNGN---SKKLTEDDI-N 557

Query: 794  NMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYV 853
             + F G +   +  +      ++ L E S+  +M TGD   TA+S+ RQ  +        
Sbjct: 558  GLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGI-------- 609

Query: 854  PSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENN 913
                                            P+ N  +   T            GD+ +
Sbjct: 610  --------------------------------PVVNPETAVLT------------GDKLD 625

Query: 914  SISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGIS 973
             +SED + +++    I+AR +P+ K  ++  LQ+    V   GDG ND  ALK AD+G+S
Sbjct: 626  HMSEDQLASIIDHVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVS 685

Query: 974  LSEAEASVAAPFTSQVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLYSAIQFITIT 1028
            + +    VA   +  V    D S +L  I+EG+     + +F  FQ  +  +A+  + I 
Sbjct: 686  MGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIA 745

Query: 1029 VLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP----SANLVSPKILIPL 1084
              +   + L   Q L+I++L+  P A  +   +P D  V K+P    +  +++  +   L
Sbjct: 746  TAFKLPNPLNAMQILWINILMDGPPAQSLGV-EPVDHEVMKKPPRKRADKILTKAVFQRL 804

Query: 1085 LASIVVVLLFQIIPWIIVQGEE 1106
            L S  ++++  I  +I    E+
Sbjct: 805  LQSAALIIIGTIYVFIKEMAED 826

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 197/842 (23%), Positives = 333/842 (39%), Gaps = 155/842 (18%)

Query: 348  GDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQ--N 405
            GD+  IS  +  V P D +++SG C  +ES +TGES  + KFP +       L DF+  N
Sbjct: 213  GDV--ISLQTGDVVPADCVMISGKCEADESSITGESNTIQKFPVDNS-----LRDFKKFN 265

Query: 406  TQISSYLSKSFLF-----NGTTIIRARIPYGQ----SAALAMVVRTGFSTTKGSLVRSM- 455
            +  S   SK         +G  I    +  G          ++   G ++  G  + S+ 
Sbjct: 266  SIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLN 325

Query: 456  VFPKPTGFKFY----EDSFKYIGVMALIALFGFSISCIQFIKIGLDKR------------ 499
              P+ T  + +     D+    G ++ I LF    +   F  I  D R            
Sbjct: 326  AEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSK 385

Query: 500  --TMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFD 557
               + + ++ +I + VP  LP  +T+   FA +R+ K G            G    +C D
Sbjct: 386  FMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSD 445

Query: 558  KTGTLTENGLDVLGVQLCVPSSHNSFQFADL-VQDVHKLFPK--FSLNDCSSPRDYRAKN 614
            KTGTLTEN   V+ V    P +        L V +  KL  K  F  N  SS R+    N
Sbjct: 446  KTGTLTEN---VMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRNDLLAN 502

Query: 615  FFISLL-------------TCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHST 661
              ++               T  S  +  N    D    ++  F K + E+D +++ F + 
Sbjct: 503  IVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKKGNREDD-EDQLFKNV 561

Query: 662  YEERRHD--NALPENIDIIPAVVHPNSADPENTFIDNDPH---NFLGIIRSFEFLSELRR 716
             + R+     +  E   +  A +       E  ++ + P    N   ++++  F S  + 
Sbjct: 562  NKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPMEKFNIEKVVQTIPFESSRKW 621

Query: 717  MSVIVK----PSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHK--------- 763
              ++VK     + +  Y  F KGA E++++ C+      +  E +N    K         
Sbjct: 622  AGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKETDDEIKNL 681

Query: 764  ---GYRVIACAGRVLPR-NTWLYSQKVSREEVESNMEFL-------------GFIIFENK 806
                 R I+ A +     ++W   Q   R++   N+  L             G +  ++ 
Sbjct: 682  ASDALRAISVAHKDFCECDSWPPEQ--LRDKDSPNIAALDLLFNSQKGLILDGLLGIQDP 739

Query: 807  LKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTS 866
            L+    +++Q  Q A +   M TGDN+LTA ++ R C                      +
Sbjct: 740  LRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNC----------------------A 777

Query: 867  IIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLK 926
            I+  D+                  SS +Y+ A+ G  FR +  +E   I        L  
Sbjct: 778  ILSTDI------------------SSEAYS-AMEGTEFRKLTKNERIRI--------LPN 810

Query: 927  GTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFT 986
              + AR SP++K  L+E L+ +   V   GDG ND  ALK ADVG S+  +   VA   +
Sbjct: 811  LRVLARSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREAS 870

Query: 987  SQVF---DISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSN-----LG 1038
              +    D S +++ IK GR C+  S   F    L   I  + +T + S  S+     L 
Sbjct: 871  DIILMTDDFSAIVNAIKWGR-CVSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLT 929

Query: 1039 DFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP---SANLVSPKILIPLLASIVVVLLFQ 1095
              Q L+I+L++    A+ ++  KP   I+ ++P   S +L+S      +L+   + L+  
Sbjct: 930  AVQLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTSLISVSTWKMILSQATLQLIVT 989

Query: 1096 II 1097
             I
Sbjct: 990  FI 991

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 190/855 (22%), Positives = 338/855 (39%), Gaps = 157/855 (18%)

Query: 279  IFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFA-CEVRVFRDEFW 337
            I S+ L ++D+    A  I +  ++ +    V+  R++KSL  ++     E  + R    
Sbjct: 114  IISVFLGNIDD----AISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRE 169

Query: 338  TNVNSADLVPGDI--YEISDPSLTVFPCD-SLLLSGDCIVNESMLTGESVPVSKFPAEPE 394
            +NV + +LVPGD+  + I D      P D  ++   D  ++ES LTGE+ PV K      
Sbjct: 170  SNVLATNLVPGDLVRFRIGDR----IPADIRIIECNDLTIDESNLTGETDPVHK------ 219

Query: 395  TMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRS 454
            +   L  D  N Q +S +    +   T I        +     +VV TG  T+ G++   
Sbjct: 220  SYKALSRDSYNDQPNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEM 276

Query: 455  MV-FPKP-TGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIV 512
            M    KP T  +   D  K    ++L +     I C+  I  G     M   ++ +    
Sbjct: 277  MSSIEKPKTPLQLTMD--KLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAA 334

Query: 513  VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGV 572
            +P  LP  +T+     + R+ K+         V   G ++++C DKTGTLT N + V  +
Sbjct: 335  IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKI 394

Query: 573  QLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNEL 632
              C+ S  N      L +           N   + ++Y   +   +LL C +L       
Sbjct: 395  -WCLGSMANKLNVLSLDK-----------NKGGNLKNYLTDDVKTTLL-CGNL------- 434

Query: 633  IGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENT 692
                           SY ++      H+ Y     D AL E +                 
Sbjct: 435  -----------CNNASYSQE------HAKYLGNPTDVALLEQL---------------QK 462

Query: 693  FIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVI--------TQIC 744
            F   D  +    ++   F S+ + M+  ++  NE     F KGA E I        T+  
Sbjct: 463  FELADVRSEYTKVKELSFNSKRKMMATKIQ-DNEKKTTLFIKGAFERILDKSSSYLTEKG 521

Query: 745  NKATLPANFEEML----NYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGF 800
                L A   E +    N    +G RV+A A R +  +    S K+  +++ S++ F G 
Sbjct: 522  KIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDS----SSKLVEDDI-SDLVFTGL 576

Query: 801  IIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEID 860
            I   +  +      +    +  I  +M TGD+  TA+++ RQ  +     V  P L    
Sbjct: 577  IGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----PVIDPKLS--- 629

Query: 861  STGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYI 920
                                                         ++ GD+ N +++D +
Sbjct: 630  ---------------------------------------------VLSGDKLNEMTDDQL 644

Query: 921  NTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEAS 980
              V+    I+AR +P+ K  ++  L+R    V   GDG ND  ALK AD+G+S+      
Sbjct: 645  ANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTD 704

Query: 981  VAAPFTSQVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSRGS 1035
            VA   +  +    D S +L  I+EG+     + +F  FQ  +  +A+  + ++  +   +
Sbjct: 705  VAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN 764

Query: 1036 NLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP----SANLVSPKILIPLLASIVVV 1091
             L   Q L+I++L+  P A  +   +P D  V K+P    +  +++ ++L  L+ +   +
Sbjct: 765  PLNAMQILWINILMDGPPAQSLGV-EPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCI 823

Query: 1092 LLFQIIPWIIVQGEE 1106
            +L  +  ++    E+
Sbjct: 824  ILGTVYVFVKEMAED 838

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 177/818 (21%), Positives = 322/818 (39%), Gaps = 150/818 (18%)

Query: 279  IFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFA-CEVRVFRDEFW 337
            + S+ + ++D+       IF++  +      V+  R++KSL  ++     E  + R    
Sbjct: 106  VVSLFMGNIDDAVSITLAIFIVVTVG----FVQEYRSEKSLEALNKLVPAECHLMRCGQE 161

Query: 338  TNVNSADLVPGDI--YEISDPSLTVFPCDSLLLSG-DCIVNESMLTGESVPVSKFPAEPE 394
            ++V ++ LVPGD+  + I D      P D  ++   D  ++ES LTGE+ PV K     E
Sbjct: 162  SHVLASTLVPGDLVHFRIGDR----IPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIE 217

Query: 395  TMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRS 454
                  +D  N+ +         + GT +      +G+     +VV TG +T+ G++   
Sbjct: 218  K--SSFNDQPNSIVPISERSCIAYMGTLVKEG---HGK----GIVVGTGTNTSFGAVFEM 268

Query: 455  MV-FPKP-TGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIV 512
            M    KP T  +   D  K    ++L++     + C+  I  G     M   ++ +    
Sbjct: 269  MNNIEKPKTPLQLTMD--KLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAA 326

Query: 513  VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGV 572
            +P  LP  +T+     + R+ K+         V   G ++++C DKTGTLT N + V  +
Sbjct: 327  IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKL 386

Query: 573  QLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNEL 632
              C+ S  N                   LN  S  ++ + KN   +L    +  V +   
Sbjct: 387  -WCLDSMSNK------------------LNVLSLDKNKKTKNSNGNLKNYLTEDVRETLT 427

Query: 633  IGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENT 692
            IG+  +   F           QE   H+ +     D AL E +         N   P   
Sbjct: 428  IGNLCNNASFS----------QE---HAIFLGNPTDVALLEQL--------ANFEMP--- 463

Query: 693  FIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVI------------ 740
                D  N +  ++   F S+ + M+  +    ++    + KGA E I            
Sbjct: 464  ----DIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKG 519

Query: 741  --TQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFL 798
              T+   +A   A   E  N    +G RV   A   L  ++   +     E++  ++ F 
Sbjct: 520  KKTEKLTEAQ-KATINECANSMASEGLRVFGFAKLTLSDSSTPLT-----EDLIKDLTFT 573

Query: 799  GFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEE 858
            G I   +  +      ++ L +  +  +M TGD+  TA+++ +Q  +     V  P L  
Sbjct: 574  GLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI----PVIDPKLS- 628

Query: 859  IDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISED 918
                                                           ++ GD+ + +S+D
Sbjct: 629  -----------------------------------------------VLSGDKLDEMSDD 641

Query: 919  YINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAE 978
             +  V+    I+AR +P+ K  ++  L++    V   GDG ND  ALK +D+G+S+    
Sbjct: 642  QLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIG 701

Query: 979  ASVAAPFTSQVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSR 1033
              VA   +  V    D S +L  I+EG+     + +F  FQ  +  +A+  + ++  +  
Sbjct: 702  TDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKL 761

Query: 1034 GSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP 1071
             + L   Q L+I++L+  P A  +   +P D  V K+P
Sbjct: 762  PNPLNAMQILWINILMDGPPAQSLGV-EPVDHEVMKKP 798

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 184/854 (21%), Positives = 328/854 (38%), Gaps = 179/854 (20%)

Query: 310  VETRRTQKSLADMSHFA-CEVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCD-S 365
            V+  +++KSL  ++     E  + R    ++V +++LVPGD+  +++ D      P D  
Sbjct: 128  VQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPGDLVRFKVGDR----IPADLR 183

Query: 366  LLLSGDCIVNESMLTGESVPVSKFPA--EPETMLQLLDDFQNTQISSYLSKSFLFNGTTI 423
            ++ S D  V+ES LTGE+ PV K     +P+    +      + I         F GT +
Sbjct: 184  IVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHI----PGSIIPVGDRNCIGFMGTLV 239

Query: 424  IRARIPYGQSAALAMVVRTGFSTTKGSLVRSMV-FPKP-TGFKFYEDSFKYIGVMALIAL 481
               R  +G+     +V+ TG  T  GS+   M    KP T  +   D             
Sbjct: 240  ---REGHGK----GIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKL----------- 281

Query: 482  FGFSISCIQFIKI----------GLDKRTMILRALDIITIVVPPALPATLTIGTGFALSR 531
             G  +S + F+ I          G     M   A+ +    +P  LP  +T+     + R
Sbjct: 282  -GQDLSYMSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLR 340

Query: 532  LKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQD 591
            + K+         V   G ++++C DKTGTLT N + V  +  C+ S  N          
Sbjct: 341  MAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKI-WCLGSMENK--------- 390

Query: 592  VHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEE 651
                       +C +    + +   +      +LR      IG+  +   +      Y  
Sbjct: 391  ----------TNCLALSKVKERPIKMEQDVATTLR------IGNICNNGTYSQEHLKYLG 434

Query: 652  DFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFL 711
            +                   P +I I+ ++ H         F  ND  N +  I    F 
Sbjct: 435  N-------------------PTDIAILESLQH---------FGINDCRNSVNKINEIPFN 466

Query: 712  SELRRMSVIVKPSNEDVYWAFTKGAPEVITQIC--------NKATLPANFEEMLN----Y 759
            S+ + M+V    +N+ V   + KGA E I +              L  N + ++N     
Sbjct: 467  SKRKFMAVKTIDANDKVV-VYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVA 525

Query: 760  YTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQ 819
               +G R +A A   +   +  +  K   E++   + F G I   +  +      ++ L 
Sbjct: 526  LASEGLRTLAFAELEV---SATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELL 582

Query: 820  EASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTL 879
            + S+  +M TGD   TA+S+ RQ  +                                  
Sbjct: 583  QGSVHVIMITGDAENTAVSIARQIGI---------------------------------- 608

Query: 880  DSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKH 939
                  P+ N              + ++ GD+ + +++D + +V+    ++AR +P+ K 
Sbjct: 609  ------PVINPE------------YSVLSGDKLDQMTDDQLASVIDHVNVFARATPEHKL 650

Query: 940  ELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVL 996
             ++  LQ+    V   GDG ND  ALK AD+G+S+ +    VA   +  V    D S +L
Sbjct: 651  NIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTIL 710

Query: 997  DVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIA 1054
              I+EG+     + +F  FQ  +  +A+  + I+      + L   Q L+I++L+  P A
Sbjct: 711  TAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILMDGPPA 770

Query: 1055 IFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVVVLLFQIIPWIIVQGEEWYMKPIVG 1114
              +   +P D  V ++P        +   +L  +++   F I+  I V  +E      + 
Sbjct: 771  QSLGV-EPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKE------MA 823

Query: 1115 GDDVVESSDNTILF 1128
             D  V S D T+ F
Sbjct: 824  EDGQVTSRDTTMTF 837

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 170/829 (20%), Positives = 315/829 (37%), Gaps = 195/829 (23%)

Query: 344  DLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEP--ETMLQLLD 401
            DL+ GD+  IS  +  V P D++L+SG C  +ES LTGES  + K   +P  E   Q+ +
Sbjct: 256  DLLVGDV--ISLQTGDVVPADAVLISGSCECDESALTGESDTIKKVALKPALEKYKQIFE 313

Query: 402  -----DFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM- 455
                 D  +  +   +    L +G+ ++            A++   G ++  G ++ ++ 
Sbjct: 314  KDPTIDIGSHGVGEKVPDPLLISGSKLL-------SGIGNAVITSVGENSVNGRIMMALK 366

Query: 456  ----VFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFI---------------KIGL 496
                  P         D+    G MA + L  F I  I+F+               + G 
Sbjct: 367  TESESTPLQERLSNLADNISIYGCMAALVL--FIILFIRFLTYLPNGKKYHDLPPAQKGS 424

Query: 497  DKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCF 556
                + + A+ +I + VP  LP  +T+   FA +R+ K G            G    +C 
Sbjct: 425  KFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATAICS 484

Query: 557  DKTGTLTENGLDV-------LGVQLCVPSSHNSFQFADLVQD------VHKLFPKFSLND 603
            DKTGTLTEN + V       LG      + +   + A +++       +  +    SLN 
Sbjct: 485  DKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTDILSNISLNS 544

Query: 604  CS---------------SPRDYRAKNFF-------ISLLTCHSLRVVDNELIGDPLDFKM 641
             +               +P     K+ F        S L   +++  D + +G   +  +
Sbjct: 545  TAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIADAMKENDEQFLGSKTETAL 604

Query: 642  FQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNF 701
              F + S       K+ H     +  D  + + + +IP                      
Sbjct: 605  LAFAQKS----LGMKDVHK-LRTKPSDLGIDKVVQVIP---------------------- 637

Query: 702  LGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQIC------NKATLPAN--- 752
                    F S  +  ++ V+ ++   Y  + KGA E++ ++C      + + +P N   
Sbjct: 638  --------FESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDL 689

Query: 753  ----FEEMLNYYTHKGYRVIACAGRVL----PRN------------TWLYSQKVSREEVE 792
                F+++ +  +H   R I+   R      P+               +   ++  + + 
Sbjct: 690  YDESFKKIQDMASH-ALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLS 748

Query: 793  S-NMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKV 851
            S  M     +  ++ L++   ++++  Q A +   M TGDN+LTA ++ R CN++  +  
Sbjct: 749  SEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY 808

Query: 852  YVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDE 911
              P                                           A+ G  FR      
Sbjct: 809  NDPE-----------------------------------------CAMEGPTFR------ 821

Query: 912  NNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVG 971
               +    +  V+ K  + AR SP++K  L+E L+++   V   GDG ND  ALK ADVG
Sbjct: 822  --KLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVG 879

Query: 972  ISLSEAEASVAAPFTSQVF---DISCVLDVIKEGRACLVT--SFSCFQYMSLYSAI--QF 1024
             S+  +   VA   +  +    D + +++ IK GR   V+   F  FQ     +A+   F
Sbjct: 880  FSMGISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTF 939

Query: 1025 ITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSA 1073
            ++        S L   Q L+++L++    A+ ++  KP + I+ ++P  
Sbjct: 940  VSAVASAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKG 988

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 182/809 (22%), Positives = 314/809 (38%), Gaps = 165/809 (20%)

Query: 314  RTQKSLADMSHF---ACEVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCD-SLL 367
            R++KSL  +      +C +  F  E  T+V ++ LVPGD+  +++ D      P D  ++
Sbjct: 143  RSEKSLEALHKLVPASCHLIRFGAE--THVLASCLVPGDLVYFKVGDR----IPADVRII 196

Query: 368  LSGDCIVNESMLTGESVPVSK--FPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIR 425
             S D  ++ES LTGE+ PV K   P    T      D     I      S  + GT +  
Sbjct: 197  ESTDLSLDESTLTGETEPVHKSCTPVNSAT----YSDVPGGIIPIGERTSIAYMGTLV-- 250

Query: 426  ARIPYGQSAALAMVVRTGFSTTKGSLVRSM-VFPKP-TGFKFYEDSFKYIGVMALIALFG 483
             R  +G+     +VV TG  T  G++   M    KP T  +   D+ +       ++   
Sbjct: 251  -REGHGK----GIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRD-----LSYVR 300

Query: 484  FSISCIQFIKIGLDKRT---MILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCI 540
            F +S I F+   +  R+   M   ++ +    +P  LP  +T+     + R+  +     
Sbjct: 301  FVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVR 360

