Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_665.28*1051055533e-75
YOR293W (RPS10A)1051055134e-69
YMR230W (RPS10B)1051055031e-67
CAGL0M04873g1051054988e-67
Scas_594.3*1161044893e-65
AFR569W1051054804e-64
KLLA0B08173g1061044345e-57
YDR373W (FRQ1)190109670.17
KLLA0E02398g19080650.30
Kwal_55.21391190109630.66
Sklu_1986.2190110620.79
AFR097W27756620.89
Scas_676.9190109601.6
Scas_672.1947122601.7
Sklu_2083.241143601.8
Scas_719.1967650592.6
Kwal_26.797235833575.0
ACL163W19080557.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_665.28*
         (105 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_665.28*                                                          217   3e-75
YOR293W (RPS10A) [5077] chr15 (867095..867146,867584..867849) Ri...   202   4e-69
YMR230W (RPS10B) [4186] chr13 (732413..732464,732875..733140) Ri...   198   1e-67
CAGL0M04873g 532872..533189 highly similar to sp|P46784 Saccharo...   196   8e-67
Scas_594.3*                                                           192   3e-65
AFR569W [3761] [Homologous to ScYOR293W (RPS10A) - SH; ScYMR230W...   189   4e-64
KLLA0B08173g complement(722254..722574) highly similar to sp|Q08...   171   5e-57
YDR373W (FRQ1) [1199] chr4 (1222747..1223319) Essential N-myrist...    30   0.17 
KLLA0E02398g 223247..223819 highly similar to sp|Q06389 Saccharo...    30   0.30 
Kwal_55.21391                                                          29   0.66 
Sklu_1986.2 YDR373W, Contig c1986 4821-5393                            28   0.79 
AFR097W [3289] [Homologous to ScYKR022C - SH] complement(609919....    28   0.89 
Scas_676.9                                                             28   1.6  
Scas_672.19                                                            28   1.7  
Sklu_2083.2 YGR210C, Contig c2083 2540-3775 reverse complement         28   1.8  
Scas_719.19                                                            27   2.6  
Kwal_26.7972                                                           27   5.0  
ACL163W [886] [Homologous to ScYDR373W (FRQ1) - SH] complement(7...    26   7.8  

>Scas_665.28*
          Length = 105

 Score =  217 bits (553), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY 105
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY 105

>YOR293W (RPS10A) [5077] chr15 (867095..867146,867584..867849)
           Ribosomal protein S10 (rat S10), nearly identical to
           Rps10Bp [318 bp, 105 aa]
          Length = 105

 Score =  202 bits (513), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLM KEDR KIH+YLFQ GVVVAKKDFNQ+KHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY 105
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQ+R+ TQRPQRRY
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRRY 105

>YMR230W (RPS10B) [4186] chr13 (732413..732464,732875..733140)
           Ribosomal protein S10 (rat S10), nearly identical to
           Rps10Ap [318 bp, 105 aa]
          Length = 105

 Score =  198 bits (503), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 94/105 (89%), Positives = 101/105 (96%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLM K++R KIH+YLFQ GVVVAKKDFNQ+KHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMPKQERNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY 105
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQ+R+ +QRPQRRY
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPSQRPQRRY 105

>CAGL0M04873g 532872..533189 highly similar to sp|P46784
           Saccharomyces cerevisiae YMR230w RPS10B or sp|Q08745
           Saccharomyces cerevisiae YOR293w RPS10A, start by
           similarity
          Length = 105

 Score =  196 bits (498), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 94/105 (89%), Positives = 98/105 (93%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLM KE+RTKIHR+LFQ GVVVAKKDFNQ KH+EIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMPKEERTKIHRHLFQEGVVVAKKDFNQPKHDEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY 105
           WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQ+  Q QRP RRY
Sbjct: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQNAQQAQRPNRRY 105

>Scas_594.3*
          Length = 116

 Score =  192 bits (489), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 97/104 (93%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           MLMSKEDRTKIHRYLFQGGVVVAKKDFNQ KHEEIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQPKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRR 104
           WQYYYYTLTEEGVEYLREYL+LPEHIVPGT IQDRS   +  ++
Sbjct: 61  WQYYYYTLTEEGVEYLREYLHLPEHIVPGTSIQDRSHHHKTTKK 104

>AFR569W [3761] [Homologous to ScYOR293W (RPS10A) - SH; ScYMR230W
           (RPS10B) - SH]
           complement(1460872..1460923,1461002..1461267) [318 bp,
           105 aa]
          Length = 105

