Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_665.2932232214850.0
YOR292C3093197266e-95
KLLA0B08195g3303386912e-89
Kwal_26.92183103226521e-83
CAGL0M11330g2963286371e-81
AFR568C3152515512e-68
Kwal_14.2632199911689e-14
AFR120C182941563e-12
YLR251W1971131539e-12
Scas_639.202081131531e-11
Sklu_1738.3200931502e-11
CAGL0B03465g210941405e-10
KLLA0F22924g1951101396e-10
KLLA0F21252g46438653.4
CAGL0E01771g519117637.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_665.29
         (322 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_665.29                                                           576   0.0  
YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member...   284   6e-95
KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyce...   270   2e-89
Kwal_26.9218                                                          255   1e-83
CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743 S...   249   1e-81
AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)...   216   2e-68
Kwal_14.2632                                                           69   9e-14
AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [...    65   3e-12
YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mp...    64   9e-12
Scas_639.20                                                            64   1e-11
Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement         62   2e-11
CAGL0B03465g complement(343994..344626) highly similar to tr|Q06...    59   5e-10
KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomy...    58   6e-10
KLLA0F21252g complement(1981872..1983266) no similarity, hypothe...    30   3.4  
CAGL0E01771g complement(175415..176974) similar to sp|P53379 Sac...    29   7.4  

>Scas_665.29
          Length = 322

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/322 (88%), Positives = 286/322 (88%)

Query: 1   MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFFXXXXXXXXXXXXXX 60
           MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFF              
Sbjct: 1   MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFFTIRIYRITLTHLII 60

Query: 61  XXXWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIV 120
              WVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIV
Sbjct: 61  LIIWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIV 120

Query: 121 DDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEVGT 180
           DDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEVGT
Sbjct: 121 DDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEVGT 180

Query: 181 TRTYLXXXXXXXXXXXXXXXXXXXQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSPVQ 240
           TRTYL                   QVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSPVQ
Sbjct: 181 TRTYLFNFRRFFSFMFWGFFISFFQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSPVQ 240

Query: 241 LYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSS 300
           LYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSS
Sbjct: 241 LYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSS 300

Query: 301 SVGVLWNCFLSMRNASKSVNSA 322
           SVGVLWNCFLSMRNASKSVNSA
Sbjct: 301 SVGVLWNCFLSMRNASKSVNSA 322

>YOR292C (YOR292C) [5076] chr15 complement(865650..866579) Member of
           the Mpv17 and PMP22 family, which are peroxisomal
           proteins, has moderate similarity to uncharacterized C.
           albicans Orf6.6217p [930 bp, 309 aa]
          Length = 309

 Score =  284 bits (726), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 195/319 (61%), Gaps = 12/319 (3%)

Query: 1   MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFFXXXXXXXXXXXXXX 60
           M L+L G D I    D+       ++    + ++   A   ++                 
Sbjct: 1   MPLQLFGRDQIVVHYDNGNMSNDDQNHQSVLGSWTRRAAAALRTLMNKRIQRITLTHWLL 60

Query: 61  XXXWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIV 120
              WV+ L K+TS+Y ++YA +A+ ATL  N +LFGISD LAQSI CF+S  +DP+P+I+
Sbjct: 61  LVIWVTSLWKFTSHYRQLYANSAVFATLCTNILLFGISDILAQSIACFYSYHVDPIPQIL 120

Query: 121 DDTARHIMNQFRSPAHESLDLENG--YESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEV 178
           +DT  H+ N        + D+ENG  YESD LS+FND+  +   SS  + + +   +  +
Sbjct: 121 NDTFHHVQN--------NRDVENGGGYESDELSIFNDF--TSEHSSYTDNDDYPELDRPL 170

Query: 179 GTTRTYLXXXXXXXXXXXXXXXXXXXQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSP 238
            T +T                     Q PWYK LNFFYTEDPTV+QV ERVLSDQL YSP
Sbjct: 171 ATFKTDTFDFFRWGCFMFWGFFISFFQAPWYKFLNFFYTEDPTVVQVFERVLSDQLLYSP 230