Query: 541  SPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFP--- 597
                V   G ++++C DKTGTLT N +    +  C+ S  N      L        P   
Sbjct: 361  RLPSVETLGSVNVICSDKTGTLTANHMTASKI-WCLGSMANKNNVLSLEAKSSGGLPGKL 419

Query: 598  ---KFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQ 654
               K  L+D     D +A     S+    S      + +G+P D  +         E  Q
Sbjct: 420  PNLKNYLSD-----DVKATLRIGSICNNASFSHEHGKYLGNPTDIALL--------EVLQ 466

Query: 655  EKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSEL 714
            + +     +ER                       P  T +D              F S+ 
Sbjct: 467  KFDL---VDER-----------------------PTTTRVDE-----------LTFNSKR 489

Query: 715  RRMSVIV-KPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGR 773
            + M+V V  P+N   +  + KGA E I +        A   E L+  +HK   +  CA  
Sbjct: 490  KYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLS-DSHKSL-INDCAKS 547

Query: 774  VLPRN--TWLYSQ------KVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRT 825
            +      T  ++Q      K   +    N+ F+G I  ++  +      ++ L +  +  
Sbjct: 548  LASEGLRTLAFAQLECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHV 607

Query: 826  VMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLL 885
            +M TGD   TA+++ RQ                                          +
Sbjct: 608  IMITGDAENTAVNIARQIG----------------------------------------I 627

Query: 886  PINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQL 945
            P+ N                ++ GD  + +++D +  V+    I+AR +P+ K  ++  L
Sbjct: 628  PVINPE------------ISVLTGDRLDQMTDDQLAGVIDHVNIFARATPEHKLNIVRAL 675

Query: 946  QRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEG 1002
            Q+    V   GDG ND  ALK AD+G+++      VA   +  V    D S +L  I+EG
Sbjct: 676  QKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEG 735

Query: 1003 RACL--VTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSWS 1060
            +     + SF  FQ  +  +A+  + I   +   + L   Q L+I++L+  P A  +   
Sbjct: 736  KGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGV- 794

Query: 1061 KPYDKIVKKRP----SANLVSPKILIPLL 1085
            +P D  V ++P    S  +++P+++  LL
Sbjct: 795  EPVDHEVMRKPPRKRSDKILTPQVMRRLL 823

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 186/835 (22%), Positives = 340/835 (40%), Gaps = 187/835 (22%)

Query: 300  ISILSIVDT-LVETRRTQKSLADMSHFA-CEVRVFRDEFWTNVNSADLVPGDI--YEISD 355
            ++IL +V    ++  R++KSL  ++     +  + R    +N  +++LVPGD+  ++I D
Sbjct: 132  LAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGD 191

Query: 356  PSLTVFPCDSLLLSG-DCIVNESMLTGESVPVSKFPA--EPETMLQLLDDFQNTQISSYL 412
                  P D  ++   D  ++ES LTGE+ P+ K     +PE       ++ N  +    
Sbjct: 192  R----IPADVRIIEAVDLSIDESNLTGETEPLHKDAQTIDPE-------EYDNRNVPVSE 240

Query: 413  SKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGS---LVRSMVFPKPTGFKFYEDS 469
                 + GT +      +G+     +V+ TG +T+ G+   +V S+  PK       +++
Sbjct: 241  RSCIAYMGTLVKEG---HGK----GIVIGTGTNTSYGAIFEMVNSIEKPKTP----LQET 289

Query: 470  FKYIGV-MALIALFGFSISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFA 528
               +G  ++ I+ F  +I  I  I  G     M   ++ +    +P  LP  +T+     
Sbjct: 290  MDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALG 349

Query: 529  LSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFA-- 586
            + R+ K+         V   G ++++C DKTGTLT N + V  +  C+ SS  +++ A  
Sbjct: 350  VLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKL-FCLDSS-GTYENAIS 407

Query: 587  ---DLVQDVHKLFPKFSL---NDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFK 640
               D   DVH    K +L   N C++ +     N +I                G+P D  
Sbjct: 408  PEEDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYI----------------GNPTDVA 451

Query: 641  MFQ-FTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPH 699
            + +  TK+   +   +++ H   EE                               N   
Sbjct: 452  LIEVLTKFGIPD---QRDSHEKMEELSF----------------------------NSKR 480

Query: 700  NFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVI----TQICNKATLPANFEE 755
             ++ I  S              K S E V +   KGA E I    +   +KA     F+E
Sbjct: 481  KYMAIKSS--------------KESGEHVLY--IKGAFERILDKSSYYLDKAGEVREFDE 524

Query: 756  ----MLNYYTHK----GYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKL 807
                M+    H     G R IACA +  P +    S  V  E+  + + F G     +  
Sbjct: 525  HSKVMVLEAAHSCASDGLRTIACAFK--PTD----SDNVISEDDINGLTFTGLFGLADPP 578

Query: 808  KKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSI 867
            +     +++ L    +  +M TGD+V TA+S+  +  L         S+++ +S+     
Sbjct: 579  RPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGL---------SVQDRESS----- 624

Query: 868  IWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKG 927
                                                  ++ GD+ + ++ED ++ V+ K 
Sbjct: 625  --------------------------------------VMTGDKVSELTEDELSKVIDKV 646

Query: 928  TIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTS 987
             I+AR +P+ K  +++ L++    V   GDG ND  ALK AD+GI++  +   VA   + 
Sbjct: 647  NIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSD 706

Query: 988  QVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQF 1042
             +    D S +L  I+EG+     + +F  FQ     + +  I IT +    + L   Q 
Sbjct: 707  MILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITTIAKLPAPLNPMQI 766

Query: 1043 LYIDLLLIVPIAIFMSWSKPYDKIVKKRP----SANLVSPKILIPLLASIVVVLL 1093
            L+I++++  P A  +   +P D  V  +P       +++  IL+ LL   + +L+
Sbjct: 767  LWINIIMDGPPAQSLGV-EPVDSDVMDKPPRSREERILNMNILLRLLYLAICILV 820

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 184/848 (21%), Positives = 334/848 (39%), Gaps = 188/848 (22%)

Query: 258  RVKTVAE-------------LLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILS 304
            R+KTV E             ++ ++V +   +  + S+I+      +   G I  +  ++
Sbjct: 45   RLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVN 104

Query: 305  IVDTLVETRRTQKSLADMSHFAC-EVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVF 361
            ++  LV+  +  K++  + + +     V R+     +NS D+VPGDI   ++ D      
Sbjct: 105  VLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGD----TI 160

Query: 362  PCD-SLLLSGDCIVNESMLTGESVPVSK-----FPAEPETMLQLLDDFQNTQISSYLSKS 415
            P D  L+ + +   +ES+LTGES+PVSK     F  E ET            +   L+  
Sbjct: 161  PADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET-----------SVGDRLN-- 207

Query: 416  FLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM------VFPKPT-------- 461
              F+ + +++ R       A  +V++T  ++  G + +S+      +   P+        
Sbjct: 208  LAFSSSAVVKGR-------AKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTW 260

Query: 462  ---------------GFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRAL 506
                           G   +    K   ++  IA+  F+I  +   K  +DKR  I  A+
Sbjct: 261  ISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKFDVDKRVAIY-AI 318

Query: 507  DIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENG 566
             +   ++P +L   LTI      + +  + +       +   G ++ +C DKTGTLT+  
Sbjct: 319  CVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 567  LDVLGVQLCVP-----SSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLT 621
            +  L  Q+ +P     +  NS    +  +    L P+FS  + S   D       + +L 
Sbjct: 379  M--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD-----VGILQ 431

Query: 622  CHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHD--NALPENIDIIP 679
                R+ + +L   P D  M  F KW   E        + +++   D   A  +  +I  
Sbjct: 432  NFKDRLYEKDL---PEDIDMDLFQKWL--ETATLANIATVFKDDATDCWKAHGDPTEIAI 486

Query: 680  AVVHPNSADPENTFI---------DNDP-----HN------FLGIIRSFEFLSELRRMSV 719
             V       P N            +ND      HN          I  F F S ++RMS 
Sbjct: 487  QVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546

Query: 720  IVKPSNEDVYWAFTKGAPEVITQICNK-----------------ATLPANFEEMLNYYTH 762
            +   ++ + Y  + KGA E I   C+                   T+  N   + N    
Sbjct: 547  VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSN---- 602

Query: 763  KGYRVIACAGRVLPRNT----WLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTL 818
            +G RV+  A +   ++      L +   +R   ES++ FLG I   +  + ETA  ++  
Sbjct: 603  EGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKF 662

Query: 819  QEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDT 878
             +A I   M TGD V TA ++ ++  ++ +  +Y  S E +DS                 
Sbjct: 663  HQAGINVHMLTGDFVGTAKAIAQEVGILPT-NLYHYSQEIVDS----------------- 704

Query: 879  LDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEK 938
                              + +TG  F        + +SE+ ++ + +   + AR SP  K
Sbjct: 705  ------------------MVMTGSQF--------DGLSEEEVDDLPVLPLVIARCSPQTK 738

Query: 939  HELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCV 995
              ++E L R        GDG ND  +LK A+VGI++    + V+   +  V    + + +
Sbjct: 739  VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASI 798

Query: 996  LDVIKEGR 1003
            L+ ++EGR
Sbjct: 799  LNAVEEGR 806

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 181/797 (22%), Positives = 317/797 (39%), Gaps = 151/797 (18%)

Query: 334  DEFWTNVNSADLVP------GDIYEISDPSLTVFPCDSLLL-----SGDCIVNESMLTGE 382
            +E +  +N++ LVP      GD+ ++   S    P D +LL     SG+  V    L GE
Sbjct: 271  NELYEVLNNSQLVPSKNLRVGDLVKLHKDSR--IPADMILLQSSEPSGETFVKTDQLDGE 328

Query: 383  SVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRT 442
            +    K    P     L  D   T++  +++ S       +   ++ Y  S+A   V  T
Sbjct: 329  TD--WKLRVAPSLTQNLTQDEMLTKV--HITASAPEKSIHMFTGKLTYKGSSAPLSVDNT 384

Query: 443  GFSTT----KGSLVRSMVFPKPTGFKFYEDSFKYI--GVMAL--------IALFGFSISC 488
             ++ T     G+ V  +++      +    S   +  G++ L        + +  F++S 
Sbjct: 385  LWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSI 444

Query: 489  IQFIKIGLDKRTM---ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRV 545
            +  +  GLD       I+R L + + ++P +L   L +G      +++       +  R 
Sbjct: 445  LLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRT 504

Query: 546  NI----GGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLF----- 596
            +      G+I+ L  DKTGTLT+N + +  + L   S   + +  D+V D  +       
Sbjct: 505  STIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVS--YTMETMDMVTDYIQTLTSPAN 562

Query: 597  ---PKFSLNDCSSPRDYRAKNFFISLLTCHSL--RVVDNELI---GDPLDFKMFQFTKWS 648
                  ++         R ++  ++L TCH++     DNEL      P +  + +FT   
Sbjct: 563  MGAAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAIVKFT--- 619

Query: 649  YEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSF 708
                  E+   S ++  RH   L           H  S    N   D        I+  F
Sbjct: 620  ------ERVGLSLFKRDRHSLTL----------FHEYSG--VNLQYD--------ILHVF 653

Query: 709  EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVI 768
             F S+ +RM +IV+   ++  W   KGA  V+++I          EE ++    +G R +
Sbjct: 654  PFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDW---LEEEVSNMAREGLRTL 710

Query: 769  ACAGRVLPRNTWLYSQ--------------------KVSREEVESNMEFLGFIIFENKLK 808
              A + L  +T LY Q                    +V +  +E N+E LG    E+KL+
Sbjct: 711  VIARKKL--STRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQ 768

Query: 809  KETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSII 868
            K+   +++ L+ A ++  M TGD V TA  V     LI S+  YV ++ ++         
Sbjct: 769  KDVKTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLI-SRGQYVHTITKL--------- 818

Query: 869  WRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGT 928
                   D  L     L  N +S     L I GD   I     ++  +E +   + L   
Sbjct: 819  ----TRRDGALSRLEYLKANRNS----CLLIDGDSLAIYM---SHYRAEFFEIVICLPVV 867

Query: 929  IYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAP 984
            I  R +P +K ++   ++ +      C GDG ND   ++ ADVG+ +   E   AS+AA 
Sbjct: 868  IACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD 927

Query: 985  FTSQVFDISCVLD--VIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQF 1042
            ++   F   C L   ++  GR     S    Q++ ++  +       +YS  SNL     
Sbjct: 928  YSITQF---CHLTKLLLWHGRNSYKRSAKLSQFV-IHRGLLISVCQAVYSISSNLK---- 979

Query: 1043 LYIDLLLIVPIAIFMSW 1059
                     PIA++  W
Sbjct: 980  ---------PIALYQGW 987

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 185/860 (21%), Positives = 339/860 (39%), Gaps = 180/860 (20%)

Query: 238  LSSGVQED----RILAFDSNQINLRVKT-VAELLFNEVLHPFYVFQIFSIILWSLDEYYY 292
            L+ G+ +D    R+ A   N +    K     ++ ++V +   +  + S+ +      + 
Sbjct: 33   LTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWI 92

Query: 293  YAGCIFLISILSIVDTLVETRRTQKSLADMSHFAC-EVRVFRDEFWTNVNSADLVPGDI- 350
              G I  +  ++++  LV+  +  K++  + + +     V R+     +NS D+VPGDI 
Sbjct: 93   TGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDIC 152

Query: 351  -YEISDPSLTVFPCD-SLLLSGDCIVNESMLTGESVPVSK-----FPAEPETMLQLLDDF 403
              ++ D      P D  L+ + +   +ES+LTGES+PVSK     F  E ET        
Sbjct: 153  LVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET-------- 200

Query: 404  QNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM------VF 457
                +   L+    F+ + +++ R       A  +V++T  ++  G + +S+      + 
Sbjct: 201  ---SVGDRLN--LAFSSSAVVKGR-------AKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 458  PKPT-----------------------GFKFYEDSFKYIGVMALIALFGFSISCIQFIKI 494
              P+                       G   +    K   ++  IA+  F+I  +   K 
Sbjct: 249  RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKF 307

Query: 495  GLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDIL 554
             +DKR  I  A+ +   ++P +L   LTI      + +  + +       +   G ++ +
Sbjct: 308  DVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 555  CFDKTGTLTENGLDVLGVQLCVP-----SSHNSFQFADLVQDVHKLFPKFSLNDCSSPRD 609
            C DKTGTLT+  +  L  Q+ +P     +  NS    +  +    L P+FS  + S   D
Sbjct: 367  CSDKTGTLTQGKM--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNED 424

Query: 610  YRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHD- 668
                   + +L     R+ + +L   P D  M  F KW   E        + +++   D 
Sbjct: 425  GD-----VGILQNFKDRLYEKDL---PEDIDMDLFQKWL--ETATLANIATVFKDDATDC 474

Query: 669  -NALPENIDIIPAVVHPNSADPENTFI---------DNDP-----HN------FLGIIRS 707
              A  +  +I   V       P N            +ND      HN          I  
Sbjct: 475  WKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAE 534

Query: 708  FEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNK-----------------ATLP 750
            F F S ++RMS +   ++ + Y  + KGA E I   C+                   T+ 
Sbjct: 535  FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIR 594

Query: 751  ANFEEMLNYYTHKGYRVIACAGRVLPRNT----WLYSQKVSREEVESNMEFLGFIIFENK 806
             N   + N    +G RV+  A +   ++      L +   +R   ES++ FLG I   + 
Sbjct: 595  KNVYSLSN----EGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDP 650

Query: 807  LKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTS 866
             + ETA  ++   +A I   M TGD V TA ++ ++  ++ +  +Y  S E +DS     
Sbjct: 651  PRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT-NLYHYSQEIVDS----- 704

Query: 867  IIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLK 926
                                          + +TG  F        + +SE+ ++ + + 
Sbjct: 705  ------------------------------MVMTGSQF--------DGLSEEEVDDLPVL 726

Query: 927  GTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFT 986
              + AR SP  K  ++E L R        GDG ND  +LK A+VGI++    + V+   +
Sbjct: 727  PLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEAS 786

Query: 987  SQVF---DISCVLDVIKEGR 1003
              V    + + +L+ ++EGR
Sbjct: 787  DIVLSDDNFASILNAVEEGR 806

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 185/861 (21%), Positives = 341/861 (39%), Gaps = 182/861 (21%)

Query: 238  LSSGVQED----RILAFDSNQINLRVKT-VAELLFNEVLHPFYVFQIFSIILWSLDEYYY 292
            L+ G+ +D    R+ A   N +    K     ++ ++V +   +  + S+ +      + 
Sbjct: 33   LTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWI 92

Query: 293  YAGCIFLISILSIVDTLVETRRTQKSLADMSHFAC-EVRVFRDEFWTNVNSADLVPGDI- 350
              G I  +  ++++  LV+  +  K++  + + +     V R+     +NS D+VPGDI 
Sbjct: 93   TGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDIC 152

Query: 351  -YEISDPSLTVFPCD-SLLLSGDCIVNESMLTGESVPVSK-----FPAEPETMLQLLDDF 403
              ++ D      P D  L+ + +   +ES+LTGES+PVSK     F  E ET        
Sbjct: 153  LVKVGD----TIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET-------- 200

Query: 404  QNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM------VF 457
                +   L+    F+ + +++ R       A  +V++T  ++  G + +S+      + 
Sbjct: 201  ---SVGDRLN--LAFSSSAVVKGR-------AKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 458  PKPT-----------------------GFKFYEDSFKYIGVMALIALFGFSISCIQFIKI 494
              P+                       G   +    K   ++  IA+  F+I  +   K 
Sbjct: 249  RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-FAIIVMASQKF 307

Query: 495  GLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDIL 554
             +DKR  I  A+ +   ++P +L   LTI      + +  + +       +   G ++ +
Sbjct: 308  DVDKRVAIY-AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 555  CFDKTGTLTENGLDVLGVQLCVP-----SSHNSFQFADLVQDVHKLFPKFSLNDCSSPRD 609
            C DKTGTLT+  +  L  Q+ +P     +  NS    +  +    L P+FS      P +
Sbjct: 367  CSDKTGTLTQGKM--LARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFS------PYE 418

Query: 610  Y-RAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHD 668
            Y   ++  + +L     R+ + +L   P D  M  F KW   E        + +++   D
Sbjct: 419  YSHNEDGDVGILQNFKDRLYEKDL---PEDIDMDLFQKWL--ETATLANIATVFKDDATD 473

Query: 669  --NALPENIDIIPAVVHPNSADPENTFI---------DNDP-----HN------FLGIIR 706
               A  +  +I   V       P N            +ND      HN          I 
Sbjct: 474  CWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIA 533

Query: 707  SFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNK-----------------ATL 749
             F F S ++RMS +   ++ + Y  + KGA E I   C+                   T+
Sbjct: 534  EFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETI 593

Query: 750  PANFEEMLNYYTHKGYRVIACAGRVLPRNT----WLYSQKVSREEVESNMEFLGFIIFEN 805
              N   + N    +G RV+  A +   ++      L +   +R   ES++ FLG I   +
Sbjct: 594  RKNVYSLSN----EGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYD 649

Query: 806  KLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQT 865
              + ETA  ++   +A I   M TGD V TA ++ ++  ++ +  +Y  S E +DS    
Sbjct: 650  PPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPT-NLYHYSQEIVDS---- 704

Query: 866  SIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLL 925
                                           + +TG  F        + +SE+ ++ + +
Sbjct: 705  -------------------------------MVMTGSQF--------DGLSEEEVDDLPV 725

Query: 926  KGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPF 985
               + AR SP  K  ++E L R        GDG ND  +LK A+VGI++    + V+   
Sbjct: 726  LPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEA 785