 Score =  189 bits (480), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 89/105 (84%), Positives = 98/105 (93%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           ML+ KE+RTKIHR LFQ GV+VAKKDFNQ KH+EIDTKNLYVIKALQSLTSKGYVKTQFS
Sbjct: 1   MLIPKEERTKIHRKLFQDGVLVAKKDFNQPKHDEIDTKNLYVIKALQSLTSKGYVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRRY 105
           WQYYYYTLTEEGVEYLR YL LPE+++PGTY+ DRSQ+QRPQRRY
Sbjct: 61  WQYYYYTLTEEGVEYLRNYLGLPENVIPGTYMADRSQSQRPQRRY 105

>KLLA0B08173g complement(722254..722574) highly similar to sp|Q08745
           Saccharomyces cerevisiae YOR293w RPS10A ribosomal
           protein S10.e, start by similarity
          Length = 106

 Score =  171 bits (434), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 92/104 (88%)

Query: 1   MLMSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFS 60
           ML+ KEDR KI+++LFQ GV+VAKKDFNQ KHEEIDTKNL+VIKALQSLTSKG+VKTQFS
Sbjct: 1   MLIPKEDRKKIYQHLFQEGVLVAKKDFNQPKHEEIDTKNLFVIKALQSLTSKGFVKTQFS 60

Query: 61  WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQDRSQTQRPQRR 104
           WQYYYYTLTEEGV YLREYLNLPEHI P TY+  +S  QRPQ +
Sbjct: 61  WQYYYYTLTEEGVVYLREYLNLPEHIFPATYLAGQSGDQRPQGK 104

>YDR373W (FRQ1) [1199] chr4 (1222747..1223319) Essential
           N-myristoylated calcium-binding protein that binds Pik1p
           and stimulates its activity in vitro, member of the
           recoverin/frequenin branch of the EF-hand superfamily
           [573 bp, 190 aa]
          Length = 190

 Score = 30.4 bits (67), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 45/109 (41%), Gaps = 10/109 (9%)

Query: 3   MSKEDRTKIHRYLFQGGVVVAKKDFNQSKHEEIDTKNLYVIK-----ALQSLTSKGYVKT 57
           +++ED  KI++  F  G   + +DF        D  N   I       + S TS+G ++ 
Sbjct: 43  LAREDFVKIYKQFFPFG---SPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEE 99

Query: 58  QFSWQYYYYTLTEEGVEYLREYLNLPEHI--VPGTYIQDRSQTQRPQRR 104
           + SW +  Y L  +G     E L +   +  + G+ +        P+ R
Sbjct: 100 KLSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMR 148

>KLLA0E02398g 223247..223819 highly similar to sp|Q06389
           Saccharomyces cerevisiae YDR373w FRQ1 regulator of
           phosphatidylinositol-4-OH kinase protein, start by
           similarity
          Length = 190

 Score = 29.6 bits (65), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 27  FNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHI 86
           F++  +  ID K    I AL S TS+G ++ +  W +  Y L  +GV    E L +   I
Sbjct: 72  FDKDNNGSIDFKEF--ITAL-STTSRGSLEEKLVWAFQLYDLNHDGVISYEEMLTIVSSI 128

Query: 87  --VPGTYIQDRSQTQRPQRR 104
             + G  ++       P+ R
Sbjct: 129 YKMIGNMVKLSDDEATPELR 148

>Kwal_55.21391
          Length = 190

 Score = 28.9 bits (63), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 10/109 (9%)

Query: 3   MSKEDRTKIHRYLFQGGVVVAKKD-----FNQSKHEEIDTKNLYVIKALQSLTSKGYVKT 57
           ++KE+ TKI++  F  G            F++  +  ID K    I AL S TS+G ++ 
Sbjct: 43  LTKEEFTKIYKQFFPFGAPEEFASHIFSVFDKDDNGTIDFKEF--ISAL-STTSRGTLEE 99

Query: 58  QFSWQYYYYTLTEEGVEYLREYLNLPEHI--VPGTYIQDRSQTQRPQRR 104
           +  W +  Y L   G     E L +   I  + G+ ++       P+ R
Sbjct: 100 KLVWAFQLYDLNHNGSISYDEMLTIVSSIYKMIGSMVKLDDNEATPELR 148

>Sklu_1986.2 YDR373W, Contig c1986 4821-5393
          Length = 190

 Score = 28.5 bits (62), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 10/110 (9%)

Query: 2   LMSKEDRTKIHRYLFQGGVVVAKKD-----FNQSKHEEIDTKNLYVIKALQSLTSKGYVK 56
           L+S+E+  KI++  F  G      +     F++  +  ID +    I AL S TS+G ++
Sbjct: 42  LLSREEFVKIYKQFFPFGTPEEFANHVFSVFDKDDNGTIDFREF--ITAL-STTSRGTLE 98

