Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_665.272032038601e-119
YOR294W (RRS1)2032026951e-93
Sklu_1837.32082016751e-90
KLLA0B13046g2042016741e-90
CAGL0G07535g2031986523e-87
ABL014C2052016462e-86
Kwal_55.203102052016385e-85
CAGL0L03377g120971770.065
YDL093W (PMT5)74321633.3
YDL095W (PMT1)81742624.1
KLLA0B07579g72234608.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_665.27
         (203 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_665.27                                                           335   e-119
YOR294W (RRS1) [5078] chr15 (868337..868948) Regulator of riboso...   272   1e-93
Sklu_1837.3 YOR294W, Contig c1837 3113-3739 reverse complement        264   1e-90
KLLA0B13046g complement(1139556..1140170) similar to sp|Q08746 S...   264   1e-90
CAGL0G07535g 714360..714971 highly similar to sp|Q08746 Saccharo...   255   3e-87
ABL014C [578] [Homologous to ScYOR294W (RRS1) - SH] (372112..372...   253   2e-86
Kwal_55.20310                                                         250   5e-85
CAGL0L03377g complement(382932..386561) some similarities with s...    34   0.065
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...    29   3.3  
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...    28   4.1  
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    28   8.9  

>Scas_665.27
          Length = 203

 Score =  335 bits (860), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 172/203 (84%), Positives = 172/203 (84%)

Query: 1   MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQL 60
           MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQL
Sbjct: 1   MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQL 60

Query: 61  LINQLLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAK 120
           LINQLLSLPIK                 LLQLPVPIT              TKWEQFAAK
Sbjct: 61  LINQLLSLPIKTTTDSTGGSTGQNSSMTLLQLPVPITELPREKPLPKPKAPTKWEQFAAK 120

Query: 121 KGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLG 180
           KGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLG
Sbjct: 121 KGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLG 180

Query: 181 RNERKQLIKKNERQQKRNLKGGR 203
           RNERKQLIKKNERQQKRNLKGGR
Sbjct: 181 RNERKQLIKKNERQQKRNLKGGR 203

>YOR294W (RRS1) [5078] chr15 (868337..868948) Regulator of ribosome
           synthesis [612 bp, 203 aa]
          Length = 203

 Score =  272 bits (695), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 155/202 (76%)

Query: 1   MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQL 60
           MSAE+YK LPVTVEKPI V YDLGNLA FDSNVL+K+D D+SN +REE IK++TRDNVQL
Sbjct: 1   MSAEDYKNLPVTVEKPIPVVYDLGNLAAFDSNVLDKNDLDSSNARREEKIKSLTRDNVQL 60

Query: 61  LINQLLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAK 120
           LINQLLSLP+K                 LLQLP P T              TKWE+FAAK
Sbjct: 61  LINQLLSLPMKTTTESVGGTGGQSSVMTLLQLPDPTTDLPREKPLPKAKAMTKWEKFAAK 120

Query: 121 KGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLG 180
           KGI+PK ++GKM+YDEA+GEWVPKWGYKG NKKLDDQWLVEVDDKV+GT +ELIDPRTL 
Sbjct: 121 KGIKPKERAGKMIYDEASGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTDNELIDPRTLN 180

Query: 181 RNERKQLIKKNERQQKRNLKGG 202
           R ERK+L+KKNE+QQ+RN+K  
Sbjct: 181 RAERKRLVKKNEKQQRRNMKNA 202

>Sklu_1837.3 YOR294W, Contig c1837 3113-3739 reverse complement
          Length = 208

 Score =  264 bits (675), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 132/201 (65%), Positives = 152/201 (75%)

Query: 2   SAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQLL 61
           +A+++K+LPVTV+KPI VSYDLGNLAVFDSNVL+KD+ D+SN KREE+IK MTRDNVQL+
Sbjct: 4   TADKFKSLPVTVDKPIPVSYDLGNLAVFDSNVLDKDELDSSNAKREEHIKGMTRDNVQLM 63

Query: 62  INQLLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAKK 121
           INQ+LSLPIK                 L+QLP P +              TKWE FAAKK
Sbjct: 64  INQILSLPIKSTTESAGSSSGQASSMTLVQLPEPTSELPREKPLPKPKAPTKWELFAAKK 123