Query: 986  TSQVF---DISCVLDVIKEGR 1003
            +  V    + + +L+ ++EGR
Sbjct: 786  SDIVLSDDNFASILNAVEEGR 806

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 182/848 (21%), Positives = 344/848 (40%), Gaps = 165/848 (19%)

Query: 236  RGLSSGVQEDRILAFDSNQ------INLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDE 289
            RGL++     R+     N       IN+R      +L  ++ +   +  I S+++    +
Sbjct: 39   RGLTAEEARARLEVVGDNTLGEEEGINVRA-----ILLKQMCNAMILVLIISMVIALAIK 93

Query: 290  YYYYAGCIFLISILSIVDTLVE---TRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLV 346
             +   G I  +  L++     +     +T  SL D+S      RV R+     + SA +V
Sbjct: 94   DWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLS--TPSARVIRNGEDVVMASAQVV 151

Query: 347  PGDIYEISDPSLTVFPCDSLLLSG-DCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQN 405
            PGDI ++        P D  L+   +   +E++LTGE++PV+K PA    + +     Q+
Sbjct: 152  PGDIVQVRVGD--TVPADLRLVEALNLETDEALLTGEALPVAKDPA---AVFE-----QD 201

Query: 406  TQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPK------ 459
            T +   L+    F  +T+ + R       A  +VVRTG  +  G +  S+   +      
Sbjct: 202  TPVGDRLN--LAFASSTVSKGR-------ATGIVVRTGLRSEIGKIAESLQGKQSLISRD 252

Query: 460  --PTGFKFYEDSFK-----YIGV---------MALIALFGFSISCIQFIKIGLDKRTMIL 503
               +G +    + K     ++G          +A +AL  F+I+ +  + +   ++ ++ 
Sbjct: 253  ENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVN 312

Query: 504  RALDIITIVV-----PPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDK 558
            R + I  I V     P +L   LTI        +  + +       +   G ++ +C DK
Sbjct: 313  REVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDK 372

Query: 559  TGTLTENGLDVLGVQLCVPS------SHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRA 612
            TGTLT+  +  +  QL VP       + ++  F   V DV  L P+FS      P +Y+ 
Sbjct: 373  TGTLTQGKM--ILKQLWVPEFGTVVVNRSNVPFDPTVGDV-SLIPRFS------PWEYQH 423

Query: 613  -KNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEED-------FQEKEFHSTYEE 664
             +   + ++     R   N L   P      +F  W +          F++ +   + E 
Sbjct: 424  DEEEDVGIIANFKQRWQSNSL---PKGLNPRKFESWLHTATLANIATVFKDSD---SKEW 477

Query: 665  RRHDNALPENIDIIPAVV-HPNSA-------DPENTFIDNDPHNFLGIIRSFEFLSELRR 716
            R H +     I +    + HP+ A       +  ++   ND          F F S ++R
Sbjct: 478  RAHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKR 537

Query: 717  MSVI-VKPSNEDVYWAFTKGAPEVITQICNK--------ATLPANFEEM------LNYYT 761
            MS + +   +++    FTKGA E + + C +         T P   +++      ++  +
Sbjct: 538  MSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLS 597

Query: 762  HKGYRVIACAGRVLP-RNTWLYSQKVSREE--VESNMEFLGFIIFENKLKKETAKTLQTL 818
            ++G RV+A A + +P        ++++++   VES++ F G +   +  + ETA  ++  
Sbjct: 598  NEGLRVLAFATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKC 657

Query: 819  QEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDT 878
              A I   M TGD   TA ++ ++  ++     + P  E +D    T+  +  +   D+ 
Sbjct: 658  HRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHYPK-EVVDIMVMTATQFDSL--TDEE 714

Query: 879  LDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEK 938
            LD   +LP+                                         + AR +P  K
Sbjct: 715  LDQLPVLPL-----------------------------------------VIARCAPQTK 733

Query: 939  HELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCV 995
              +++ L R        GDG ND  +LK A+VGI++    + VA   +  V    + + +
Sbjct: 734  VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASI 793

Query: 996  LDVIKEGR 1003
            L+ ++EGR
Sbjct: 794  LNAVEEGR 801

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  109 bits (273), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 174/831 (20%), Positives = 333/831 (40%), Gaps = 171/831 (20%)

Query: 251  DSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLV 310
            D ++IN++      +  +++ +   +  I S+++    + +   G I  +  +++V    
Sbjct: 58   DDSKINIK-----GIFISQICNAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAY 112

Query: 311  ETRRTQKSLADMSHFAC-EVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCDSLL 367
            +     K++  +   +     V R      + S +LVPGDI    + D      P D  L
Sbjct: 113  QEYNASKTMNSLKSLSTPSAHVIRAGNDLTIESKELVPGDICIIRVGD----TVPADLRL 168

Query: 368  LSG-DCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRA 426
                +   +E++LTGES+PV+K   E           Q+T +   L+    F  +T+ + 
Sbjct: 169  FEAINLETDEALLTGESLPVAKSHGEVYE--------QDTPVGDRLN--LAFAASTVTKG 218

Query: 427  RIPYGQSAALAMVVRTGFSTTKGSLVRSM-------------VFPKPTGFKFYEDSFKYI 473
            R       A  +V++T  +T  G + +S+              F +       E    ++
Sbjct: 219  R-------ATGIVIKTALNTEIGKIAKSLKSEASLISRDKSKSFGRNLWITLRESIGTFL 271

Query: 474  G----------VMALIALFGFSISCIQFIKIGLDK----RTMILRALDIITIVVPPALPA 519
            G          +  L  L          + +G  K    + + + A+ +   ++P +L  
Sbjct: 272  GTSVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKFKVNKQVAIYAICVALSMIPSSLVV 331

Query: 520  TLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVP-- 577
             LTI        +  + +       +   G ++ +C DKTGTLT+  +  +  Q+ +P  
Sbjct: 332  VLTITMSAGAKVMATRHVIIRKLDSLEALGAVNDICSDKTGTLTQGKM--IAKQVWIPQF 389

Query: 578  ---SSHNSFQ-FADLVQDVHKLFPKFSLNDCSSPRDYRAKNFF-ISLLTCHSLRVVDNEL 632
               +  NS + F   + ++ +L PKFS      P  Y+  +   + ++T    +   +EL
Sbjct: 390  GTINVQNSNEPFNPTIGEI-QLIPKFS------PYQYKHDDEEDVGMITDFKSKYYADEL 442

Query: 633  IGDPLDFKMFQFTKWSYEED-------FQEKEFHSTYEERRHDNALPENIDI-------- 677
               PL+  +F  T+W Y          F++ E   T + + H +  P  I I        
Sbjct: 443  --GPLNVSLF--TQWLYTATLANIATVFRDPE---TQDWKAHGD--PTEIAIQVFATRMD 493

Query: 678  IPAVVHPNSADPENTFIDND---PHNFLGIIRSFEFLSELRRMSVIVKPSNED---VYWA 731
            +P  V     + +   I ND    H     +  + F S ++RMS I K   E    +Y  
Sbjct: 494  LPRRVLTGEDNDDEKNIHNDITFEH-----VAEYPFDSSVKRMSAIYKNVEEPKAPIYEV 548

Query: 732  FTKGAPEVITQICNK-------ATLPANFEEM------LNYYTHKGYRVIACAGRVLPRN 778
            FTKGA E + Q CN        +  P   E++      ++  + +G RV+A A +    +
Sbjct: 549  FTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNES 608

Query: 779  TWLYSQKV---SREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLT 835
             +  ++      R+ VE+N+ FLG +   +  ++E+   ++    A I   M TGD   T
Sbjct: 609  QFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGT 668

Query: 836  AISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSY 895
            A S+ ++  ++     + P               ++V N                     
Sbjct: 669  AKSIAQEVGILPHNLYHYP---------------KEVVN--------------------- 692

Query: 896  TLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFC 955
                    F ++   + +++S+  I+ + +   + AR +P  K  ++E L R N      
Sbjct: 693  --------FMVMTATDFDALSDKEIDELPVLPLVIARCAPQTKVRMIEALHRRNRFCAMT 744

Query: 956  GDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGR 1003
            GDG ND  +LK A+VGI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 745  GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 173/827 (20%), Positives = 335/827 (40%), Gaps = 163/827 (19%)

Query: 251  DSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCI-FLISILSIVDTL 309
            D  +IN++      +L +++ +   +  I S+++    + +   G + F++ I  ++   
Sbjct: 58   DDTKINIK-----GILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAY 112

Query: 310  VE--TRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCD- 364
             E    +T  SL  +S       V RD     + S +LVPGDI   ++ D      P D 
Sbjct: 113  QEYNASKTMNSLKSLS--TPSAHVIRDGNDITIQSKELVPGDICIIKVGD----TVPADL 166

Query: 365  SLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTII 424
             LL S +   +E++LTGES+PV+K  +E           ++T +   L+    F  +T+ 
Sbjct: 167  RLLESINLETDEALLTGESLPVAKSHSEVYE--------KDTPVGDRLN--LAFAASTVT 216

Query: 425  RARIPYGQSAALAMVVRTGFSTTKGSLVRSM-------------VFPKPTGFKFYEDSFK 471
            + R       A  +V++T  +T  G + +S+              F +       E    
Sbjct: 217  KGR-------ATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGS 269

Query: 472  YIG----------VMALIALFGFSISCIQFIKIGLDK----RTMILRALDIITIVVPPAL 517
            ++G          +  L  L          + +G  K    + + + A+ +   ++P +L
Sbjct: 270  FLGTNVGTPLHRKLSQLAILLFVVAVIFAIVVMGTQKYRVNKQVAIYAICVAISMIPSSL 329

Query: 518  PATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVP 577
               LTI        +  + +       +   G ++ +C DKTGTLT+  +  +  Q+ +P
Sbjct: 330  VVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM--IAKQVWIP 387

Query: 578  S------SHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFF-ISLLTCHSLRVVDN 630
                     ++  F   + ++H L PKFS      P  Y+  +   + ++     + +  
Sbjct: 388  QFGTITVQESNEPFNPTIGEIH-LIPKFS------PYQYKHDDEEDVGIIPDFKSKYLAG 440

Query: 631  ELIGDPLDFKMFQFTKWSYEED-------FQEKEFHSTYEERRHDNALPENIDIIPAVV- 682
            EL   PL+  +F   +W Y          FQ+ E   T + + H +     I +    + 
Sbjct: 441  EL--GPLNVSLFD--QWLYTATLANIATVFQDSE---TQDWKAHGDPTEIAIQVFATRMD 493

Query: 683  ---HPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNED----VYWAFTKG 735
               H  + + ++   D   ++    +  F F S ++RMS I K + ED    +Y  FTKG
Sbjct: 494  LPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYK-NTEDPATPIYEVFTKG 552

Query: 736  APEVITQICNK-ATLP------------ANFEEMLNYYTHKGYRVIACAGRVLPRNTWLY 782
            A E + Q C+   T P               ++ ++  + +G RV+A A +    + +  
Sbjct: 553  AFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA 612

Query: 783  SQKV---SREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISV 839
            ++      R+ VE  + FLG I   +  ++E+   ++   +A I   M TGD   TA S+
Sbjct: 613  NKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSI 672

Query: 840  GRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAI 899
             ++  ++     + P               ++V N                         
Sbjct: 673  AQEVGILPHNLYHYP---------------KEVVN------------------------- 692

Query: 900  TGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGA 959
                F ++   + +++S+  I+ + +   + AR +P  K  ++E L R +      GDG 
Sbjct: 693  ----FMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGV 748

Query: 960  NDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGR 1003
            ND  +LK A+VGI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 749  NDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795

>Scas_707.48*
          Length = 741

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 161/753 (21%), Positives = 295/753 (39%), Gaps = 140/753 (18%)

Query: 279  IFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFA-CEVRVFRDEFW 337
            + S I+ ++D+    A  I L  ++ +    V+  R++KSL  ++     E  + R    
Sbjct: 106  VVSFIMGNIDD----AVSITLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQE 161

Query: 338  TNVNSADLVPGDI--YEISDPSLTVFPCDSLLLSG-DCIVNESMLTGESVPVSKFPAEPE 394
            ++V ++ LVPGD+  ++I D      P D  ++   D  ++ES LTGE+ PV K  +  E
Sbjct: 162  SHVLASGLVPGDLVHFKIGDR----IPADLRIIEAVDLSIDESNLTGENEPVHK--SAKE 215

Query: 395  TMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRS 454
                  +D  N+ I         + GT +      +G+     +VV  G +T+ G++   
Sbjct: 216  VNKDSFNDQPNSIIPISDRTCVAYMGTLVKEG---HGK----GIVVGIGKNTSFGAIFEM 268

Query: 455  MV-FPKPTGFKFYEDSFKYIGV-MALIALFGFSISCIQFIKIGLDKRTMILRALDIITIV 512
            +    KP      +++   +G  ++L +     + C+  I  G     M   ++ +    
Sbjct: 269  LSNIEKPK--TPLQNAMDKLGKDLSLFSFIVIGLICLVGILQGRSWLEMFQISVSLAVAA 326

Query: 513  VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGV 572
            +P  LP  +T+     + R+ K+         V   G ++++C DKTGTLT N +    +
Sbjct: 327  IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTASKI 386

Query: 573  QLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNEL 632
              C+ S  N      L +        +   D  S           ++    S      + 
Sbjct: 387  -WCLDSMANKANVLSLEKSKSGSLKNYLTEDVKSTLTIG------NICNNASFSQEHGKY 439

Query: 633  IGDPLDFKMF-QFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPEN 691
            +G+P D  +  Q +K      F   +   T+++ +           IP            
Sbjct: 440  LGNPTDIALLEQLSK------FDLSDIRPTFKKVQE----------IPF----------- 472

Query: 692  TFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDV-----YWAFTKGAPEVITQICNK 746
                N    F+ +    + ++   + S+ VK + E V     ++   KG  E +TQ    
Sbjct: 473  ----NSKRKFMAV----KIVNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRD 524

Query: 747  ATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENK 806
              +     E  N    +G R++A A   LP +  L +     EE   ++ F G I   + 
Sbjct: 525  VII-----ETANSLASEGLRMLAFAKTTLPDSPTLLT-----EESVGDLIFTGLIGMNDP 574

Query: 807  LKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTS 866
             +      ++ L +  +  +M TGD+  TA+++ RQ        + +P            
Sbjct: 575  PRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQ--------IGIP------------ 614

Query: 867  IIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLK 926
                        LD +                       ++ GD+ N +S+D +  V+  
Sbjct: 615  -----------VLDPK---------------------LSVLSGDKLNEMSDDQLANVIDH 642

Query: 927  GTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFT 986
              I+AR +P+ K  ++  L++    V   GDG ND  ALK AD+G+S+      VA   +
Sbjct: 643  VNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEAS 702

Query: 987  SQVF---DISCVLDVIKEGRACL--VTSFSCFQ 1014
              V    D S +L  I+EG+     + +F  FQ
Sbjct: 703  DMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQ 735

>Kwal_23.3160
          Length = 1100

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 180/852 (21%), Positives = 335/852 (39%), Gaps = 166/852 (19%)

Query: 237  GLSSGVQEDRILAFDSNQINLRVKT-VAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAG 295
            GL S     R+  +  N +    K     +L +++ +   +    S+++      +   G
Sbjct: 42   GLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMILVLFISMVITLAIRDWISGG 101

Query: 296  CIFLISILSIVDTLVETRRTQKSLADMSHFAC-EVRVFRDEFWTNVNSADLVPGDIYEIS 354
             I  +  +++     +  +  K++  +   +     V RD     + S  LVPGD+  + 
Sbjct: 102  VIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDGNDETIPSKQLVPGDLCVVK 161

Query: 355  DPSLTVFPCDSLLLSGDCI---VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSY 411
              +    P D  L+  +C+    +E++LTGES+P++K  +      Q+    ++T +   
Sbjct: 162  --AGDTVPADLRLI--ECVNFETDEALLTGESLPIAKEAS------QVYPATEDTPVGDR 211

Query: 412  LSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSM-------------VFP 458
            L  +  F  +T+ + R       A  +VV+TG +T  G + +S+              F 
Sbjct: 212  L--NLAFASSTVSKGR-------ATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262

Query: 459  KPTGFKFYEDSFKYIGV---------MALIALFGFSISCIQFIKIGLDKRTMILRALDII 509
               G         ++G          ++ +A+  F I+ +  I +   ++ ++ + + I 
Sbjct: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIY 322

Query: 510  TIVV-----PPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTE 564
             I V     P +L   LTI        +  + +       +   G ++ +C DKTGTLT+
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382

Query: 565  NGLDVLGVQLCVPS------SHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFF-I 617
              + V   Q  VPS      S++S  F D      +L P+F      SP  Y+  +   +
Sbjct: 383  GKMIV--KQAWVPSFGTITVSNSSNPF-DPTDGGIELIPRF------SPHQYKHDSTEDV 433

Query: 618  SLLTCHSLRVVDNELIGDPLDFKMFQFTKW-------SYEEDFQEKEFHSTYEERRHDNA 670
             ++T    +  +++L   P       F  W       +    +Q+ E   T E + H + 
Sbjct: 434  GIITSFKNKFYNDKL---PAGLNSKLFLNWLKTAALANIAHVYQDPE---TEEWKAHGDP 487

Query: 671  LPENIDIIPAVVH-PNSA----DPENTFIDND-----------PHNFLGIIRSFEFLSEL 714
                I +    +  P +A    D  ++  D D           PH     I  F F S +
Sbjct: 488  TEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPH--YKHIAEFPFDSSI 545

Query: 715  RRMSVIVKPSNED-VYWAFTKGAPEVITQICNKATLPANFEEM----------------L 757
            +RMS +    +ED  +  FTKGA E +   C K  LP    E                 +
Sbjct: 546  KRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTK-WLPDGCNESDAKPMTEEDKEEVFKNV 604

Query: 758  NYYTHKGYRVIACAGRVLPRNTWLYSQ---KVSREEVESNMEFLGFIIFENKLKKETAKT 814
               + +G RV+A A +    +  L      + +R+ VES++ F G +   +  ++ETA  
Sbjct: 605  ETLSSEGLRVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGA 664

Query: 815  LQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDN 874
            ++   +A I   M TGD   TA ++ ++  ++     + P  E +DS   T+  +  +  
Sbjct: 665  VKQFHKAGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPK-EVVDSMVMTAAQFDQL-- 721

Query: 875  MDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMS 934
             D+ +D+  LLP+                                         + AR +
Sbjct: 722  TDEEIDNLLLLPL-----------------------------------------VIARCA 740

Query: 935  PDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---D 991
            P  K  +++ L R        GDG ND  +LK A+VGI++    + VA   +  V    +
Sbjct: 741  PQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDN 800

Query: 992  ISCVLDVIKEGR 1003
             + +L+ ++EGR
Sbjct: 801  FASILNAVEEGR 812

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 152/668 (22%), Positives = 266/668 (39%), Gaps = 118/668 (17%)

Query: 435  ALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKI 494
             +A VV TG  T +   + +      TG    E     I  +    +F  SI  + F   
Sbjct: 380  CIACVVYTGRDTRQA--MNTTTAKVKTGL--LELEINSISKILCACVFALSILLVAFAGF 435

Query: 495  GLDKRTM-ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI----GG 549
              D   + ILR L + + ++P +L   L +       +++       +  R +      G
Sbjct: 436  HNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLG 495

Query: 550  KIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQD-VHKLFP---------KF 599
            +I+ L  DKTGTLT+N + +  + L   S   + +  D+V D V  L           K 
Sbjct: 496  RIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--TSETLDIVSDYVQSLVSSKNDSLNNSKV 553

Query: 600  SLNDCSSPRDYRAKNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQ 654
            +L+       +R ++  ++L  CH++     D+EL      P +  + +FT         
Sbjct: 554  ALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT--------- 604