Query: 57  TQFSWQYYYYTLTEEGVEYLREYLNLPEHI--VPGTYIQDRSQTQRPQRR 104
            +  W +  Y L  +G     E L +   I  + G+ ++       P+ R
Sbjct: 99  EKLVWAFQLYDLNHDGYISYDEMLTIVSSIYKMIGSMVKLNEDEATPELR 148

>AFR097W [3289] [Homologous to ScYKR022C - SH]
           complement(609919..610752) [834 bp, 277 aa]
          Length = 277

 Score = 28.5 bits (62), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 30  SKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEH 85
           SK E +D K L   +  Q   +   V  QFS + Y   L  E  E L+E L  P H
Sbjct: 88  SKQEILDIKKLRAERQ-QEAAAGSAVDQQFSEKSYVRMLDREDKEDLQELLGRPLH 142

>Scas_676.9
          Length = 190

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/109 (20%), Positives = 48/109 (44%), Gaps = 10/109 (9%)

Query: 3   MSKEDRTKIHRYLFQGGVVVAKKD-----FNQSKHEEIDTKNLYVIKALQSLTSKGYVKT 57
           +++ED  +I++  F  G      +     F++  +  ID K    +    S TS+G ++ 
Sbjct: 43  LTREDFVRIYKQFFPFGTPEEFANHLFSVFDRDNNGAIDFKEFITV---LSTTSRGSLEE 99

Query: 58  QFSWQYYYYTLTEEGVEYLREYLNLPEHI--VPGTYIQDRSQTQRPQRR 104
           +  W +  Y L  +G     E L +   +  + G+ ++ ++    P+ R
Sbjct: 100 KLIWAFDLYDLNHDGYITYDEMLTIVTSVYKMMGSMVKLKADEATPELR 148

>Scas_672.19
          Length = 471

 Score = 27.7 bits (60), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 16/22 (72%)

Query: 79  YLNLPEHIVPGTYIQDRSQTQR 100
           Y++LP+ ++P  YIQD S  ++
Sbjct: 12  YVDLPQCVIPTVYIQDNSTQKK 33

>Sklu_2083.2 YGR210C, Contig c2083 2540-3775 reverse complement
          Length = 411

 Score = 27.7 bits (60), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 12/43 (27%)

Query: 46  LQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVP 88
           L+ L+ +G+VK             EEG E++  Y + PEH+ P
Sbjct: 262 LRKLSKQGFVKY------------EEGTEFIDTYEDDPEHLKP 292

>Scas_719.19
          Length = 676

 Score = 27.3 bits (59), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 7   DRTKIHRYLFQGGVV---VAKKDFNQSKHEEIDTKNLYVIKALQSLTSKG 53
           D T+I R +    +V   +  KDF   K E IDT  + ++  L+ LT  G
Sbjct: 428 DSTRILRLICLMSIVRISIRDKDFENFKKELIDTFGIEILFQLERLTQAG 477

>Kwal_26.7972
          Length = 358

 Score = 26.6 bits (57), Expect = 5.0,   Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 38  KNLYVIKALQSLTSKGYVKTQFS-WQYYYYTLT 69
           K +Y  +A +SLTSK YV   F+ W  +Y   T
Sbjct: 170 KQIYTERASESLTSKSYVPRWFAHWCNFYRGFT 202

>ACL163W [886] [Homologous to ScYDR373W (FRQ1) - SH]
           complement(72514..73086) [573 bp, 190 aa]
          Length = 190

 Score = 25.8 bits (55), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 27  FNQSKHEEIDTKNLYVIKALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHI 86
           F++  +  ID K    I AL S TS+G ++ +  W +  Y L  +G     E L +   +
Sbjct: 72  FDKDNNGTIDFKEF--ITAL-STTSRGTLEEKLVWAFQLYDLNHDGYITYNEMLTIVTSV 128

Query: 87  --VPGTYIQDRSQTQRPQRR 104
             + G+ ++       P+ R
Sbjct: 129 YKMIGSMVKLSEDEATPELR 148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,586,114
Number of extensions: 136570
Number of successful extensions: 463
Number of sequences better than 10.0: 28
Number of HSP's gapped: 463
Number of HSP's successfully gapped: 28
Length of query: 105
Length of database: 16,596,109
Length adjustment: 76
Effective length of query: 29
Effective length of database: 13,965,141
Effective search space: 404989089
Effective search space used: 404989089
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)