Query: 239 VQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPF 298
           + LY FFM++NY+MEGG+ +T   KI+ +YISTLGCNYLVWP VQFINFL++P+ FQ PF
Sbjct: 231 ISLYCFFMFSNYVMEGGDKDTLGKKIQRLYISTLGCNYLVWPMVQFINFLIMPRDFQAPF 290

Query: 299 SSSVGVLWNCFLSMRNASK 317
           SSSVGV+WNCFLSMRNASK
Sbjct: 291 SSSVGVVWNCFLSMRNASK 309

>KLLA0B08195g 723299..724291 similar to sgd|S0005818 Saccharomyces
           cerevisiae YOR292c, start by similarity
          Length = 330

 Score =  270 bits (691), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 196/338 (57%), Gaps = 27/338 (7%)

Query: 1   MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFFXXXXXXXXXXXXXX 60
           M L L  E    +F  +S  R  + +  +  +T   N +  ++RF               
Sbjct: 1   MPLSLPEESGFASF--ESGLRDSLTNKIEQWKTITLNLIYSLRRF---KILKITIIHWSI 55

Query: 61  XXXWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIV 120
              W+  LL +TS Y  +Y  +AL+AT+  N +LFG SDCLAQ I+CF S  +DPVP++V
Sbjct: 56  LSTWIVLLLHFTSVYGSLYQSSALLATMCTNVLLFGTSDCLAQCISCFLSYKVDPVPEVV 115

Query: 121 DDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGL--------------SPASSSIG 166
           D   R+++        ES D  + Y SD +S+FNDYG+              SP   S  
Sbjct: 116 DKVTRNLVAGLSFRRTESFD--DNY-SDNVSIFNDYGVERPSFEGQTDTRNASPGIDSEL 172

Query: 167 NEEGFLPSE-----EEVGTTRTYLXXXXXXXXXXXXXXXXXXXQVPWYKILNFFYTEDPT 221
             +  L S      +   ++   L                   QVPWYK LN+FYTEDPT
Sbjct: 173 RHDWDLDSNLDYDADGTSSSNNELFSFYRWICFMSWGWFLSFFQVPWYKFLNYFYTEDPT 232

Query: 222 VIQVLERVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPA 281
           V+QVLERVLSDQL YSP+ LY FFMY+NYIME G+AE+F  KI++IYI+TLGCNYLVWP 
Sbjct: 233 VVQVLERVLSDQLVYSPISLYCFFMYSNYIMEHGDAESFQIKIRNIYITTLGCNYLVWPL 292

Query: 282 VQFINFLLLPKPFQVPFSSSVGVLWNCFLSMRNASKSV 319
           VQFINFL++PK  QVPFSSSVGVLWNCFLSMRN+S S+
Sbjct: 293 VQFINFLMVPKHLQVPFSSSVGVLWNCFLSMRNSSNSL 330

>Kwal_26.9218
          Length = 310

 Score =  255 bits (652), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 184/322 (57%), Gaps = 14/322 (4%)

Query: 1   MALELAGEDSI-TAFNDDSETRGVIKSSFKNIR-TFEENAVGKVKRFFXXXXXXXXXXXX 58
           M ++L   D I  ++ DD   RG  + + +N+R    E A     +              
Sbjct: 1   MPIQLFDRDQIAVSYGDDDMERGWTRRASRNVREKLLEWARRVDDKIQGYTLLHVGIVHW 60

Query: 59  XXXXXWVSFLLKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPK 118
                WV  L+K  S Y  MY ++AL  TL  N++LFG SD LAQ I  +   P+DP P 
Sbjct: 61  TLLTIWVMLLVKVASVYGRMYKRSALFTTLCTNAVLFGTSDILAQCILQYTWDPVDPTPA 120

Query: 119 IVDDTARHIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEV 178
            +D TA ++++++     +  D EN    D++S++N+YG    + S        P     
Sbjct: 121 ALDATAHNLVSRYALFGDQDSDAEN----DSISLYNEYGPGATAQS--------PVPYHQ 168

Query: 179 GTTRTYLXXXXXXXXXXXXXXXXXXXQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSP 238
                                     QVPWYK+LNFFYTEDPTV+QVLERVLSDQL YSP
Sbjct: 169 SAQHPPRFDFFRWLCFMAWGSFLSFFQVPWYKVLNFFYTEDPTVVQVLERVLSDQLVYSP 228