Query: 655  EKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSEL 714
            E    S ++  RH  +L          +H +S    N            I++ F F S+ 
Sbjct: 605  ESVGLSLFKRDRHSISL----------LHEHSGKTLN----------YEILQVFPFNSDS 644

Query: 715  RRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRV 774
            +RM +IV+    D YW   KGA  V+++I          EE       +G R +    + 
Sbjct: 645  KRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDW---LEEETGNMAREGLRTLVIGRKK 701

Query: 775  LPRNTWLYSQK---------VSREE---------VESNMEFLGFIIFENKLKKETAKTLQ 816
            L +  +   QK         ++R++         +E ++E LG    E+KL+K+   +++
Sbjct: 702  LNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIE 761

Query: 817  TLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMD 876
             L+ A I+  M TGD V TA  V     LI S+  YV ++ +             V   +
Sbjct: 762  LLRNAGIKIWMLTGDKVETARCVSISAKLI-SRGQYVHTITK-------------VTRPE 807

Query: 877  DTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL-LKGTIYARMSP 935
               +    L IN ++     L I G+   +          +++ + V+ L   I  R +P
Sbjct: 808  GAFNQLEYLKINRNA----CLLIDGESLGMFL----KHYEQEFFDVVVHLPTVIACRCTP 859

Query: 936  DEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSQVFD 991
             +K ++   ++++      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F 
Sbjct: 860  QQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF- 918

Query: 992  ISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIV 1051
                         C +T    +   + Y     +   V++ RG  +   Q +Y    L  
Sbjct: 919  -------------CHLTELLLWHGRNSYKRSAKLAQFVMH-RGLIIAICQAVYSICSLFE 964

Query: 1052 PIAIFMSW 1059
            PIA++  W
Sbjct: 965  PIALYQGW 972

>Kwal_23.5789
          Length = 1133

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 180/787 (22%), Positives = 313/787 (39%), Gaps = 151/787 (19%)

Query: 340  VNSADLVPGDIYEISDPSLTVFPCDSLLL-----SGDCIVNESMLTGE-------SVPVS 387
            V S DL  GD+ +I   +    P D +LL     SG+  +    L GE       + P++
Sbjct: 251  VPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLT 308

Query: 388  KFPAEPETM--LQLLDDFQNTQISSYLSK-SF-------LFNGTTIIRARIPYGQSAALA 437
            +  ++ + +  + +        I+++L K +F       L    T+    +      A+A
Sbjct: 309  QHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIA 368

Query: 438  MVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFK-------YIGVMALIALFGFSISCIQ 490
             VV TG + T+ ++  SM   K    +   +S         +I  +AL+A  GF+ +   
Sbjct: 369  CVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNN--- 424

Query: 491  FIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI--- 547
                  D    I+R L + + ++P +L   L +G      +++       +  R +    
Sbjct: 425  ------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPE 478

Query: 548  -GGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSS 606
              G+I+ L  DKTGTLT+N +++  + L   S   +    D+V D  +     +LN  + 
Sbjct: 479  DLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--TMDTMDIVTDYVRAMSD-NLNSSAV 535

Query: 607  P----RDY--RAKNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQE 655
            P    +D   R ++  ++L  CH +     D EL      P +  + +FT         E
Sbjct: 536  PSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFT---------E 586

Query: 656  KEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELR 715
                + +   RH   L          +H    D   T  + D      I+  F F S+ +
Sbjct: 587  SVGLTLFRRDRHSITL----------LH----DQSGTNFEYD------ILHVFPFNSDNK 626

Query: 716  RMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVL 775
            RM +++    +D YW   KGA  V+++I  K       EE       +G R +    + L
Sbjct: 627  RMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIGRKRL 683

Query: 776  PR------------------NTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQT 817
             +                  N  +    V  + +E ++E LG    E+KL+++   +++ 
Sbjct: 684  SKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIEL 743

Query: 818  LQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDD 877
            L+ A I+  M TGD V TA     +C  I +K V         S GQ       V+  + 
Sbjct: 744  LRNAGIKIWMLTGDKVETA-----RCVSISAKLV---------SRGQYVHTVTKVNKPEG 789

Query: 878  TLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDE 937
             L    LL IN +S     L I G+   +          E  +N   L   I  R +P +
Sbjct: 790  ALTHLELLKINTNS----CLLIDGESLGLYLEYYRQQFFEIVVN---LPAVIACRCTPQQ 842

Query: 938  KHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT-SQVFDI 992
            K ++   ++ +      C GDG ND   +++ADVG+ +   E   AS+AA F+ +Q   +
Sbjct: 843  KADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHL 902

Query: 993  SCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVP 1052
            S +L  +  GR     S    Q++ ++  +       +YS  S                P
Sbjct: 903  SKLL--LWHGRNSYKRSAKLAQFV-IHRGLLISVCQAVYSISSKFE-------------P 946

Query: 1053 IAIFMSW 1059
            IA++  W
Sbjct: 947  IALYQGW 953

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 176/792 (22%), Positives = 313/792 (39%), Gaps = 142/792 (17%)

Query: 334  DEFWTNVNSADLVP------GDIYEISDPSLTVFPCDSLLL-----SGDCIVNESMLTGE 382
            +E +  +N A LVP      GD+ +I     T  P D +LL     SG+  +    L GE
Sbjct: 249  NELYEVLNKAQLVPSKDLKVGDLIKIHKG--TRIPADLVLLQSSEPSGESFIKTDQLDGE 306

Query: 383  S---VPVSKFPAEPETMLQLLDDFQNT------QISSYLSK--------SFLFNGTTIIR 425
            +   + V+    +  +   LL+    T       I  +L K        + L    T+  
Sbjct: 307  TDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWA 366

Query: 426  ARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFS 485
              +     + +  VV TG + T+ ++  +M   K TG    E     +  +    +F  S
Sbjct: 367  NTVLASVGSCIGCVVYTG-TDTRQAMNTTMSSVK-TGL--LELEINSLSKILCACVFVLS 422

Query: 486  ISCIQFIKIG-LDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTR 544
            I  + F   G  D    I+R L + + ++P +L   L +G      +++       +  R
Sbjct: 423  IVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIPDTIVR 482

Query: 545  VNI----GGKIDILCFDKTGTLTENGLDVLGVQL-CVPSSHNSFQFA-DLVQDVHKLFPK 598
             +      G+I+ L  DKTGTLT+N + +  + L  V  + ++     D VQ++      
Sbjct: 483  TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIVTDYVQELVSSSTT 542

Query: 599  FSLNDCSSPRDY--RAKNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEE 651
              +   ++ +D   R ++  ++L  CH++     D EL      P +  + +FT      
Sbjct: 543  TPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT------ 596

Query: 652  DFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNF-LGIIRSFEF 710
               E    S ++  RH  +L           H +SA            NF   I++ F F
Sbjct: 597  ---ESVGLSLFKRDRHSVSL----------FHQHSAT-----------NFEYDILQVFPF 632

Query: 711  LSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIAC 770
             S+ +RM +IV    +  +W   KGA  V+ +I          +E +     +G R +  
Sbjct: 633  NSDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDW---LDEEVGNMAREGLRTLVI 689

Query: 771  AGRVLPRNTWLYSQK------------------VSREEVESNMEFLGFIIFENKLKKETA 812
              + L   ++   +K                  V ++ +E N+E LG    E+KL+ +  
Sbjct: 690  GRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVK 749

Query: 813  KTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDV 872
             +++ L+ A ++  M TGD V TA  V     LI S+  YV ++ ++             
Sbjct: 750  SSIELLRNAGVKIWMLTGDKVETARCVSISAKLI-SRGQYVHTVTKLSRP---------- 798

Query: 873  DNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL-LKGTIYA 931
               +  L++   L IN SS     L I G+   +          +++ + V+ L   I  
Sbjct: 799  ---EGALNALEYLKINKSS----CLLIDGESLGMFL----TYYKQEFFDIVVDLPAVIAC 847

Query: 932  RMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTS 987
            R +P +K ++   ++ +      C GDG ND   ++ ADVG+ +   E   AS+AA F+ 
Sbjct: 848  RCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSV 907

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDL 1047
              F              C +T    +   + Y     +   V++ RG  +   Q +Y   
Sbjct: 908  TQF--------------CHLTKLLLWHGRNSYKRSAKLAQFVIH-RGLIISVCQAVYSVC 952

Query: 1048 LLIVPIAIFMSW 1059
                PIA++  W
Sbjct: 953  SKFEPIALYQGW 964

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 186/830 (22%), Positives = 322/830 (38%), Gaps = 156/830 (18%)

Query: 291  YYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDI 350
            Y   G + ++ I+S V   VE  +   +  +++H  C+V   R   +      D+  GDI
Sbjct: 252  YTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDI 311

Query: 351  YEISDPSLTVFPCDSLLLS-----GDCIVNESMLTGES-VPVSKFPAEPETML------- 397
              +   S    P D ++LS     G C +  + L GE+ + + +   E    L       
Sbjct: 312  IRVR--SEEAIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCK 369

Query: 398  ---QLLDDFQNTQISSYLSKSFLFNGTT--------IIRARIPYGQSAALAMVVRTGFST 446
               ++  +  N+ + +Y   +   NG+T        ++R       +    ++V TG  T
Sbjct: 370  LHGRVQSEHPNSSLYTY-EGTMTLNGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHET 428

Query: 447  TKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSI------------------SC 488
                L+R+      T       + + +  M ++ALFG  I                  + 
Sbjct: 429  ---KLMRN-----ATATPIKRTAVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAH 480

Query: 489  IQFIKI-GLDKRTMILRALDIITI------VVPPALPATL---------TIGTGFALSRL 532
            + ++ I G +K  +  +  DI+T       +VP +L  T+          IG+   L   
Sbjct: 481  LGYLYIEGTNKAGLFFK--DILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHE 538

Query: 533  KKKGIFCISPTRVNIG------GKIDILCFDKTGTLTENGLDVLGVQL---CVPSSHNSF 583
            +       +PT V         G+I+ +  DKTGTLT N ++   V +   C   +    
Sbjct: 539  ESD-----TPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPED 593

Query: 584  QFADLVQDVHKLFPKF-SLND-CSSPRDYRAK---NFFISLLTCHSLRVVDNELIGDPLD 638
            + A +   +   F  F SL D  + P D  A     F   L TCH+  V+        + 
Sbjct: 594  RRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHT--VIPETQSDGTIK 651

Query: 639  FKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDP 698
            ++     + +  +   +  F   ++ RR                 PNS      F +   
Sbjct: 652  YQAASPDEGALVQGAADLGFR--FDIRR-----------------PNSVSISTPFSEQLE 692

Query: 699  HNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLP--ANFEEM 756
            +  L I    EF S  +RMS I +  +  +   F KGA  VI +  +    P   +    
Sbjct: 693  YQLLNIC---EFNSTRKRMSAIFRMPDGSIK-LFCKGADTVILERLDSEFNPYVQSTLRH 748

Query: 757  LNYYTHKGYRVIACAGRVLPRNTWLYSQKV-----------------SREEVESNMEFLG 799
            L  Y  +G R +  A R +P   +    K+                 + E +E ++ FLG
Sbjct: 749  LEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLG 808

Query: 800  FIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEI 859
                E+KL++   +T+  LQEA ++  + TGD   TAI++G  C L+      +   EE 
Sbjct: 809  ATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEET 868

Query: 860  DSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDY 919
                +T        N+   L++     I+     S  L I G        ++     ED 
Sbjct: 869  KEDTRT--------NLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEED----LEDQ 916

Query: 920  INTV--LLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSE 976
              T+  L K  I  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ +S 
Sbjct: 917  FLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISG 976

Query: 977  AE---ASVAAPFTSQVFDISCVLDVIKEG----RACLVTSFSCFQYMSLY 1019
             E   A+ +A F    F     L ++       R  L   +S ++ M+LY
Sbjct: 977  MEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY 1026

>Kwal_47.17547
          Length = 1240

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 99/417 (23%), Positives = 175/417 (41%), Gaps = 98/417 (23%)

Query: 704  IIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQIC-------NKATL--PANFE 754
            I++   F S  +   ++VK  N  ++  + KGA E++ + C       +K TL    +F+
Sbjct: 586  IVQIIPFESSRKWGGIVVKYKN-GLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFD 644

Query: 755  EMLNYYTH---KGYRVIACAGRVLPR-NTW------------------LYSQKVSR---- 788
            E     T+   +  R I+ A R  P    W                  L+  +VSR    
Sbjct: 645  EESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSV 704

Query: 789  ----EEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCN 844
                +E+ S M   G +  ++ L+K   K+++  Q+A +   M TGDN+LTA ++ ++C+
Sbjct: 705  SEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCS 764

Query: 845  LIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIF 904
            ++  ++   P                                           ++ G  F
Sbjct: 765  ILSEEQAENPES-----------------------------------------SMEGPRF 783

Query: 905  RIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGA 964
            R +   E   I        L    + AR SP++K  L+E L+++   V   GDG ND  A
Sbjct: 784  RKLSNKERVRI--------LPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPA 835

Query: 965  LKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGRACLVTSFSCFQYMSLYSA 1021
            LK ADVG S+  A   VA   +  +    D S +++ IK GR C+ TS   F    L   
Sbjct: 836  LKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGR-CVSTSIKKFIQFQLTVN 894

Query: 1022 IQFITITVLYSRGSN-----LGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSA 1073
            +  + +T + +  S+     L   Q L+++L++    A+ ++  KP + I++++P  
Sbjct: 895  VTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENILERKPKG 951

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 108/265 (40%), Gaps = 29/265 (10%)

Query: 328 EVRVFR--DEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVP 385
           EV V R  DE   +++  D++ GDI  +   +  V P D +L+ G C  +ES LTGES  
Sbjct: 187 EVIVLRNGDEHLISIH--DILVGDILSLQ--TGDVVPADCILVKGSCECDESALTGESAT 242

Query: 386 VSKFPA----EPETMLQLLDDFQN--TQISSYLSKSFLFNGTTIIRARIPYGQSAALAMV 439
           + K       E    L   D   +  T  +  +    L +G+ ++      G++   ++ 
Sbjct: 243 IKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSG---LGRAVVTSVG 299

Query: 440 VRTGFSTTKGSL-VRSMVFPKPTGFKFYEDSFKYIGVMALIALF-------------GFS 485
           V +    T  +L V +   P         +S    G  A + LF             G  
Sbjct: 300 VNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGE 359

Query: 486 ISCIQFIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRV 545
           +  +   + G     + +  + +I + VP  LP  +T+   FA +R+ K G         
Sbjct: 360 LHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLRAC 419

Query: 546 NIGGKIDILCFDKTGTLTENGLDVL 570
              G    +C DKTGTLTEN + V+
Sbjct: 420 ETMGSATAVCSDKTGTLTENRMTVV 444

>Scas_704.38
          Length = 1161

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 166/750 (22%), Positives = 289/750 (38%), Gaps = 143/750 (19%)

Query: 306 VDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDS 365
           +D +   RR  +S +++ H   + ++        V S DL  GD+ +IS       P D 
Sbjct: 249 MDDIQRRRRDNESNSELYHVLNQSKL--------VPSKDLKVGDLIKISKGDR--LPADL 298

Query: 366 LLL-----SGDCIVNESMLTGE-------SVPVSKFPAEPETM--LQLLDDFQNTQISSY 411
           +LL     SG+  +    L GE       +  +++   EP+ M  + +        I ++
Sbjct: 299 VLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNF 358

Query: 412 LSK--------SFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGF 463
           L K        + L    T+    +       +  VV TG  T +   + +      TG 
Sbjct: 359 LGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQA--MNTTTATVKTGL 416

Query: 464 KFYEDSFKYIGVMALIALFGFSISCIQFIKI-GLDKRTMILRALDIITIVVPPALPATLT 522
              E     I  +   ++F  SI  + F      D    ++R L + + ++P +L   L 
Sbjct: 417 --LELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLD 474

Query: 523 IGTGFALSRLKKKGIFCISPTRVNI----GGKIDILCFDKTGTLTENGLDVLGVQLCVPS 578
           +       +++       +  R +      G+I+ L  DKTGTLT+N + +  + L   S
Sbjct: 475 LAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVS 534

Query: 579 SHNSFQFADLVQDV--------------HKLFPKFSLNDCSSPRDYRAKNFFISLLTCHS 624
              + +  D+V D                K  P  S  D S+    R ++  ++L  CH+
Sbjct: 535 Y--TSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSA----RVRDMVVTLAICHN 588

Query: 625 LRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIP 679
           +     D+EL      P +  + +FT         E    S ++  RH  +L        
Sbjct: 589 VTPTFEDDELTYQAASPDEIAIVKFT---------ESVGLSLFKRDRHSISL-------- 631

Query: 680 AVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEV 739
             +H +S                 I++ F F S+ +RM +IV    +D YW   KGA  V
Sbjct: 632 --LHGHSGSILT----------YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTV 679

Query: 740 ITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQK---------VSREE 790
           + +I          EE       +G R +    + L RN +   +K         V+R++
Sbjct: 680 MARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQ 736

Query: 791 ---------VESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGR 841
                    +E ++E LG    E+KL+ +   +++ L+ A I+  M TGD V TA  V  
Sbjct: 737 QMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 796

Query: 842 QCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITG 901
              LI              S GQ   I   +   +  L+    L +N  +     L I G
Sbjct: 797 SAKLI--------------SRGQYVHIITKLTKPEGALNQLEYLKVNKGA----CLLIDG 838

Query: 902 DIFRIIFGDENNSISEDYINTVLLKGTIYA-RMSPDEKHELMEQLQRLNYTVGFC-GDGA 959
           +   +           ++ + V+   T+ A R +P +K ++   ++        C GDG 
Sbjct: 839 ESLGMFL----RYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894

Query: 960 NDCGALKAADVGISLSEAE---ASVAAPFT 986
           ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 895 NDVSMIQCADVGVGIVGKEGKQASLAADFS 924

>Kwal_26.7070
          Length = 1315

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 191/851 (22%), Positives = 338/851 (39%), Gaps = 171/851 (20%)

Query: 243 QEDRILAFDSNQINLRVKTVA----ELLFNEVLHPFYVFQIFSIILWSL-----DEYYYY 293
           + +R   F SN I+     +A    + LF E      +F +F+  +  +        Y  
Sbjct: 190 EANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTT 249

Query: 294 AGCIFLISILSIVDTLVETRRTQKSLADMSH-----FACEVRVFRDEFWTNVNSADLVPG 348
            G + ++ I+S +  +VE  +  +S ++++      F+ +++ F    W N++  D++  
Sbjct: 250 IGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKV 309

Query: 349 DIYEISDPSLTVFPCDSLLLS-----GDCIVNESMLTGES--------VPVSKFPAEPE- 394
           +  E         P D ++++     G C +  + L GE+        +  SKF  + + 
Sbjct: 310 NSEE-------AIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDL 362

Query: 395 --TMLQLLDDFQNTQISSYLSKSFLFNGTTI--------IRARIPYGQSAALAMVVRTGF 444
                ++L +  N+ + +Y   +   NG  I        +R       +    +VV TG 
Sbjct: 363 AGMRGKVLSEHPNSSLYTY-EGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGH 421

Query: 445 STTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSI------SCIQFIKIGLDK 498
            T    L+R+      T       + + +  M ++ALFG  I      S    IK+  D 
Sbjct: 422 ET---KLMRN-----ATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDA 473

Query: 499 RTMILRAL-----------DIITI------VVPPALPATLTIGTGFAL----SRLKKKGI 537
             +    L           DI+T       +VP +L  T+ +   +      S L     
Sbjct: 474 EHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDE 533

Query: 538 FCISPTRVNIG------GKIDILCFDKTGTLTENGLDVLGVQL---CVPSSHNSFQFADL 588
              SPT V         G+I+ +  DKTGTLT N ++     +   C   +    + A  
Sbjct: 534 ASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATT 593