Query: 122 GIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLGR 181
           GI+ K +SGKMVYDEA+GEW PKWGYKG NKKLDDQWLVEVDDKV+GT DELIDPRTL R
Sbjct: 124 GIKSKERSGKMVYDEASGEWAPKWGYKGTNKKLDDQWLVEVDDKVKGTEDELIDPRTLHR 183

Query: 182 NERKQLIKKNERQQKRNLKGG 202
            ERK+LIKKNE Q KRNL+  
Sbjct: 184 AERKKLIKKNELQNKRNLRNS 204

>KLLA0B13046g complement(1139556..1140170) similar to sp|Q08746
           Saccharomyces cerevisiae YOR294w RRS1 regulator of
           ribosome synthesis singleton, start by similarity
          Length = 204

 Score =  264 bits (674), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 132/201 (65%), Positives = 150/201 (74%)

Query: 1   MSAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQL 60
           MS  +Y   PVTVEK I V+YDLGNLAVFD+NVL+++DFD+SN  RE NIK++TRDNVQL
Sbjct: 1   MSTTKYSERPVTVEKAIPVTYDLGNLAVFDTNVLDRNDFDSSNAARESNIKDLTRDNVQL 60

Query: 61  LINQLLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAK 120
           LINQ+LSLPI+                 L+QLP P T              TKWEQFAAK
Sbjct: 61  LINQILSLPIRATTESAGGSSGQSSSMTLVQLPEPTTELPREKPLPKPKAPTKWEQFAAK 120

Query: 121 KGIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLG 180
           KGI+PK +SGKM+YDEA GEWVPKWGYKG NK+LDDQWLVEVDDKVQGT DELIDPRTL 
Sbjct: 121 KGIKPKERSGKMIYDEAAGEWVPKWGYKGSNKELDDQWLVEVDDKVQGTEDELIDPRTLN 180

Query: 181 RNERKQLIKKNERQQKRNLKG 201
           R ERK+LIKKN+ QQKRNLK 
Sbjct: 181 RAERKRLIKKNQLQQKRNLKN 201

>CAGL0G07535g 714360..714971 highly similar to sp|Q08746
           Saccharomyces cerevisiae YOR294w RRS1 regulator of
           ribosome synthesis, hypothetical start
          Length = 203

 Score =  255 bits (652), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 126/198 (63%), Positives = 150/198 (75%)

Query: 5   EYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQLLINQ 64
           EYK LPVTVEKPI V+YDLGNL+VFD+NV++++D D+SN KREE IK++TRDNVQLLINQ
Sbjct: 3   EYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKREEVIKSVTRDNVQLLINQ 62

Query: 65  LLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAKKGIQ 124
           LLSLPIK                 LLQLP P +              TKW++FAAKKGI+
Sbjct: 63  LLSLPIKKTTEHTGGNSGQGATVALLQLPEPSSELPREKPLPKPKALTKWQKFAAKKGIK 122

Query: 125 PKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLGRNER 184
           PK ++GKMV+DEATG+W PKWGY GINKKLDDQWLVEVDD  +GT +ELIDPR+L R ER
Sbjct: 123 PKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEVDDDTKGTENELIDPRSLNRAER 182

Query: 185 KQLIKKNERQQKRNLKGG 202
           K+L+KKNERQQK+NLK  
Sbjct: 183 KRLVKKNERQQKKNLKNA 200

>ABL014C [578] [Homologous to ScYOR294W (RRS1) - SH]
           (372112..372729) [618 bp, 205 aa]
          Length = 205

 Score =  253 bits (646), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 146/201 (72%), Gaps = 2/201 (0%)

Query: 2   SAEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQLL 61
           S+ E   LPVTVEKPI V+YDLGNLAVFDSN L+++D D+SN  REE+++ +TRDNVQLL
Sbjct: 4   SSAEKSELPVTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSNANREEHLRALTRDNVQLL 63

Query: 62  INQLLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAKK 121
           INQ+LSLPIK                 L++LP P T              TKWE FAAKK
Sbjct: 64  INQILSLPIKSTTDSTGSGQSSSIA--LVRLPEPTTDLPREKPLPKPKAPTKWELFAAKK 121

Query: 122 GIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLGR 181
            I+PK KSGKMVYDEA GEWVPKWGYKG NKKLDDQWLVEVDDKV+GT +ELIDPRTL R
Sbjct: 122 NIKPKEKSGKMVYDEAAGEWVPKWGYKGANKKLDDQWLVEVDDKVKGTEEELIDPRTLSR 181

Query: 182 NERKQLIKKNERQQKRNLKGG 202
            ERK+LIKKNE Q KRNLK  
Sbjct: 182 AERKKLIKKNELQHKRNLKNA 202

>Kwal_55.20310
          Length = 205

 Score =  250 bits (638), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 148/201 (73%)

Query: 3   AEEYKTLPVTVEKPISVSYDLGNLAVFDSNVLEKDDFDTSNGKREENIKNMTRDNVQLLI 62
           AEE K+LPVTVEKPI V+YDLGNLAVFD N L+++DFD+SN +RE+NIK++TR+NVQL+I
Sbjct: 5   AEEKKSLPVTVEKPIPVAYDLGNLAVFDPNTLDRNDFDSSNAQREKNIKSVTRENVQLMI 64

Query: 63  NQLLSLPIKXXXXXXXXXXXXXXXXXLLQLPVPITXXXXXXXXXXXXXXTKWEQFAAKKG 122
           NQ+LSLPIK                 L+QLP P T              TKWE+FAA KG
Sbjct: 65  NQILSLPIKSTTESAGGTSGQSASMTLVQLPEPTTELPREKPLPKPKAPTKWEKFAAIKG 124

Query: 123 IQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLGRN 182
           I+ K +SGKMVYDE  G+WVPKWGYKG NKKLD QWLVEVDDK +   +ELIDPR+L R 
Sbjct: 125 IKAKERSGKMVYDEDAGQWVPKWGYKGANKKLDKQWLVEVDDKPKKAENELIDPRSLSRA 184

Query: 183 ERKQLIKKNERQQKRNLKGGR 203
           ERK++IKKNE QQKRNLKG +
Sbjct: 185 ERKKIIKKNEVQQKRNLKGAK 205

>CAGL0L03377g complement(382932..386561) some similarities with
           sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
           interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 34.3 bits (77), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 122 GIQPKAKSGKMVYDEATGEWVPKWGYKGINKKLDDQWLVEVDDKVQGTADELIDPRTLGR 181
           G+QP +   K+ Y+  T +   K   +G+ K   D    EV  K+Q   +E+    TL R
Sbjct: 41  GLQPCSNCAKIGYNCVTSD---KLSRRGLPKGYTDLLECEVV-KLQKIVNEIAGYETLDR 96

Query: 182 NERKQLIKKNE 192
           NE K ++K N+
Sbjct: 97  NEFKSILKTND 107

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 8/21 (38%), Positives = 15/21 (71%)

Query: 145 WGYKGINKKLDDQWLVEVDDK 165
           +GY+G    ++D W++E+D K
Sbjct: 426 YGYEGFEGDINDDWIIEIDKK 446

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score = 28.5 bits (62), Expect = 4.1,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 138 TGEW---VPKWGYKGINKKLDDQWLVEVDDK--VQGTADELI 174
           + +W   V  +GY G +   +D W+VE+D K    G A E +
Sbjct: 420 SSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERV 461

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 27.7 bits (60), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 22/34 (64%)

Query: 141 WVPKWGYKGINKKLDDQWLVEVDDKVQGTADELI 174
           WVPK+   GI+ +   +W++E D + + +A +L+
Sbjct: 658 WVPKFLLDGISLERTIRWMIEPDYRDRPSASDLL 691

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,049,571
Number of extensions: 239706
Number of successful extensions: 619
Number of sequences better than 10.0: 19
Number of HSP's gapped: 612
Number of HSP's successfully gapped: 19
Length of query: 203
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 106
Effective length of database: 13,238,163
Effective search space: 1403245278
Effective search space used: 1403245278
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)