Query: 239 VQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPF 298
           + LY FFMY+NYIM+ G++ +F  KI+ +Y+ TLGCNYLVWP VQFINFL++PK  QVPF
Sbjct: 229 ISLYCFFMYSNYIMQKGDSASFKVKIQKVYLGTLGCNYLVWPPVQFINFLVVPKHLQVPF 288

Query: 299 SSSVGVLWNCFLSMRNASKSVN 320
           SSSVGV+WNCFLSMRNAS SV+
Sbjct: 289 SSSVGVVWNCFLSMRNASHSVD 310

>CAGL0M11330g complement(1114703..1115593) similar to sp|Q08743
           Saccharomyces cerevisiae YOR292c, hypothetical start
          Length = 296

 Score =  249 bits (637), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 194/328 (59%), Gaps = 43/328 (13%)

Query: 1   MALELAGEDSITAFNDDSETRGVIKSSFKNIRTFEENAVGKVKRFFXXXXXXXXXXXXXX 60
           M + L G D  TA+N     R V ++ F     F  +       F               
Sbjct: 1   MTIALPGVDGSTAYNYAVRQRNVFRTVFT-ANVFHISLTHWFLMF--------------- 44

Query: 61  XXXWVSFLLKYT-SYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKI 119
              W++ + +Y  ++Y ++Y  N L+A+   N +LFG+SD LAQ ITC+FS  +DPVP+I
Sbjct: 45  --CWLNLMWRYYFNHYKDLYKYNRLIASQLSNCMLFGLSDILAQCITCYFSREMDPVPRI 102

Query: 120 VDDTARHIM--NQFRSPA------HESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGF 171
           +D+T ++++  N    P        E LD +N    D LSVFNDYG    S    N+E  
Sbjct: 103 IDETVQNLIPYNVMPLPGGIFEANEELLDSDN---DDNLSVFNDYGEYDNS----NDEIE 155

Query: 172 LPSEEEVGTT--RTYLXXXXXXXXXXXXXXXXXXXQVPWYKILNFFYTEDPTVIQVLERV 229
               E+V T   R +L                   QVPWY ILN  YTEDPTV+QVLERV
Sbjct: 156 YNHTEKVATFHFRRWLGFMGWGGFISFF-------QVPWYIILNTIYTEDPTVVQVLERV 208

Query: 230 LSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLL 289
           L+DQL YSPV LYFFFMY+NY++E G+  TF+ KI+ +Y++TLGCNY++WP +QFINFL+
Sbjct: 209 LTDQLLYSPVSLYFFFMYSNYVIEQGDRYTFSMKIRRLYVTTLGCNYMIWPMMQFINFLV 268

Query: 290 LPKPFQVPFSSSVGVLWNCFLSMRNASK 317
           +PK +QVPFSSSVGV+WNCFLSMRNA+K
Sbjct: 269 IPKHYQVPFSSSVGVVWNCFLSMRNAAK 296

>AFR568C [3760] [Homologous to ScYOR292C - SH] (1459711..1460658)
           [948 bp, 315 aa]
          Length = 315

 Score =  216 bits (551), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 148/251 (58%), Gaps = 26/251 (10%)

Query: 72  TSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFS------GPLDPVPKIVDDTAR 125
           T  Y  +Y ++ LVAT   N +LFG+SDC AQ + C  +      GPL           R
Sbjct: 78  TRVYGWLYERSVLVATYCSNVLLFGLSDCAAQGLACAATEASRAGGPLA--------ATR 129

Query: 126 HIMNQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEVGTTRTYL 185
            ++ Q R      LD     E D L  F+DYG  P  S +   EG    EE     R + 
Sbjct: 130 ELLVQLRPQPPVRLD-----EEDELRAFSDYGPRP-ESHMTESEGVWVEEE----PRRF- 178

Query: 186 XXXXXXXXXXXXXXXXXXXQVPWYKILNFFYTEDPTVIQVLERVLSDQLTYSPVQLYFFF 245
                              QVPWY++LN+ YT+DPTV+QVLERVLSDQL YSP+ LY FF
Sbjct: 179 -DFYRWGCFMLWGPVMANFQVPWYRLLNYLYTDDPTVVQVLERVLSDQLLYSPLSLYCFF 237