Query: 589 VQDVHKLFPKF-----SLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQ 643
              +   F KF     +LND   P  +   +F   L TCH++                  
Sbjct: 594 EDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVI----------------- 636

Query: 644 FTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIP---AVVHPNSADPENTFIDN---- 696
                   +FQE            + AL E    +     +  PNS    +  I++    
Sbjct: 637 -------PEFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSV---SVLIEDLGQE 686

Query: 697 DPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEM 756
             +  L I    EF S  +RMS I +  N ++   F KGA  VI +       P   E  
Sbjct: 687 QEYQLLNIC---EFNSTRKRMSAIFRLPNGEIKL-FCKGADTVILERLKAGENPY-IEAT 741

Query: 757 LNY---YTHKGYRVIACAGRVLPRNTW-----LY----------SQKV--SREEVESNME 796
           L +   Y  +G R +  A R +  + +     +Y          +QK+  + E +E ++ 
Sbjct: 742 LRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLF 801

Query: 797 FLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLI-KSKKVYVPS 855
            LG    E+KL+    +T+ TLQ+A I+  + TGD   TA+++G  C L+ +   + + +
Sbjct: 802 LLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIIN 861

Query: 856 LEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSI 915
            E+ ++T +         N+ + L + +   I+     S  L I G    + F  E +  
Sbjct: 862 EEDKEATRK---------NLTEKLKAISDHQISQQDMNSLALVIDGK--SLGFALEAD-- 908

Query: 916 SEDYINTV--LLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGI 972
            EDY+  +  L K  I  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+
Sbjct: 909 LEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGV 968

Query: 973 SLSEAEASVAA 983
            +S  E   AA
Sbjct: 969 GISGMEGMQAA 979

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 130/536 (24%), Positives = 217/536 (40%), Gaps = 109/536 (20%)

Query: 502 ILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI----GGKIDILCFD 557
           I+R L + + ++P +L   L +       +++       +  R +      G+I+ L  D
Sbjct: 438 IMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSD 497

Query: 558 KTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSS---PRDYRAKN 614
           KTGTLT+N + +  V L   S   + + AD+V D  +   + S ND  +   PR    K+
Sbjct: 498 KTGTLTQNDMQLKKVHLGNVSY--TTETADIVSDYIQGMIE-SKNDSVTNLGPRSTTRKD 554

Query: 615 -------FFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQEKEFHSTY 662
                     +L  CH++     D+EL      P +  + +FT         E    S +
Sbjct: 555 AATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT---------ESVGLSLF 605

Query: 663 EERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVK 722
           +  RH  +L          +H +S     T ++ D      ++  F F S+ +RM +IV 
Sbjct: 606 KRDRHSMSL----------LHEHSG----TILNYD------VLTMFPFNSDTKRMGIIVY 645

Query: 723 PSNEDVYWAFTKGAPEVITQICNKATLPAN---FEEMLNYYTHKGYRVIACAGRVLPRNT 779
              +D YW   KGA  V+ +I       AN    EE       +G R +    + L +  
Sbjct: 646 DKQKDQYWFLQKGADTVMNRIV------ANNDWLEEETGNMAREGLRTLVIGRKKLTKK- 698

Query: 780 WLYSQ-KVSREEV-------------------ESNMEFLGFIIFENKLKKETAKTLQTLQ 819
            +Y Q K   EEV                   E ++E LG    E+KL+K+   +++ L+
Sbjct: 699 -IYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLR 757

Query: 820 EASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTL 879
            A I+  M TGD V TA  V     LI              S GQ   +   +   +   
Sbjct: 758 NAGIKIWMLTGDKVETARCVSISAKLI--------------SRGQYVHVVTKLSKPEGAF 803

Query: 880 DSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVL-LKGTIYARMSPDEK 938
           +    L +N ++     L I G+   +          +++ + V+ L   I  R +P +K
Sbjct: 804 NQLEYLKVNKNAC----LLIDGESLGMFL----KYYRQEFFDVVVHLPTVIACRCTPQQK 855

Query: 939 HELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSQVF 990
            ++   ++ L      C GDG ND   ++ ADVG+ +   E   AS+AA F+   F
Sbjct: 856 ADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF 911

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 147/658 (22%), Positives = 261/658 (39%), Gaps = 122/658 (18%)

Query: 441  RTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRT 500
            R   +TTK      ++  +  G      +  ++  + L+A  GF+ +         D   
Sbjct: 395  RQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNN---------DWYV 445

Query: 501  MILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI----GGKIDILCF 556
             I+R L + + ++P +L   L +G      +++       +  R +      G+I+ L  
Sbjct: 446  DIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLS 505

Query: 557  DKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQD-VHKLFPKFSLNDCSSPRDY---RA 612
            DKTGTLT+N + +  + L   S  N  +  D+V D +  +  + S +  ++ R     R 
Sbjct: 506  DKTGTLTQNDMQLKKIHLGTVSYTN--ETMDIVTDFIQSMNSRTSNSTPTTTRKNISDRV 563

Query: 613  KNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRH 667
             +   +L  CH++     D EL      P +  + +FT         E    S +   RH
Sbjct: 564  IDLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFT---------ESVGLSLFRRDRH 614

Query: 668  DNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIR-SFEFLSELRRMSVIVKPSNE 726
              +L                     F D+        I+  F F S+ +RM VI+    +
Sbjct: 615  SISL---------------------FHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLK 653

Query: 727  DVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTW------ 780
              YW   KGA  V++ I  +       EE  +    +G R +    + L  N +      
Sbjct: 654  QEYWFLQKGADTVMSSIVVRNDW---LEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKE 710

Query: 781  ------------LYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMC 828
                        ++ Q V R+ +E+++E LG    E+KL+K+   +++ L+ A I+  M 
Sbjct: 711  YSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWML 770

Query: 829  TGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPIN 888
            TGD V TA  V     LI S+  YV ++ +             V+  +  L     L +N
Sbjct: 771  TGDKVETARCVSISAKLI-SRGQYVHTVTK-------------VNKPEGALHHLEYLQVN 816

Query: 889  NSSSTSYTLAITGD---IFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQL 945
             +S     L I G+   ++   F DE   I       V L   +  R +P +K ++   +
Sbjct: 817  QNS----CLLIDGESLGLYLQYFPDEFFDI------VVNLPTVVACRCTPQQKADVAVFI 866

Query: 946  QRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFTSQVFDISCVLDVIKE 1001
            ++       C GDG ND   ++ ADVG+ +   E   AS+AA F+   F           
Sbjct: 867  RQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQF----------- 915

Query: 1002 GRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIFMSW 1059
               C +T    +   + Y +   ++  V++ RG  +   Q +Y    +  P+A++  W
Sbjct: 916  ---CHLTKLLLWHGRNSYKSSAKLSQFVIH-RGLIISVCQAVYSICSMFEPLALYQGW 969

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 134/554 (24%), Positives = 228/554 (41%), Gaps = 104/554 (18%)

Query: 549  GKIDILCFDKTGTLTENGLDVLGVQLC-------VPSSHNSFQFADLVQDVHKLFPKFSL 601
            G+I+ +  DKTGTLT N ++     +        +P    +  F D ++  ++ F     
Sbjct: 535  GQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAA-TFEDGIEVGYRSFDDLKK 593

Query: 602  NDCSSPRDYRAKNFFISLL-TCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHS 660
               ++  D +  + F++LL TCH++                          +FQ      
Sbjct: 594  QLTTNSDDCKIIDEFLTLLATCHTVI------------------------PEFQADGSIK 629

Query: 661  TYEERRHDNALPENIDIIP---AVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRM 717
                   + AL E   ++     +  PNS       I+ +      ++   EF S  +RM
Sbjct: 630  YQAASPDEGALVEGGALLGYKFLIRKPNSV---TILINEEEEREYQLLNICEFNSTRKRM 686

Query: 718  SVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANF-----EEMLNYYTHKGYRVIACAG 772
            S I +  ++ +     KGA  VI +   + +   NF        L  Y  +G R +  A 
Sbjct: 687  SAIFRFPDDSIK-LLCKGADSVILE---RLSETGNFYVDATTRHLEDYATEGLRTLCLAT 742

Query: 773  RVLPR---NTW------------LYSQKVSR--EEVESNMEFLGFIIFENKLKKETAKTL 815
            + +P    N W              ++K+    EE+ES +  +G    E+KL++    T+
Sbjct: 743  KDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTI 802

Query: 816  QTLQEASIRTVMCTGDNVLTAISVGRQCNLI-KSKKVYVPSLEEIDSTGQTSIIWRDVDN 874
            +TLQEA I+  + TGD   TAI++G  C L+ +   + + S E  ++T +         N
Sbjct: 803  RTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRR---------N 853

Query: 875  MDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTV--LLKGTIYAR 932
            M++ L +  L   + S     TLA+  D   + F  E +   EDY   +  + K  I  R
Sbjct: 854  MEEKLAA--LHEHSLSEHDMNTLALVIDGHSLSFALEAD--LEDYFLAIGKMCKAVICCR 909

Query: 933  MSPDEKHELMEQLQR-LNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVFD 991
            +SP +K  +++ ++R  N  +   GDGAND   ++AA VG+ +S  E   AA    +  D
Sbjct: 910  VSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA----RSAD 965

Query: 992  ISCVLDVIKEGRACLVTSFSCFQYMSLYSAI---QFITITVLYSRGSNLGDF--QFLYID 1046
            IS             V  F   + + L       Q I++ +LYS   N   +  QF Y+ 
Sbjct: 966  IS-------------VGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVF 1012

Query: 1047 LLLIVPIAIFMSWS 1060
                   +I  SW+
Sbjct: 1013 ANAFSGQSIMESWT 1026

>Scas_499.3
          Length = 346

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 102/210 (48%), Gaps = 13/210 (6%)

Query: 201 FQYRYITFIYSPVEDIFKTNNNWTD--PDWVDLSSTLRGLSSGVQEDRILAFDSNQINLR 258
           FQ++   F++   E  F +     D  P   D    +       Q  R+  +  N  ++ 
Sbjct: 128 FQFQKKRFLWHEKEQSFSSPKFIVDESPKVKDFKDCVGNSGDLTQLRRL--YGENAFDIP 185

Query: 259 VKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETR-RTQK 317
           V T  EL     + P +VFQ+F + LW LDE++YY+    L+ I+S+    V  R ++ K
Sbjct: 186 VPTFMELFKEHAVAPLFVFQLFCVALWLLDEFWYYS-LFNLMMIVSMEGAAVFQRLQSLK 244

Query: 318 SLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPS-LTVFPCDSLLLSGDCIVNE 376
               M      + V R+E W  + + +L+  D+  ++  +  +  PCD +L+ G CIVNE
Sbjct: 245 EFRTMGIKPFAINVLRNEHWVTLQTNELLTMDVVSLTTTTEESAIPCDMILIDGACIVNE 304

Query: 377 SMLTGESVPVSK-----FPAEPETMLQLLD 401
           +M +GES P+ K      P E + +L+ +D
Sbjct: 305 AM-SGESTPLLKESIQLRPGEDDLLLESID 333

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 139/316 (43%), Gaps = 64/316 (20%)

Query: 708  FEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQIC--------NKATLPAN-----FE 754
            F F S ++RMS + +  +   Y  +TKGA E +   C        N AT+  +      +
Sbjct: 530  FPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIK 589

Query: 755  EMLNYYTHKGYRVIACAGRVLPRNTWLYS--QKVSREE--VESNMEFLGFIIFENKLKKE 810
            E ++  + +G RV+A A +  P++       QK+ +E    E+ + FLG I   +  ++E
Sbjct: 590  ENIDSMSSEGLRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREE 649

Query: 811  TAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWR 870
            TA  ++   +A I   M TGD   TA ++ ++  ++ +  +Y  S E +D          
Sbjct: 650  TAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILPT-NLYHYSKEVVD---------- 698

Query: 871  DVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIY 930
                                      + +TG  F        +++SED I+ + +   + 
Sbjct: 699  -------------------------IMVMTGKQF--------DNLSEDEIDNLPVLPLVI 725

Query: 931  ARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF 990
            AR SP  K  ++E L R        GDG ND  +LK A+VGI++    + VA   +  V 
Sbjct: 726  ARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVL 785

Query: 991  ---DISCVLDVIKEGR 1003
               + + +L+ ++EGR
Sbjct: 786  SDDNFASILNAVEEGR 801

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/344 (20%), Positives = 153/344 (44%), Gaps = 54/344 (15%)

Query: 265 LLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSH 324
           +L +++ +   +  I S+I+      +   G I  +  ++++  L++  +  K++  +  
Sbjct: 61  MLIHQICNAMILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRA 120

Query: 325 FAC-EVRVFRDEFWTNVNSADLVPGD--IYEISDPSLTVFPCDSLLLSGDCI-VNESMLT 380
            +     V R+     V+S D+VPGD  + ++ D      P D  L+S      +E++LT
Sbjct: 121 LSSPNAHVIRNGNSEVVDSTDVVPGDLVVVKVGD----TIPADLRLVSQQNFETDEALLT 176

Query: 381 GESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVV 440
           GES+PVSK   E      + DD   T +   +  +  F+ +T+++ R       A  + +
Sbjct: 177 GESLPVSKDANE------IFDD--ETPVGDRI--NLAFSSSTVVKGR-------AQGIAI 219

Query: 441 RTGFSTTKGSLVRSM-----VFPKPTGFKFYEDSF--------KYIGV---------MAL 478
           +TG +T  G + +S+     +  +     +Y++++         ++G          ++ 
Sbjct: 220 KTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSK 279

Query: 479 IALFGFSISCIQFIKIGLDKRTMILRALDIITIVV-----PPALPATLTIGTGFALSRLK 533
           +A+  F I+ +  I +   ++  + R + I  + V     P +L   LTI      + + 
Sbjct: 280 LAVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMA 339

Query: 534 KKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQLCVP 577
            + +       +   G ++ +C DKTGTLT+  +  +  Q+ VP
Sbjct: 340 SRNVIIRKLDSLEALGAVNDICSDKTGTLTQGKM--IAKQIWVP 381

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
           complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 132/298 (44%), Gaps = 37/298 (12%)

Query: 709 EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLP--ANFEEMLNYYTHKGYR 766
           EF S  +RMS I +  +  +     KGA  VI +     + P  A     L  Y  +G R
Sbjct: 693 EFNSTRKRMSAIFRFPDNSIR-LLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLR 751

Query: 767 VIACAGRVLPRNTW-----LY----------SQKVSR--EEVESNMEFLGFIIFENKLKK 809
            +  A R +P + +     LY          S+++ +  E +E  +  LG    E+KL+ 
Sbjct: 752 TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811

Query: 810 ETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSII- 868
              +T+ TLQ+A I+  + TGD   TAI++G  C L+      +   E+   + + ++I 
Sbjct: 812 GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLID 871

Query: 869 -WRDV-DNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLK 926
             R + D+     D  TL  + +  S  + L    + F +  G              + +
Sbjct: 872 KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGK-------------MCR 918

Query: 927 GTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAEASVAA 983
             I  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ +S  E   AA
Sbjct: 919 AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 976

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 127/307 (41%), Gaps = 59/307 (19%)

Query: 799  GFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEE 858
            G +   + L+    ++++  Q++ +   M TGDN+ T  ++ R C ++            
Sbjct: 708  GVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGIL------------ 755

Query: 859  IDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISED 918
                                         + S    +  A+ G +FR         +S  
Sbjct: 756  -----------------------------SESEYADHECAMEGPVFR--------KLSRR 778

Query: 919  YINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAE 978
             +     K  + AR SP++K   ++ L+++N  V   GDG ND  AL  ADVG S+  + 
Sbjct: 779  QMMDAAPKLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISG 838

Query: 979  ASVAAPFTSQVF---DISCVLDVIKEGRACL---VTSFSCFQYMSLYSAIQFITITVLYS 1032
              VA   +  +    D + +++ IK GR C+   +  F  FQ     +A+    +T + S
Sbjct: 839  TGVAREASDIILMTDDFTSIVNAIKWGR-CVSLSIKKFIQFQLTVNITAVTLTCVTAVTS 897

Query: 1033 RGSN--LGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRPSANLVSPKILIPLLASIVV 1090
               N  L   Q L+++L++    A+ ++  KP   I+++ P+    SP I +     I+ 
Sbjct: 898  TEENPVLTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGR-DSPLIAVSTWKMILG 956

Query: 1091 VLLFQII 1097
              + Q+I
Sbjct: 957  QAVLQLI 963

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 117/287 (40%), Gaps = 35/287 (12%)

Query: 328 EVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVS 387
           EV V R+     ++  DL+ GD+  +   +  V P D +L+ G C  +ES +TGES  + 
Sbjct: 184 EVVVVRNGDKHVISVHDLLVGDLLSLQ--TGDVVPVDCILVEGKCECDESGITGESDTIK 241

Query: 388 KFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAAL-----AMVVRT 442
           K        LQ+         S+ +  S   NG +++   +    S  L     A+V   
Sbjct: 242 KVSLA--MSLQVYRTVAADNPSADIGSSD--NGHSLVPDPMLISGSKLLSGIGHAVVTAV 297

Query: 443 GFSTTKGSLVRSMVF-PKPTGFK-----FYEDSFKYIGVMALIALFGFSISCIQFIKIG- 495
           G  +  G ++ ++   P+ T  +       +D   Y  V A +      +  + ++  G 
Sbjct: 298 GPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPKGR 357

Query: 496 ----LDKRTMILRALDIITIVV-------PPALPATLTIGTGFALSRLKKKGIFCISPTR 544
               L       R +DI    V       P  LP  +T+   FA +R+ K G        
Sbjct: 358 LYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRA 417

Query: 545 VNIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQD 591
               G    +C DKTGTLT+N + V  V+  + SSH    F D+ +D
Sbjct: 418 CETMGSATTVCSDKTGTLTQNKMVV--VKGFLGSSH----FDDISED 458

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 166/381 (43%), Gaps = 55/381 (14%)

Query: 709  EFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKAT---LPANFEEMLNYYTHKGY 765
            EF S  +RMS I +  +  +   F KGA  VI +  +      + A    + +Y + +G 
Sbjct: 697  EFNSTRKRMSAIFRFPDGSIK-LFCKGADTVILERLDDEANQYVEATMRHLEDYAS-EGL 754

Query: 766  RVIACAGRVLPRNTW-----LYSQKVS----REE--------VESNMEFLGFIIFENKLK 808
            R +  A R +    +     +Y++  +    R E        +E N+  +G    E+KL+
Sbjct: 755  RTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQ 814

Query: 809  KETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLI-KSKKVYVPSLEEIDSTGQTSI 867
                +T+ TLQEA I+  + TGD   TAI++G  C L+ +   + + + E  D T +   
Sbjct: 815  DGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTER--- 871

Query: 868  IWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTV--LL 925
                  N+ + +++     ++     S  L I G         E     EDY+ TV  L 
Sbjct: 872  ------NLLEKINALNEHQLSTHDMKSLALVIDGKSLGFALEPE----LEDYLLTVAKLC 921

Query: 926  KGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAEASVAAP 984
            K  I  R+SP +K  +++ ++R + ++      GAND   ++AA VG+ +S  E   AA 
Sbjct: 922  KAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAA- 980

Query: 985  FTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDF--QF 1042
               +  DI+  L   K  +  L+   S         + Q I++ +LYS   N   +  QF
Sbjct: 981  ---RSADIA--LGQFKFLKKLLLVHGSW--------SYQRISVAILYSFYKNTALYMTQF 1027

Query: 1043 LYIDLLLIVPIAIFMSWSKPY 1063
             Y+        +I  SW+  +
Sbjct: 1028 WYVFANAFSGQSIMESWTMSF 1048

>Scas_297.1
          Length = 800

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 100/252 (39%), Gaps = 58/252 (23%)

Query: 830  GDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINN 889
            GDN+LTA ++ R CN++  +   +P                                   
Sbjct: 1    GDNILTARAIARNCNILSEETYLIPEC--------------------------------- 27

Query: 890  SSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLN 949
                    AI G  FR +   E   +        L    + AR SP++K  L+E L+ + 
Sbjct: 28   --------AIEGPKFRTLTKQERIKM--------LPNLRVMARSSPEDKRLLVETLKGMG 71

Query: 950  YTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGRACL 1006
              V   GDG ND  ALK ADVG S+  +   VA   +  +    D + ++D IK GR C+
Sbjct: 72   DVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKWGR-CV 130

Query: 1007 VTSFSCFQYMSLYSAIQFITITVLYSRGSN-----LGDFQFLYIDLLLIVPIAIFMSWSK 1061
              S   F    L   I  + +  + S  S      L   Q L+I+L++    A+ ++  K
Sbjct: 131  SISIKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMDTLAALALATDK 190

Query: 1062 PYDKIVKKRPSA 1073
            P   I+ ++P  
Sbjct: 191  PDPNIMDRKPRG 202

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 66/155 (42%), Gaps = 25/155 (16%)

Query: 344 DLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPA-----------E 392
           +L+ GDI  I+  +  V P D +L+ G C V+ES +TGES  + K              E
Sbjct: 615 NLLVGDI--ITLQTGDVIPADGVLVEGQCEVDESSITGESDTIKKVKVFNALKTFDVINE 672

Query: 393 PETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLV 452
            ++  Q+LD    T     +    L +G+ ++            A++   G ++  G  +
Sbjct: 673 GKSNDQILDIGFKTPNGDKIPDCMLISGSKLLSG-------LGKAIITSVGTNSIHGRTM 725

Query: 453 RSM-VFPKPTGFK----FYEDSFKYIGVMALIALF 482
            ++ V P+ T  +       DS    G +A I LF
Sbjct: 726 MALKVEPESTPLQQRLSQLADSISVYGCVAAILLF 760

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 84/326 (25%), Positives = 137/326 (42%), Gaps = 55/326 (16%)

Query: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVI----TQICNKATLPANFE 754
            ++   EF S  +RMS I+K     P +E       KGA  VI     +  N ATL     
Sbjct: 881  VLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTA 940

Query: 755  EMLNYYTHKGYRVIACAGRVL---PRNTWLYSQKVS------REE--------VESNMEF 797
              L  Y  +G R +  A R L       W+ +  V+      REE        +E  +  
Sbjct: 941  LHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELIL 1000

Query: 798  LGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK---VYVP 854
            LG    E++L+     ++  L EA I+  + TGD V TAI++G  CN++ +     V   
Sbjct: 1001 LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKA 1060

Query: 855  SLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSST-------------SYTLAITG 901
            S E+++  G   I    V N   T   R    ++ S                ++ + I G
Sbjct: 1061 SGEDVEEFGSDPI---QVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDG 1117

Query: 902  DIFRIIFGDENNSISEDYINTVLL----KGTIYARMSPDEKHELMEQLQR-LNYTVGFCG 956
            D  ++    E     E     +LL    K  +  R+SP +K  +++ +++ L+      G
Sbjct: 1118 DALKVALNGE-----EMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIG 1172

Query: 957  DGANDCGALKAADVGISLSEAEASVA 982
            DG+ND   +++ADVG+ ++  E   A
Sbjct: 1173 DGSNDVAMIQSADVGVGIAGEEGRQA 1198

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 171/415 (41%), Gaps = 74/415 (17%)

Query: 613  KNFFISLLTCHSLRVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALP 672
            ++F +SL  CHS+ V +N+   + LD K     + +  E  ++  F  ++  R  +  + 
Sbjct: 775  EHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGF--SFVGRTKNGVII 832

Query: 673  ENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVK-PSNED---- 727
            E    I  V                      I+   EF S  +RMS IVK P+ ++    
Sbjct: 833  E----IQGV-----------------QKEFRILNVLEFNSTRKRMSCIVKIPAADENSKP 871

Query: 728  VYWAFTKGAPEVITQICNKATLPANFEEM----LNYYTHKGYRVIACAGRVLPRNTWL-Y 782
                  KGA  VI    +++       E     L  +  +G R +  A R +  + +L +
Sbjct: 872  KALLLCKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNW 931

Query: 783  SQKV--------SREE--------VESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTV 826
            +++         +REE        +E  +  LG    E++L+     ++  L +A I+  
Sbjct: 932  NERRELAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLW 991

Query: 827  MCTGDNVLTAISVGRQCNL---------IKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDD 877
            + TGD V TAI++G  CNL         IKS    V  L E DS    ++I + ++   +
Sbjct: 992  VLTGDKVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFN 1051

Query: 878  TLDSRTLLPINNSSST----SYTLAITGDIFRIIFGDENNSISEDYINTVLL-----KGT 928
               S   L       T    ++ + I GD  ++          ED     LL     K  
Sbjct: 1052 MKGSPEELAAARKDHTPPQSAFGVVIDGDALKLALH------GEDIRRKFLLLCKNCKAV 1105

Query: 929  IYARMSPDEKHELMEQLQR-LNYTVGFCGDGANDCGALKAADVGISLSEAEASVA 982
            +  R+SP +K  +++ ++  L+      GDG+ND   ++AADVGI ++  E   A
Sbjct: 1106 LCCRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQA 1160

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 143/333 (42%), Gaps = 67/333 (20%)

Query: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVI-TQICNKA-----TLPAN 752
            I+   EF S  +RMS I+K     P++E       KGA  VI +++  KA     TL   
Sbjct: 832  ILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEK 891

Query: 753  FEEMLNYYTHKGYRVIACAGRVLPRNTW------------LYSQKVSREE--------VE 792
                L  Y  +G R +  A R L   TW              +   +REE        +E
Sbjct: 892  TALHLEQYATEGLRTLCLAQREL---TWSEYTEWNARYDIAAASLTNREEQLEIVSDSIE 948

Query: 793  SNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVY 852
             ++  LG    E++L+    +++  L EA I+  + TGD V TAI++G  CNL+ +    
Sbjct: 949  RDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDM-- 1006

Query: 853  VPSLEEIDSTGQTSIIW-RDVDNMDDTLDSRTL----------LPINNSSST------SY 895
               L  + + G+  + +  D   + ++L S+ L          + ++N+          +
Sbjct: 1007 --ELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDF 1064

Query: 896  TLAITGDIFRIIFGDENNSISEDYINTVLL-----KGTIYARMSPDEKHELMEQLQR-LN 949
             + I GD  +I          +D     LL     K  +  R+SP +K  +++ ++  L+
Sbjct: 1065 AVVIDGDALKIAL------TGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLD 1118

Query: 950  YTVGFCGDGANDCGALKAADVGISLSEAEASVA 982
                  GDG+ND   +++ADVGI ++  E   A
Sbjct: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 140/322 (43%), Gaps = 48/322 (14%)

Query: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVITQICNKATLPANFEEM-- 756
            ++   EF S  +RMS I+K     P+ E       KGA  +I    +K       E+   
Sbjct: 881  LLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNNDEKLLEKTAL 940

Query: 757  -LNYYTHKGYRVIACAGRVLPRNTWLYSQK------------VSREE--------VESNM 795
             L  Y  +G R +  A R L   +W   Q+            V RE+        +E  +
Sbjct: 941  HLEQYATEGLRTLCIAQREL---SWKEYQEWNEKHEIAAAALVDREDEMEKVADVIEREL 997

Query: 796  EFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK---VY 852
              LG    E++L+     ++ TL EA I+  + TGD V TAI++G  CNL+ ++    V 
Sbjct: 998  TLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVI 1057

Query: 853  VPSLEEIDSTGQ------TSIIWRDVDNMDDTLDSRTLL----PINNSSSTSYTLAITGD 902
              S +++D  G        ++I + +        S   L     ++   + ++ + I GD
Sbjct: 1058 KASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGD 1117

Query: 903  IFRIIFGDENNSISEDYINTV-LLKGTIYARMSPDEKHELMEQLQR-LNYTVGFCGDGAN 960
              ++     N+ +  +++      K  +  R+SP +K  +++ ++  L+      GDG+N
Sbjct: 1118 ALKLAL--RNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1175

Query: 961  DCGALKAADVGISLSEAEASVA 982
            D   +++AD+G+ ++  E   A
Sbjct: 1176 DVAMIQSADIGVGIAGEEGRQA 1197

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 138/334 (41%), Gaps = 69/334 (20%)

Query: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLN 758
            I+   EF S  +RMS IVK     P +E       KGA  +I    ++ +  +N E +L 
Sbjct: 836  ILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS-GSNSEAILE 894

Query: 759  -------YYTHKGYRVIACAGRVLPRNTWLYSQK------------VSREE--------V 791
                    Y  +G R +  A R L   +W   +K             +RE+        +
Sbjct: 895  KTALHLEQYATEGLRTLCIAQREL---SWSEYEKWNEKYDIAAASLANREDELEVVADSI 951

Query: 792  ESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKV 851
            E  +  LG    E++L+      ++ L EA I+  + TGD V TAI++G  CNL+ ++  
Sbjct: 952  ERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEM- 1010

Query: 852  YVPSLEEIDSTG-QTSIIWRDVDNMDDTLDSRTLLPINNSSST----------------S 894
                L  I +TG        +   + D L S+ L    N + +                +
Sbjct: 1011 ---ELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067

Query: 895  YTLAITGDIFRIIFGDENNSISEDYINTVLL-----KGTIYARMSPDEKHELMEQLQ-RL 948
            Y + I GD  ++          ED     LL     +  +  R+SP +K  +++ ++  L
Sbjct: 1068 YAIVIDGDALKLAL------YGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSL 1121

Query: 949  NYTVGFCGDGANDCGALKAADVGISLSEAEASVA 982
            +      GDG+ND   +++ADVGI ++  E   A
Sbjct: 1122 DVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1155

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 136/330 (41%), Gaps = 62/330 (18%)

Query: 704  IIRSFEFLSELRRMSVIVKPSNEDVYWA-----FTKGAPEVITQICNKATLPANFEEMLN 758
            I+   EF S  +RMS IVK   +D           KGA  VI    +K  L  N E +L 
Sbjct: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGL--NEESLLE 900

Query: 759  -------YYTHKGYRVIACAGRVLPRNTWLYSQK---------VSREE--------VESN 794
                    Y  +G R +  A R L    +    K         V REE        +E +
Sbjct: 901  KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH 960

Query: 795  MEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSK----- 849
            +  LG    E++L+     ++  L EA I+  + TGD V TAI++G  CNL+ +      
Sbjct: 961  LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV 1020

Query: 850  -KVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTL---LPINNSSSTSYTLAITGDI-- 903
             K   P +E++ +T +  +         DTL S+ L     +  S           DI  
Sbjct: 1021 IKTTGPDVEDLGATPKDIV---------DTLISQYLHDKFGMAGSEEELKKAKAEHDIPR 1071

Query: 904  --FRIIFGDENNSIS---EDYINTVLL-----KGTIYARMSPDEKHELMEQLQR-LNYTV 952
              F +I   E    +   ED     LL     K  +  R+SP +K  +++ ++  L+   
Sbjct: 1072 GEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMT 1131

Query: 953  GFCGDGANDCGALKAADVGISLSEAEASVA 982
               GDG+ND   +++A++G+ ++  E   A
Sbjct: 1132 LAIGDGSNDVAMIQSANIGVGIAGEEGRQA 1161

>Scas_636.16
          Length = 1554

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/327 (25%), Positives = 135/327 (41%), Gaps = 55/327 (16%)

Query: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVITQIC------NKATLPAN 752
            I+   EF S  +RMS IVK       +E       KGA  VI          N  TL   
Sbjct: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874

Query: 753  FEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQK------------VSREE--------VE 792
                L  Y  +G R +    R +   +W   Q+              REE        +E
Sbjct: 875  TALHLEQYATEGLRTLCVGQREI---SWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931

Query: 793  SNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVY 852
             ++  LG    E++L+     ++  L EA I+  + TGD V TAI++G  CNL+ +    
Sbjct: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDM-- 989

Query: 853  VPSLEEIDSTGQ-TSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAIT--------GDI 903
               L  I +TG+       D   + + L S+ L+   N + +   LA          G+ 
Sbjct: 990  --ELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEF 1047

Query: 904  FRIIFGDENN-SISEDYINTVLL------KGTIYARMSPDEKHELMEQLQ-RLNYTVGFC 955
              II G+    +++ D +    L      K  +  R+SP +K  +++ ++  L+      
Sbjct: 1048 AIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAI 1107

Query: 956  GDGANDCGALKAADVGISLSEAEASVA 982
            GDG+ND   +++ADVG+ ++  E   A
Sbjct: 1108 GDGSNDVAMIQSADVGVGIAGEEGRQA 1134

>Scas_576.8
          Length = 1591

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 131/322 (40%), Gaps = 45/322 (13%)

Query: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVI------TQICNKATLPAN 752
            I+ + EF S  +RMS IVK     P +E       KGA  +I          N   L   
Sbjct: 852  ILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKNGANSENLLEK 911

Query: 753  FEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQK---------VSREE--------VESNM 795
                L  Y  +G R +  A R L    +L   K          +REE        +E  +
Sbjct: 912  TALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQLEAVSDEIEREL 971

Query: 796  EFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK---VY 852
              LG    E++L+    +++  L +A I+  + TGD V TAI++G  CNL+ +     V 
Sbjct: 972  TLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVV 1031

Query: 853  VPSLEEIDSTGQ------TSIIWRDVDNMDDTLDSRTLLPINNSSST----SYTLAITGD 902
              + +++   G        S+I + +        S   L     +       + + I G+
Sbjct: 1032 KTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHDFPRGDFAVVIDGE 1091

Query: 903  IFRIIFGDENNSISEDYINTVL-LKGTIYARMSPDEKHELMEQ-LQRLNYTVGFCGDGAN 960
              ++    E  SI   ++      K  +  R+SP +K  +++  +  L+      GDG+N
Sbjct: 1092 ALKLALNGE--SIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVMTLAIGDGSN 1149

Query: 961  DCGALKAADVGISLSEAEASVA 982
            D   +++ADVG+ ++  E   A
Sbjct: 1150 DVAMIQSADVGVGIAGEEGRQA 1171

>Scas_89.1
          Length = 271

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 97/210 (46%), Gaps = 27/210 (12%)

Query: 786 VSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNL 845
           V ++ +E N+E LG    E+KL+ +   +++ L+ A ++  M TGD V TA  V     L
Sbjct: 26  VIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKL 85

Query: 846 IKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFR 905
           I S+  YV ++ ++                +  L++   L IN SS     L I G+   
Sbjct: 86  I-SRGQYVHTVTKLSRP-------------EGALNALEYLKINKSS----CLLIDGESLG 127

Query: 906 IIFGDENNSISEDYINTVL-LKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCG 963
           +          +++ + V+ L   I  R +P +K ++   ++ +      C GDG ND  
Sbjct: 128 MFL----TYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVS 183

Query: 964 ALKAADVGISLSEAE---ASVAAPFTSQVF 990
            ++ ADVG+ +   E   AS+AA F+   F
Sbjct: 184 MIQCADVGVGIVGKEGKQASLAADFSVTQF 213

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 115/273 (42%), Gaps = 56/273 (20%)

Query: 304 SIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPC 363
           SIVD L      +K+LA+ +       V RD     + + ++VPGDI ++ D   TV P 
Sbjct: 167 SIVDEL------KKTLANTA------VVIRDGQLVEIPANEVVPGDILQLEDG--TVIPT 212

Query: 364 DSLLLSGDCI--VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGT 421
           D  +++ DC   +++S +TGES+ V K   +                         F+ +
Sbjct: 213 DGRIVTEDCFLQIDQSAITGESLAVDKHYGDQT-----------------------FSSS 249

Query: 422 TIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL 481
           T+ R            +V  TG +T  G    ++V     G   + +    IG++ L+  
Sbjct: 250 TVKRGE-------GFMVVTATGDNTFVGR-AAALVNKAAGGQGHFTEVLNGIGIILLV-- 299

Query: 482 FGFSISCIQFIKIGLDKRT----MILR-ALDIITIVVPPALPATLTIGTGFALSRLKKKG 536
               I+ +  +      RT     ILR  L I  I VP  LPA +T       + L KK 
Sbjct: 300 --LVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQ 357

Query: 537 IFCISPTRVNIGGKIDILCFDKTGTLTENGLDV 569
                 + +     ++ILC DKTGTLT+N L +
Sbjct: 358 AIVQKLSAIESLAGVEILCSDKTGTLTKNKLSL 390

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 62/132 (46%), Gaps = 15/132 (11%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 987
            +A + P  K+ ++E LQ   Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 607  FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 666

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQY---MSLYSAIQFITITVLYSRGSNLGDFQFLY 1044
                +S ++D +K  R      +S   Y   +SL+  I F+ + +     S         
Sbjct: 667  LAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEI-FLGLWIAILDNS--------- 716

Query: 1045 IDLLLIVPIAIF 1056
            +D+ LIV IAIF
Sbjct: 717  LDIDLIVFIAIF 728

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 23/133 (17%)

Query: 718 SVIVKPSNEDVYWAFTKGAPE-VITQICNKATLPA----NFEEMLNYYTHKGYRVIACAG 772
           +V+  P  E +     KGAP  V+  +     +P     N+E  +     +G+R +    
Sbjct: 460 AVVESPEGERI--VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG--- 514

Query: 773 RVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDN 832
                        V+R+  E + E LG +   +  + +TA+T+   +   +R  M TGD 
Sbjct: 515 -------------VARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDA 561

Query: 833 VLTAISVGRQCNL 845
           V  A    RQ  L
Sbjct: 562 VGIAKETCRQLGL 574

>Scas_710.41
          Length = 904

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 106/248 (42%), Gaps = 36/248 (14%)

Query: 325 FACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCI--VNESMLTGE 382
            A   RV RD     + + ++VPGDI E+ +   T+ P D  L++ +    V++S +TGE
Sbjct: 163 LANTARVIRDGTLQEIPANEIVPGDILELDEG--TIIPADGRLVTENRFLQVDQSAITGE 220

Query: 383 SVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRT 442
           S+ V K             ++ +   SS   K+    GT+++             +V  T
Sbjct: 221 SLAVDK-------------NYGDVTFSSSTVKT----GTSVM-------------VVTAT 250

Query: 443 GFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMI 502
           G +T  G    ++V     G   + D    IG + L+ +    +          D   MI
Sbjct: 251 GDNTFVGR-AAALVGEASGGQGHFTDILNDIGTILLVLVIITLLLVWTACFYRTDGIVMI 309

Query: 503 LR-ALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGT 561
           LR  L I  I VP  LPA +T       + L KK       + +     ++ILC DKTGT
Sbjct: 310 LRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGT 369

Query: 562 LTENGLDV 569
           LT+N L +
Sbjct: 370 LTKNKLSL 377

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 61/132 (46%), Gaps = 15/132 (11%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 987
            +A + P  K++++E LQ   Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 594  FAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 653

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQY---MSLYSAIQFITITVLYSRGSNLGDFQFLY 1044
                +S ++D +K  R      +S   Y   +SL+  I F     + +R  N+       
Sbjct: 654  LAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWIAILNRSLNIE------ 707

Query: 1045 IDLLLIVPIAIF 1056
                LIV IAIF
Sbjct: 708  ----LIVFIAIF 715

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 24/137 (17%)

Query: 715 RRMSVIVK-PSNEDVYWAFTKGAPEVITQICNK-----ATLPANFEEMLNYYTHKGYRVI 768
           ++++ +VK P  E +     KGAP  + +   +       +  N+E  +     +G+R  
Sbjct: 443 KKVTAVVKSPEGETI--TCVKGAPLFVLKTVEEDHPVPEDVHENYENKVAELASRGFR-- 498