Query: 246 MYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSSSVGVL 305
            Y+NY++EGG  ETFA KI+ +Y+STLGCNY VWP VQF+NFL++PK  QVPFSSSVGVL
Sbjct: 238 WYSNYVIEGGTEETFALKIQRVYVSTLGCNYAVWPLVQFLNFLVIPKSLQVPFSSSVGVL 297

Query: 306 WNCFLSMRNAS 316
           WN FLS+R AS
Sbjct: 298 WNIFLSLRAAS 308

>Kwal_14.2632
          Length = 199

 Score = 69.3 bits (168), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 56/91 (61%), Gaps = 1/91 (1%)

Query: 228 RVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINF 287
           RV +DQL ++P+ + F+F     +MEG + +    KI++++   L  N++VWPAVQ INF
Sbjct: 95  RVGTDQLLFAPLCVPFYFGILT-LMEGKSPKHAENKIRNVWWDILKTNWMVWPAVQIINF 153

Query: 288 LLLPKPFQVPFSSSVGVLWNCFLSMRNASKS 318
            L+P   ++   + V + WN FLS RN+  S
Sbjct: 154 SLVPVQHRLLAVNLVAIFWNTFLSFRNSEAS 184

>AFR120C [3312] [Homologous to ScYLR251W - SH] (655883..656431) [549
           bp, 182 aa]
          Length = 182

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 225 VLERVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQF 284
           VL RV  DQL ++P+ +  ++  A  +MEGG+ E    ++   + STL  N++VWPA Q 
Sbjct: 89  VLARVACDQLIFAPIGVPLYYT-AMALMEGGSLEDVRIRLSEKWWSTLLANWIVWPAFQL 147

Query: 285 INFLLLPKPFQVPFSSSVGVLWNCFLSMRNASKS 318
            NF L+P   ++   + + + WN +LS  N++ S
Sbjct: 148 CNFSLVPVQHRLLTVNVLSIFWNTYLSYSNSTAS 181

>YLR251W (YLR251W) [3647] chr12 (641466..642059) Member of the Mpv17
           and PMP22 family, which are peroxisomal proteins, has
           low similarity to mouse Mpv17, which functions in
           peroxisomal reactive oxygen metabolism and is associated
           with glomerulosclerosis and inner ear defects [594 bp,
           197 aa]
          Length = 197

 Score = 63.5 bits (153), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 208 WYKILN--FFYTEDPTVI--QVLERVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATK 263
           WYKILN   +    P      ++ RV  DQL ++P+ L F+F   + IMEG + +    K
Sbjct: 70  WYKILNNKIYMRNRPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMS-IMEGRSFDVAKLK 128

Query: 264 IKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSSSVGVLWNCFLSMRNAS 316
           IK  +  TL  N+ VWP  Q INF ++P   ++   + V + WN +LS +N+ 
Sbjct: 129 IKEQWWPTLLTNWAVWPLFQAINFSVVPLQHRLLAVNVVAIFWNTYLSYKNSK 181

>Scas_639.20
          Length = 208

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 6/113 (5%)

Query: 208 WYKILNF-----FYTEDPTVIQVLERVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFAT 262
           WYKIL          +    + +L +V  DQL ++P+ + F+F     IMEGG  +   T
Sbjct: 80  WYKILQNNVKLPLRFQHNKSLSMLYKVSVDQLAFAPLGVPFYFSCMT-IMEGGTMKDVET 138

Query: 263 KIKSIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSSSVGVLWNCFLSMRNA 315
           KIK+ +  TL  N+ VWP  Q +NF  +P   ++   + V + WN +LS  N+
Sbjct: 139 KIKTQWWRTLVTNWCVWPLFQMVNFTWVPLQHRLLAVNVVAIFWNTYLSYMNS 191

>Sklu_1738.3 YLR251W, Contig c1738 3838-4440 reverse complement
          Length = 200

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 52/93 (55%), Gaps = 5/93 (5%)

Query: 228 RVLSDQLTYSP--VQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFI 285
           RV  DQL +SP  V LYF  M    I+EG N +   T+I   +  TL  N+ VWPA Q +
Sbjct: 96  RVGVDQLGFSPIGVPLYFGIMT---ILEGRNIDEARTRISDNWWPTLVTNWAVWPAFQLV 152