Query: 769 ACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMC 828
                         S  V+R+  E   E LG +   +  + +TA+T+   +   +R  M 
Sbjct: 499 --------------SLGVARKRGEGYWEILGVMPCMDPPRDDTARTIAEARTLGLRVKML 544

Query: 829 TGDNVLTAISVGRQCNL 845
           TGD V  A    RQ  L
Sbjct: 545 TGDAVGIAKETSRQLGL 561

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 130/310 (41%), Gaps = 60/310 (19%)

Query: 275 YVFQIFSIILWSLDEYYYYA---GCIFLISIL---------SIVDTLVETRRTQKSLADM 322
           +V +  +I+   L+++  +    G +FL + +         SIVD L      +K+LA+ 
Sbjct: 107 FVMEAAAILAAGLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDEL------KKTLANS 160

Query: 323 SHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIV--NESMLT 380
           +       V RD     V S ++VPGDI ++ D    V P D  L++ DC +  ++S +T
Sbjct: 161 A------VVIRDGNLVEVPSNEVVPGDILQLEDG--VVIPADGRLVTEDCFIQIDQSAIT 212

Query: 381 GESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVV 440
           GES+ V K              F ++  SS          +T+ R         A  +V 
Sbjct: 213 GESLAVDK-------------RFGDSTFSS----------STVKRGE-------AFMIVT 242

Query: 441 RTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRT 500
            TG ST  G     +      G   + +    IG + LI +    +          +K  
Sbjct: 243 ATGDSTFVGRAAALVNKAA-AGSGHFTEVLNGIGTILLILVIVTLLLVWVASFYRTNKIV 301

Query: 501 MILRALDIITIV-VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKT 559
            ILR    ITIV VP  LPA +T       + L KK       + +     ++ILC DKT
Sbjct: 302 RILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKT 361

Query: 560 GTLTENGLDV 569
           GTLT+N L +
Sbjct: 362 GTLTKNKLSL 371

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 15/132 (11%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 987
            +A + P  K+ ++E LQ+  Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 588  FAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 647

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQY---MSLYSAIQFITITVLYSRGSNLGDFQFLY 1044
                +S ++D +K  R      +S   Y   +SL+  I       + +R  N+       
Sbjct: 648  LAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILNRSLNID------ 701

Query: 1045 IDLLLIVPIAIF 1056
                L+V IAIF
Sbjct: 702  ----LVVFIAIF 709

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 24/137 (17%)

Query: 715 RRMSVIVK-PSNEDVYWAFTKGAPE-VITQICNKATLPA----NFEEMLNYYTHKGYRVI 768
           ++++ IV+ P  E +     KGAP  V+  +  +  +P     N+E  +     +G+R +
Sbjct: 437 KKVTAIVESPEGERII--CVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRAL 494

Query: 769 ACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMC 828
                            V+R+  E + E LG +   +  + +TA+T+   +   +R  M 
Sbjct: 495 G----------------VARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKML 538

Query: 829 TGDNVLTAISVGRQCNL 845
           TGD V  A    RQ  L
Sbjct: 539 TGDAVGIAKETCRQLGL 555

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 109/254 (42%), Gaps = 32/254 (12%)

Query: 790  EVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSK 849
            E+E  +  LG    E+KL+   ++ ++ ++ A I+  M TGD   TAI++G  C LIK  
Sbjct: 1075 EIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDY 1134

Query: 850  KVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFG 909
               V     I +T   +II + ++ +   +DS  +            + I G    +  G
Sbjct: 1135 STVV-----ILTTTDENIISK-MNAVSQEVDSGNI--------AHCVVVIDGATMAMFEG 1180

Query: 910  DENNSISEDYINTVL-----LKGTIYARMSPDEKHELMEQLQRL--NYTVGFCGDGANDC 962
            +        Y++  +         I  R SP +K  ++  ++    N      GDGAND 
Sbjct: 1181 NPT------YMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDI 1234

Query: 963  GALKAADVGISLSEAE---ASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLY 1019
              +++AD+G+ ++  E   AS  + ++   F     L +   GR   + + S F   + Y
Sbjct: 1235 AMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKL-LFVHGRYNYIRT-SKFMLCTFY 1292

Query: 1020 SAIQFITITVLYSR 1033
              I F    ++Y R
Sbjct: 1293 KEITFYFTQLIYQR 1306

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 71/174 (40%), Gaps = 20/174 (11%)

Query: 611 RAKNFFISLLTCHSL--RVVDNELIGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHD 668
           +AK FF+SL  CHS   +   NE IG+             Y+    ++    T       
Sbjct: 727 KAKFFFLSLALCHSCLPKKTHNESIGED---------SIEYQSSSPDELALVTAARDLGY 777

Query: 669 NALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVK-PSNED 727
             L  N  I+     P+  D E    + +  N++      +F S+ +RMSV+V+ P+  +
Sbjct: 778 IVLNRNAQILTIKTFPDGFDGEAKLENYEILNYI------DFNSQRKRMSVLVRMPNQPN 831

Query: 728 VYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWL 781
                 KGA  VI +  +   L A  ++M +  T    R  A A  VL +   L
Sbjct: 832 QVLLICKGADNVIMERLHDRELAA--KKMADICTSTKERKDAEAELVLQQRKSL 883

>Kwal_23.3556
          Length = 1597

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 119/251 (47%), Gaps = 24/251 (9%)

Query: 789  EEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKS 848
            E VE+++  LG    E+KL++  A  +  ++ A I+  M TGD   TAI++G  CNLI  
Sbjct: 1013 ELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIHD 1072

Query: 849  -KKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRII 907
               V + S ++ + + + + + ++++  +    +  ++ I+ S+ T++    T     + 
Sbjct: 1073 YSTVVILSAKDENISSKLTAVSQEIERGN---IAHCVVVIDGSTLTTFESNPTLMSVFVE 1129

Query: 908  FGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVG--FCGDGANDCGAL 965
               + +S+             I  R SP +K  ++  ++  +  +     GDGAND   +
Sbjct: 1130 LCTKTDSV-------------ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMI 1176

Query: 966  KAADVGISLSEAE---ASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYSAI 1022
            ++AD+G+ ++  E   AS ++ ++   F     L ++  GR   V + + F   + Y  +
Sbjct: 1177 QSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKL-LLVHGRYNYVRT-TKFVLCTFYKEL 1234

Query: 1023 QFITITVLYSR 1033
             F    ++Y R
Sbjct: 1235 LFYLTQMIYQR 1245

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 9/81 (11%)

Query: 671 LPENIDIIPAVVHPNSADPENTFIDNDPH-NFLGIIRSFEFLSELRRMSVIVK-PSNEDV 728
           +  N D++    +PN  D E       PH +   I+ + EF S  +RMSV+V+ P  E+ 
Sbjct: 716 MNRNSDVLTIKTYPNGFDAE-------PHLDKYEILNNIEFSSHRKRMSVLVRLPHEENR 768

Query: 729 YWAFTKGAPEVITQICNKATL 749
                KGA  VI +  + + L
Sbjct: 769 ILLICKGADNVILERLHNSDL 789

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 109/253 (43%), Gaps = 30/253 (11%)

Query: 790  EVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSK 849
             +E+++E LG    E+KL++   + +Q ++ A I+  M TGD   TAI++G  C LI   
Sbjct: 994  HIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDY 1053

Query: 850  KVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLL--PINNSSSTSYTLAITGDIFRII 907
               V             I+ ++ DN+   +   T L   ++        L I G    + 
Sbjct: 1054 STVV-------------ILKKNDDNL---ISKMTALGEELDTGKIAHCVLVIDGASLAVF 1097

Query: 908  FGDENNSISEDYINTVLLK--GTIYARMSPDEKHELME--QLQRLNYTVGFCGDGANDCG 963
               ENN         +  K    I  R SP +K  ++   +L+  +      GDGAND  
Sbjct: 1098 ---ENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIA 1154

Query: 964  ALKAADVGISLSEAE---ASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYS 1020
             +++AD+G+ ++  E   AS ++ ++   F     L +   GR   V + S F   + Y 
Sbjct: 1155 MIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKL-LFVHGRYNYVRT-SKFVLCTFYK 1212

Query: 1021 AIQFITITVLYSR 1033
             + F    ++Y R
Sbjct: 1213 EVLFYLTQMIYQR 1225

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 126/302 (41%), Gaps = 44/302 (14%)

Query: 275 YVFQIFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSH-FACEVRVFR 333
           +V +  +I+   L+E+  + G I  + +L+     ++  +    + ++    A    V R
Sbjct: 107 FVMEAAAILAAGLEEWIDF-GIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIR 165

Query: 334 DEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIV--NESMLTGESVPVSKFPA 391
           D     + + ++VPGDI ++ D    + P D  +++  C V  ++S +TGES+ V K   
Sbjct: 166 DGSLVEIPANEVVPGDILQLEDG--VIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYG 223

Query: 392 EPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSL 451
           +                         F+ +T+ R            +V  TG ST  G  
Sbjct: 224 DAT-----------------------FSSSTVKRGE-------GFMIVTATGDSTFVGR- 252

Query: 452 VRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFS----ISCIQFIKIGLDKRTMILRALD 507
             ++V     G   + +    IG + LI +        ++C  F +  +D  T++   L 
Sbjct: 253 AAALVNKASAGSGHFTEVLNGIGTILLILVILTLLVVYVAC--FYR-SIDIVTILRYTLA 309

Query: 508 IITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGL 567
           I  + VP  LPA +T       + L KK       + +     ++ILC DKTGTLT+N L
Sbjct: 310 ITVVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

Query: 568 DV 569
            +
Sbjct: 370 SL 371

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 987
            +A + P  K+ ++E LQ+  Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 588  FAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 647

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQY 1015
                +S ++D +K  R      +S   Y
Sbjct: 648  LAPGLSAIIDALKTSRQIFHRMYSYVVY 675

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 24/137 (17%)

Query: 715 RRMSVIVK-PSNEDVYWAFTKGAPEVITQICNKATL-----PANFEEMLNYYTHKGYRVI 768
           ++++ IV+ P  E +     KGAP  + +   +  L       N+E  +     +GYR +
Sbjct: 437 KKVTAIVESPEGERI--VCVKGAPLFVLKTVEENHLIPEDVKENYENKVAELASRGYRAL 494

Query: 769 ACAGRVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMC 828
                            V+R+  E + E LG +   +  + +TA+T+   +   +R  M 
Sbjct: 495 G----------------VARKRGEGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKML 538

Query: 829 TGDNVLTAISVGRQCNL 845
           TGD V  A    RQ  L
Sbjct: 539 TGDAVGIAKETCRQLGL 555

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 116/269 (43%), Gaps = 48/269 (17%)

Query: 304 SIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPC 363
           SIVD L      +K+LA+++       V RD     V + ++VPGDI ++ D   T+ P 
Sbjct: 151 SIVDEL------KKTLANVA------VVIRDGQLVEVPANEVVPGDILQLEDG--TIIPA 196

Query: 364 DSLLLSGDCI--VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGT 421
           D  L++ +C   V++S +TGES+ V K                      Y  ++F  + +
Sbjct: 197 DGRLVTENCFLQVDQSAITGESLAVDK---------------------GYGDQTF--SSS 233

Query: 422 TIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL 481
           T+ R         A  +V  TG +T  G    ++V     G   + +    IG++ L+ +
Sbjct: 234 TVKRGE-------AFMVVTATGDNTFVGR-AAALVNKASGGQGHFTEVLNGIGILLLVLV 285

Query: 482 FGFSISCIQFIKIGLDKRTMILR-ALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCI 540
               +          D    ILR  L I  I VP  LPA +T       + L KK     
Sbjct: 286 IVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQ 345

Query: 541 SPTRVNIGGKIDILCFDKTGTLTENGLDV 569
             + +     ++ILC DKTGTLT+N L +
Sbjct: 346 KLSAIESLAGVEILCSDKTGTLTKNKLSL 374

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 65/133 (48%), Gaps = 17/133 (12%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSQV 989
            +A + P  K++++E LQ   Y V   GDG ND  +LK AD GI++ E  +  A      V
Sbjct: 591  FAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGASDAARSAADIV 649

Query: 990  F---DISCVLDVIKEGRACLVTSFSCFQY---MSLYSAIQFITITVLYSRGSNLGDFQFL 1043
            F    +S ++D +K  R      +S   Y   +SL+  + F+ + ++    S        
Sbjct: 650  FLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEL-FLGLWIIILNHS-------- 700

Query: 1044 YIDLLLIVPIAIF 1056
             +D+ LIV IAIF
Sbjct: 701  -LDIELIVFIAIF 712

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 23/133 (17%)

Query: 718 SVIVKPSNEDVYWAFTKGAPE-VITQICNKATLPA----NFEEMLNYYTHKGYRVIACAG 772
           +V+  P  E +     KGAP  V+  +     +P     N+E  +     +G+R +    
Sbjct: 444 AVVESPEGERI--VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG--- 498

Query: 773 RVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDN 832
                        V+R+  E + E LG +   +  + +TA+T+   +   +R  M TGD 
Sbjct: 499 -------------VARKRGEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDA 545

Query: 833 VLTAISVGRQCNL 845
           V  A    RQ  L
Sbjct: 546 VGIAKETCRQLGL 558

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 118/274 (43%), Gaps = 58/274 (21%)

Query: 304 SIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPC 363
           SIVD L      +K+LA+ +       V RD     + + ++VPG+I ++   S T+ P 
Sbjct: 196 SIVDEL------KKTLANTA------TVIRDGQLIEIPANEVVPGEILQLE--SGTIAPA 241

Query: 364 DSLLLSGDCI--VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGT 421
           D  +++ DC   +++S +TGES+   K   +                        +F+ +
Sbjct: 242 DGRIVTEDCFLQIDQSAITGESLAAEKHYGDE-----------------------VFSSS 278

Query: 422 TIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFK-FYEDSFKYIGVMALIA 480
           T+           A  +V  TG +T  G    + +  + +G +  + +    IG++ L+ 
Sbjct: 279 TVKTGE-------AFMVVTATGDNTFVGR--AAALVGQASGVEGHFTEVLNGIGIILLV- 328

Query: 481 LFGFSISCIQFIKIGLDKRTM----ILR-ALDIITIVVPPALPATLTIGTGFALSRLKKK 535
                I+ +  +      RT+    ILR  L I  I VP  LPA +T       + L KK
Sbjct: 329 ---LVIATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK 385

Query: 536 GIFCISPTRVNIGGKIDILCFDKTGTLTENGLDV 569
                  + +     ++ILC DKTGTLT+N L +
Sbjct: 386 QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSL 419

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 62/132 (46%), Gaps = 15/132 (11%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 987
            +A + P  K+ ++E LQ   Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 636  FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 695

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQY---MSLYSAIQFITITVLYSRGSNLGDFQFLY 1044
                +S ++D +K  R      +S   Y   +SL+  I F+ + +     S         
Sbjct: 696  LAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEI-FLGLWIAILNNS--------- 745

Query: 1045 IDLLLIVPIAIF 1056
            +D+ LIV IAIF
Sbjct: 746  LDINLIVFIAIF 757

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 23/133 (17%)

Query: 718 SVIVKPSNEDVYWAFTKGAPE-VITQICNKATLPA----NFEEMLNYYTHKGYRVIACAG 772
           +V+  P  E +     KGAP  V+  +     +P     N+E  +     +G+R +    
Sbjct: 489 AVVESPEGERI--VCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG--- 543

Query: 773 RVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDN 832
                        V+R+  E + E LG +   +  + +TA+T+   +   +R  M TGD 
Sbjct: 544 -------------VARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDA 590

Query: 833 VLTAISVGRQCNL 845
           V  A    RQ  L
Sbjct: 591 VGIAKETCRQLGL 603

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 115/253 (45%), Gaps = 30/253 (11%)

Query: 790  EVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKS- 848
            ++E  +  LG    E+KL++  ++ ++ ++ A I+  M TGD   TAI++G  C LI   
Sbjct: 1015 QIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDY 1074

Query: 849  KKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIF 908
              V + +  + +   + + I ++VD                S + ++ + +       +F
Sbjct: 1075 STVVILTTSDENIISKMNAISQEVD----------------SGNVAHCVIVIDGATLAMF 1118

Query: 909  GDENNSISEDYINTVLLKGT---IYARMSPDEKHELMEQLQRLNYTVG--FCGDGANDCG 963
             D    +S   + T L   T   +  R SP +K  ++  ++  + ++     GDGAND  
Sbjct: 1119 EDNPTLMS---VFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIA 1175

Query: 964  ALKAADVGISLSEAE---ASVAAPFTSQVFDISCVLDVIKEGRACLVTSFSCFQYMSLYS 1020
             +++AD+G+ ++  E   AS +A ++   F     L ++  GR   + + + F   + Y 
Sbjct: 1176 MIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKL-LLVHGRYNYIRT-AKFILCTFYK 1233

Query: 1021 AIQFITITVLYSR 1033
             + F    ++Y R
Sbjct: 1234 ELTFYLTQLIYQR 1246

>Scas_688.1
          Length = 913

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 78/349 (22%), Positives = 128/349 (36%), Gaps = 90/349 (25%)

Query: 718  SVIVKPSNEDVYWAFTKGAPEVITQICNK-----ATLPANFEEMLNYYTHKGYRVIACAG 772
            +V+  P  E +     KGAP  + +   +       +  N+E  +     +G+R +    
Sbjct: 455  AVVESPEGERII--CVKGAPLFVLKTVEEDHPIPEDIHENYENKVAELASRGFRALG--- 509

Query: 773  RVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDN 832
                         V+R+  E + E LG +   +  + +T +T+   +   +R  M TGD 
Sbjct: 510  -------------VARKRGEGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDA 556

Query: 833  VLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSS 892
            V  A    RQ  L     VY                                        
Sbjct: 557  VGIAKETCRQLGL--GTNVY---------------------------------------- 574

Query: 893  TSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTV 952
             +  L ++G       GD   S   D++         +A + P +K+ ++E LQ   Y V
Sbjct: 575  NAERLGLSGG------GDMPGSELADFVE----NADGFAEVFPQDKYRVVEILQTRGYLV 624

Query: 953  GFCGDGANDCGALKAADVGISLSEA--EASVAAPFTSQVFDISCVLDVIKEGRACLVTSF 1010
               GDG ND  +LK AD GI++  A   A  AA        +S ++D +K  R      +
Sbjct: 625  AMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMY 684

Query: 1011 SCFQY---MSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVPIAIF 1056
            S   Y   +S++  I F+ + +     S         +D+ LIV IAIF
Sbjct: 685  SYVVYRIALSIHLEI-FLGLWIAILNNS---------LDINLIVFIAIF 723

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 497 DKRTMILRALDIITIV-VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILC 555
           D    ILR    ITIV VP  LPA +T       + L KK       + +     ++ILC
Sbjct: 312 DGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILC 371

Query: 556 FDKTGTLTENGLDV 569
            DKTGTLT+N L +
Sbjct: 372 SDKTGTLTKNKLSL 385

>Scas_669.3
          Length = 1638

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (46%), Gaps = 19/184 (10%)

Query: 789  EEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKS 848
            EE+E +++ LG    E+KL++  ++ ++ ++ A I+  M TGD   TAI++G  C LI  
Sbjct: 1048 EEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLI-- 1105

Query: 849  KKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIF 908
               Y  S   I + G  +II + ++ +   +DS  +            + I G    +  
Sbjct: 1106 ---YDYSTVVILAKGDENIISK-MNAISQEVDSGNV--------AHCVIIIDGSTLAMFE 1153

Query: 909  GDENNSISEDYIN-TVLLKGTIYARMSPDEKHELMEQLQRLNYTVG--FCGDGANDCGAL 965
            G  N ++   +I         I  R SP +K  ++  ++  N  +     GDGAND   +
Sbjct: 1154 G--NPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMI 1211

Query: 966  KAAD 969
            ++AD
Sbjct: 1212 QSAD 1215

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 88/198 (44%), Gaps = 19/198 (9%)

Query: 789  EEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKS 848
            E +E ++  LG I  E+KL++     +  L+ A I+  M TGD   TAI++G  C LI  
Sbjct: 994  EIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIHD 1053

Query: 849  KKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIF 908
                +             I+  + +NM   + + T   I   +     + I G    I  
Sbjct: 1054 YSTVI-------------ILAPNDENMASKITTIT-QEIEAGNVAHCVVVIDGATLTIFE 1099

Query: 909  GDENNSISEDYIN-TVLLKGTIYARMSPDEKHELMEQLQRLNYTVG--FCGDGANDCGAL 965
            G  N ++   +I         I  R SP +K  ++ ++++ +  +     GDGAND   +
Sbjct: 1100 G--NLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMI 1157

Query: 966  KAADVGISLSEAEASVAA 983
            ++AD+G+ ++  E   A+
Sbjct: 1158 QSADIGVDITGKEGLQAS 1175

>Kwal_47.17522
          Length = 899

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 111/269 (41%), Gaps = 48/269 (17%)

Query: 304 SIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPC 363
           SIVD L      +KSLA+ +       V RD     + + ++VPGDI ++ D    V   
Sbjct: 148 SIVDEL------KKSLANSA------VVVRDGNLVEIPANEVVPGDIMQLEDG--VVICA 193

Query: 364 DSLLLSGDCI--VNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGT 421
           D  L++ +C   +++S +TGES+ V K              + +T  SS          +
Sbjct: 194 DGRLVTEECFLQIDQSAITGESLAVDKH-------------YGDTTFSS----------S 230

Query: 422 TIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL 481
           T+ R            +V  TG +T  G    ++V         + +    IG + L+ +
Sbjct: 231 TVKRGE-------GFMIVTATGDNTFVGR-AAALVNQAAGDQGHFTEVLNGIGTILLVLV 282

Query: 482 FGFSISCIQFIKIGLDKRTMILR-ALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCI 540
               +          D+   ILR  L I  I VP  LPA +T       + L KK     
Sbjct: 283 IVTLLLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQ 342

Query: 541 SPTRVNIGGKIDILCFDKTGTLTENGLDV 569
             + +     ++ILC DKTGTLT+N L +
Sbjct: 343 KLSAIESLAGVEILCSDKTGTLTKNKLSL 371

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 930  YARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA--EASVAAPFTS 987
            +A + P  K+ ++E LQ+  Y V   GDG ND  +LK AD GI++  A   A  AA    
Sbjct: 588  FAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVF 647

Query: 988  QVFDISCVLDVIKEGRACLVTSFSCFQY---MSLYSAIQF-ITITVLYSRGSNLGDFQFL 1043
                +S ++D +K  R      +S   Y   +SL+  I   + I +L          Q L
Sbjct: 648  LAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIAILN---------QSL 698

Query: 1044 YIDLLLIVPIAIF 1056
             ID  LIV IAIF
Sbjct: 699  NID--LIVFIAIF 709

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 54/133 (40%), Gaps = 23/133 (17%)

Query: 718 SVIVKPSNEDVYWAFTKGAPE-VITQICNKATLPA----NFEEMLNYYTHKGYRVIACAG 772
           +V+  P  E +     KGAP  V+  +     +P     N+E  +     +G+R +    
Sbjct: 441 AVVESPEGERII--CVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALG--- 495

Query: 773 RVLPRNTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDN 832
                        V+R+  E + E LG +   +  + +TA+T+   +   +R  M TGD 
Sbjct: 496 -------------VARKRGEGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDA 542

Query: 833 VLTAISVGRQCNL 845
           V  A    RQ  L
Sbjct: 543 VGIAKETCRQLGL 555

>Scas_569.0d
          Length = 468

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 906  IIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGAL 965
            ++ G + + ++ + I+ + +   + AR SP  K  ++E L R +      GDG ND  +L
Sbjct: 81   VMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSL 140

Query: 966  KAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGR 1003
            K A+VGI++    + VA   +  V    + + +L+ I+EGR
Sbjct: 141  KMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGR 181

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 124/300 (41%), Gaps = 63/300 (21%)

Query: 292 YYAGCIFL---ISILSIVDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPG 348
           Y+   +FL   + I  ++++L +T+ T  +++++S F  E      +        + V  
Sbjct: 511 YFDSVVFLTFFLLIGRLLESLAKTK-TASAISNLSSFKQETATLMQKVGDQYQEVETVQI 569

Query: 349 DIYEISD-----PSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDF 403
              E+ D     P  +  P DS++L G+   +ES LTGES+P+ +   +     Q+    
Sbjct: 570 QYLELGDYIKISPGQSP-PLDSIILEGETEFDESALTGESIPMVRLRGD-----QIFAGT 623

Query: 404 QNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGF 463
            N   SS ++K   F+G ++            L  +V T      G L R+ +       
Sbjct: 624 VNVGSSSVIAKVSSFDGESL------------LDQIVNT---VRDGQLNRAPIERLADIL 668

Query: 464 KFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRT---------------MILRALDI 508
             Y     ++ ++  +A+    ++ + ++ +GL  +                 +  A+ +
Sbjct: 669 TGY-----FVPIIIFLAI----LTWVVWLSLGLSGKLPEHYLDTDIGGWPVWSLEFAISV 719

Query: 509 ITIVVPP----ALPATLTIGTGFALSRLKKKGIFCISPTRV-NIGGKIDILCFDKTGTLT 563
             I  P     A P  L +G+G A     K GI C         G KI I+CFDKTGTLT
Sbjct: 720 FVIACPCGIGLAAPTALFVGSGMA----AKFGILCRGGGAAFQEGCKIAIVCFDKTGTLT 775

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 906  IIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNY-------TVGFCGDG 958
            +I GD  N ++   +   L    + A + P+EK   ++ +Q  N         V   GDG
Sbjct: 951  MISGD--NEVTARAVAQELDIDNVIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDG 1008

Query: 959  ANDCGALKAADVGISLSEA 977
             ND  AL AADVGI+L+  
Sbjct: 1009 INDAPALAAADVGIALASG 1027

>Kwal_55.21575
          Length = 989

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 906 IIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQ---RLNYTVGFCGDGANDC 962
           ++ GD + S  +  +   +    +Y+ ++P +K++L++ LQ   R N  V F GDG ND 
Sbjct: 769 MVTGDNHKSAMKVALELGIEANNVYSELTPADKNQLVQDLQDGGRKN--VAFIGDGINDS 826

Query: 963 GALKAADVGISLS 975
            AL  +D+G+S+S
Sbjct: 827 PALVTSDLGVSIS 839

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 791 VESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKK 850
           V+ N E +G     + +KK+ A+ +Q L E   R  M TGDN  +A+ V  +   I++  
Sbjct: 733 VKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELG-IEANN 791

Query: 851 VY 852
           VY
Sbjct: 792 VY 793

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 127/328 (38%), Gaps = 76/328 (23%)

Query: 275 YVFQIFSIILWSLDEYYYYAGCIFLISILSI----VDTLVETR---RTQKSLADMSHFA- 326
           + F ++SI +    +       IF  S++ I    V  L+E +   +T  SL+ +   A 
Sbjct: 349 FAFSLYSIAMNVAKKSERMPNVIFDASVMLIGFISVGKLLENKAKSKTNNSLSKLMSLAP 408

Query: 327 CEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPV 386
               +  +     +    L  GD  EI  P   + P D +++ G+  V+ES++TGES+ V
Sbjct: 409 STCTIIENGKAREIPVEFLQVGDTVEIK-PGAKI-PTDGVIIEGESEVDESLITGESLMV 466

Query: 387 SKFPAEPETMLQLLDDFQNTQISSYLS--KSFLFNGTTIIRARIPYGQSAALAMVVRTGF 444
            ++   P              I+  ++    FL   T++       G    LA +++T  
Sbjct: 467 PRYKGFP-------------VIAGSINGPNRFLLTATSV-------GDDTKLAQIIQT-- 504

Query: 445 STTKGSLVRSMVFPKPTGFKFYED--SFKYIGVMALIALFGFSISCIQFIKIGLDKRTM- 501
                 + ++ +   P   + Y D  + K++  + ++A+       I F+   +  R + 
Sbjct: 505 ------MKQAQLSKAP--IQHYADYLASKFVPSVLVLAM-------ITFVTWTILSRVLS 549

Query: 502 ----------------ILRALDIITIVVPPAL----PATLTIGTGFALSRLKKKGIFCIS 541
                           +   + +I +  P AL    P  + +GTG       K G+    
Sbjct: 550 NPPSIFDSPNGKFFICLEMTISVIVVACPCALGLAAPTAIMVGTGLG----AKHGVLIKG 605

Query: 542 PTRVNIGGKIDILCFDKTGTLTENGLDV 569
              +     ++   FDKTGTLT   + V
Sbjct: 606 GDILEKCSSLETFLFDKTGTLTTGHMTV 633

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%)

Query: 929 IYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEA 977
           +Y+ ++PD K + +E L+     + F GDG ND  AL  +D+GI++S  
Sbjct: 808 VYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSG 856

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type
           copper-transporting ATPase, involved in resistance to
           cadmium [3651 bp, 1216 aa]
          Length = 1216

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 103/244 (42%), Gaps = 45/244 (18%)

Query: 338 TNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETML 397
           T +N   L  GDI+++   S    P D  ++SG   V+E+++TGES+PV   P + ++++
Sbjct: 707 TEINIRLLQYGDIFKVLPDSR--IPTDGTVISGSSEVDEALITGESMPV---PKKCQSIV 761

Query: 398 QLLDDFQNTQISSYLSKSFLFNGTTIIR-ARIPYGQSAALAMVVRTGFSTTKGSLVRSMV 456
                         ++ S    GT  ++ +++P   +            +T  ++V    
Sbjct: 762 --------------VAGSVNGTGTLFVKLSKLPGNNTI-----------STIATMVDEAK 796

Query: 457 FPKPTGFKFYEDSFKY-IGVMALIALFGFSISCIQFIKIGLDKRT-----MILRALDIIT 510
             KP      +    Y +  +  I +  F +     I++    R+      I+ A+ ++ 
Sbjct: 797 LTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLI 856

Query: 511 IVVPP----ALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENG 566
           +  P     A+P    I +G A     K+G+   S   + +      + FDKTGTLTE  
Sbjct: 857 VSCPCVIGLAVPIVFVIASGVA----AKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGK 912

Query: 567 LDVL 570
           L V+
Sbjct: 913 LTVV 916

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 51/121 (42%), Gaps = 19/121 (15%)

Query: 875  MDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMS 934
            ++D+L +  +  IN        L   G    I+ GD++ ++        +    I +  +
Sbjct: 1022 LEDSLRADAVSTIN-------LLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHAT 1074

Query: 935  PDEKHELMEQL----------QRLNYTVGFCGDGANDCGALKAADVGISLSEAE--ASVA 982
            P EK E ++ +          Q     V FCGDG ND   L  A +G+ ++E    A +A
Sbjct: 1075 PAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLA 1134

Query: 983  A 983
            A
Sbjct: 1135 A 1135

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 929 IYARMSPDEKHELMEQLQRLNYT--VGFCGDGANDCGALKAADVGISLSEA 977
           +++ ++P++K +++ QLQ  N T  V F GDG ND  AL  AD+GIS+S  
Sbjct: 794 VFSEVTPEQKRDIVIQLQN-NGTERVAFVGDGINDSPALVEADLGISISSG 843

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 67/281 (23%), Positives = 105/281 (37%), Gaps = 63/281 (22%)

Query: 311 ETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSG 370
           ET      L  ++  +C + V  D     ++   L P DI E+  P + + P D +++  
Sbjct: 393 ETSTAMSKLISLTPSSCSI-VLPDGSTREISVELLQPNDIVEVV-PGMKI-PADGVVIRN 449

Query: 371 DCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPY 430
           +  V+ES++TGES+ V K                    S  +  S    G    RA I  
Sbjct: 450 ETEVDESLITGESMLVEKIVG-----------------SQVIGGSVNGPGHFYFRA-IRV 491

Query: 431 GQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL-FGFSISCI 489
           G+   LA ++ T        + ++ +   P          KY   MA I + F  S+S I
Sbjct: 492 GEDTKLANIIAT--------MKKAQLSKAPIQ--------KYADKMAGIFVPFVISLSAI 535

Query: 490 QFIKIGLDKRTM-----------------ILRALDIITIVVPPAL----PATLTIGTGFA 528
            FI   L   TM                 +  ++ +I +  P AL    P  + +GTG  
Sbjct: 536 TFITWMLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVG 595

Query: 529 LSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDV 569
            S     G+       +     +    FDKTGTLT   + V
Sbjct: 596 ASH----GVLIKGGDVLEKCSALQTFLFDKTGTLTTGRMSV 632

>Scas_505.4
          Length = 1025

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 917 EDYINTV--LLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGIS 973
           EDY+  +  + K  +  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ 
Sbjct: 576 EDYLLALGKICKAVVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVG 635

Query: 974 LSEAEASVAA 983
           +S  E   AA
Sbjct: 636 ISGMEGMQAA 645

>Scas_615.9
          Length = 942

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 2/75 (2%)

Query: 902 DIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYT-VGFCGDGAN 960
           DI+ ++ GD + +  +      +    +Y+ ++P  K E++E LQ  +   V F GDG N
Sbjct: 721 DIY-MVTGDSHGAAMKVAQQVGIAANNVYSGVTPSGKCEIVESLQADSVGGVAFVGDGIN 779

Query: 961 DCGALKAADVGISLS 975
           D   L  +D+G++LS
Sbjct: 780 DSPVLVTSDIGVALS 794

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 349 DIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSK 388
           DI EI  P + + P D +++ G+  ++ES++TGES+ V K
Sbjct: 383 DIIEIK-PGMKI-PADGIIIQGESEIDESLMTGESILVHK 420

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129)
           [3702 bp, 1233 aa]
          Length = 1233

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 99/251 (39%), Gaps = 56/251 (22%)

Query: 364 DSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTI 423
           D+L++ G+   +ES LTGES P++ FP +     Q+     N    + ++K     G ++
Sbjct: 681 DALIVQGETEFDESSLTGESRPITHFPGD-----QIFAGTVNVGQCAVIAKVSTAPGNSL 735

Query: 424 IRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFG 483
           +   I           VR G    +G+ +  +     TG+        ++  + L+A+  
Sbjct: 736 LDHVIS---------AVRDG--QLRGAPIERIA-DVLTGY--------FVPFIVLLAILT 775

Query: 484 FSISCIQFIKIGLDKRTM-----------ILRALDIITIVVPP----ALPATLTIGTGFA 528
           ++I  I      L +  +           +  A+ +  I  P     A P  L +G   A
Sbjct: 776 WAIWLILGFAGVLSQEKLDGSVGGWPFWSLEFAIAVFVIACPCGIGLAAPTALFVGANIA 835

Query: 529 LSRLKKKGIFCISPTRV-NIGGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFAD 587
                K GI     +    +G K+  +CFDKTGTLT+          C P   +   + D
Sbjct: 836 ----AKYGILARGGSAAFQMGSKVTTVCFDKTGTLTKG---------CAPEVTDYAIYPD 882

Query: 588 LVQDVHKLFPK 598
               +HK+  K
Sbjct: 883 --PRIHKILGK 891

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 906  IIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLN---YTVGFCGDGANDC 962
            +I GD  NS++ + +   +    + A + P+ K E ++ ++  +     +   GDG ND 
Sbjct: 1040 MISGD--NSLAANAVALEVGIKHVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDA 1097

Query: 963  GALKAADVGISLSEA 977
             A+ AADVGISL+  
Sbjct: 1098 PAIAAADVGISLASG 1112

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 8/124 (6%)

Query: 275 YVFQIFSII----LWSLDEYYYYAGCIFLISILSIVDTLVETR---RTQKSLADMSHFAC 327
           Y+F + +I     L S D    +     ++     V  L+E+R   R   SLA M   A 
Sbjct: 192 YLFSVATICRGVWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAP 251

Query: 328 EVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVS 387
            +   R+         +L+      +  P  T  P D  +L G+  V+ES++TGES  V 
Sbjct: 252 SMCTIRESGSDREVEVELLQAGDVVVMRPG-TKLPADGTVLEGEAEVDESLMTGESTLVP 310

Query: 388 KFPA 391
           K+P 
Sbjct: 311 KYPG 314

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (63%)

Query: 929 IYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLS 975
           +++   P+ K +++ QL++    V F GDG ND  AL  +D+GISLS
Sbjct: 632 VFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS 678

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 906 IIFGDENNSISEDYINTVLLK-GTIYARMSPDEKHELMEQLQ--RLNYTVGFCGDGANDC 962
           +I GD NNS ++     V +    +Y+ +SP  K +L++++Q    N  V   GDG ND 
Sbjct: 785 MITGD-NNSAAKRVAREVGISFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDA 843

Query: 963 GALKAADVGISLS 975
            AL  +D+GI++S
Sbjct: 844 PALALSDLGIAIS 856

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 92/233 (39%), Gaps = 52/233 (22%)

Query: 349 DIYEISDPSLTVFPCDSLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQI 408
           DI EI  P + + P D ++  G+  ++ES++TGES+ V K    P              I
Sbjct: 435 DIVEIK-PGMKI-PADGIITRGESEIDESLMTGESILVPKKTGFP-------------VI 479

Query: 409 SSYLS--KSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFY 466
           +  ++    F F  TT+       G+   LA +++      +  L ++ +     G+  Y
Sbjct: 480 AGSVNGPGHFYFRTTTV-------GEETKLANIIKV---MKEAQLSKAPI----QGYADY 525

Query: 467 EDSFKYIGVMALIALFGFSISC----------IQFI-KIGLDKRTMILRALDIITIVVPP 515
             S    G++ ++A+  F I C          + F      D   + L+    + IV  P
Sbjct: 526 LASIFVPGIL-ILAVLTFFIWCFILNISANPPVAFTANTKADNFFICLQTATSVVIVACP 584

Query: 516 -----ALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLT 563
                A P  + +GTG       + G+       +     I    FDKTGTLT
Sbjct: 585 CALGLATPTAIMVGTGVG----AQNGVLIKGGEVLEKFNSITTFVFDKTGTLT 633

>Scas_227.0d
          Length = 307

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 548 GGKIDILCFDKTGTLTENGLDVL 570
            G    +CFDKTGTLTEN + V+
Sbjct: 2   NGSATAVCFDKTGTLTENVMSVV 24

>KLLA0C17292g 1512447..1518143 similar to sp|P37297 Saccharomyces
           cerevisiae YLR305c STT4 phosphatidylinositol-4-kinase,
           start by similarity
          Length = 1898

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 69/165 (41%), Gaps = 28/165 (16%)

Query: 736 APEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNM 795
           +PEV+  I N A+L       +N++T    R+ A    V P    + SQ++S E V    
Sbjct: 367 SPEVLKAIVNVASL-------MNFFTD---RLSARLLNVFP--LIVSSQQISTELV---- 410

Query: 796 EFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPS 855
                     +L    A  L+ L E +I   + + +N+L     G    L+K +K+ V  
Sbjct: 411 ---------TQLSANFAIGLKPLSEDAIVGTIYSLNNLLAVTKDGSPVPLLKERKMTVSD 461

Query: 856 LEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAIT 900
           + E+D         R  +      D R  L   N +S++ +L ++
Sbjct: 462 MNELDKMFPRQ---RKANTFTSLNDMRVYLGAENDNSSTASLVLS 503

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,996,863
Number of extensions: 1912104
Number of successful extensions: 5039
Number of sequences better than 10.0: 83
Number of HSP's gapped: 5005
Number of HSP's successfully gapped: 188
Length of query: 1439
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1325
Effective length of database: 12,649,657
Effective search space: 16760795525
Effective search space used: 16760795525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)