Query: 286 NFLLLPKPFQVPFSSSVGVLWNCFLSMRNASKS 318
           NF L+P   ++   + V + WN FLS +N+  +
Sbjct: 153 NFSLVPLSHRLLAVNVVSIFWNTFLSYKNSRAT 185

>CAGL0B03465g complement(343994..344626) highly similar to tr|Q06563
           Saccharomyces cerevisiae YLR251w, hypothetical start
          Length = 210

 Score = 58.5 bits (140), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 1/94 (1%)

Query: 228 RVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIKSIYISTLGCNYLVWPAVQFINF 287
           RV  DQL ++P+ L F+F   + ++EG        KIK  +  TL  N+ VWP  Q +NF
Sbjct: 106 RVCVDQLGFAPLGLPFYFGCMS-LLEGHGLGAAREKIKLQWWDTLKTNWCVWPLFQMVNF 164

Query: 288 LLLPKPFQVPFSSSVGVLWNCFLSMRNASKSVNS 321
            L+P   ++  ++ V + WN FLS  N+   V  
Sbjct: 165 SLVPLQHRLLAANVVAIFWNTFLSYTNSQIPVGG 198

>KLLA0F22924g 2129434..2130021 similar to sgd|S0004241 Saccharomyces
           cerevisiae YLR251w, hypothetical start
          Length = 195

 Score = 58.2 bits (139), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 208 WYKILNFFYTEDPTV--IQVLERVLSDQLTYSPVQLYFFFMYANYIMEGGNAETFATKIK 265
           WYK LN      P         RV  DQL ++PV +  ++   + I+EG +      KI+
Sbjct: 70  WYKFLNQKVIVKPGKHWTNTAARVGCDQLLFAPVGIPMYYGVMS-ILEGKSLVDAKKKIE 128

Query: 266 SIYISTLGCNYLVWPAVQFINFLLLPKPFQVPFSSSVGVLWNCFLSMRNA 315
             +  TL  N+ VWPA Q INF L+P   ++   + + + WN FLS +N+
Sbjct: 129 DNWWPTLVTNWYVWPAFQLINFSLVPVHHRLFSVNIISIFWNAFLSFKNS 178

>KLLA0F21252g complement(1981872..1983266) no similarity,
           hypothetical start
          Length = 464

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 4/38 (10%)

Query: 112 PLDPVPKIVDD-TARHIMNQFRSPAHESLDLENGYESD 148
           PL+PVP ++ D TA      F+ P +E+  LEN +E++
Sbjct: 160 PLEPVPAVITDLTAEET---FKKPINENYTLENKFETN 194

>CAGL0E01771g complement(175415..176974) similar to sp|P53379
           Saccharomyces cerevisiae YDR144c MKC7 or sp|P32329
           Saccharomyces cerevisiae YLR120c YAP3 or sp|Q12303
           Saccharomyces cerevisiae YLR121c YPS3, hypothetical
           start
          Length = 519

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 51/117 (43%), Gaps = 31/117 (26%)

Query: 69  LKYTSYYNEMYAKNALVATLFMNSILFGISDCLAQSITCFFSGPLDPVPKIVDDTARHIM 128
           + Y+ Y N   +K          SILFG  D         +SGPL  +P         I+
Sbjct: 230 VAYSIYLNSTKSKQG--------SILFGAVDHSK------YSGPLYTLP---------IV 266

Query: 129 NQFRSPAHESLDLENGYESDTLSVFNDYGLSPASSSIGNEEGFLPSEEEVGTTRTYL 185
           N+F    H    +EN YE +     +  GL  A+S+I   +  LP+  + GTT TY+
Sbjct: 267 NRF---GHL---VENPYELEV--TLSGLGLQRATSNITLFDQLLPALLDTGTTYTYM 315

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,431,495
Number of extensions: 372351
Number of successful extensions: 900
Number of sequences better than 10.0: 18
Number of HSP's gapped: 885
Number of HSP's successfully gapped: 20
Length of query: 322
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 220
Effective length of database: 13,065,073
Effective search space: 2874316060
Effective search space used: 2874316060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)