Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_663.345745724290.0
Sklu_2164.250845019520.0
YOR323C (PRO2)45645719450.0
Kwal_26.706745745118300.0
CAGL0F00693g45545218180.0
KLLA0A03982g44745118170.0
ADR351C45244716510.0
Scas_717.74522163850.025
CAGL0K03509g527187682.6
YGL157W34751655.3
YER091C (MET6)76780655.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_663.3
         (457 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_663.3                                                            940   0.0  
Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement         756   0.0  
YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   753   0.0  
Kwal_26.7067                                                          709   0.0  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   704   0.0  
KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   704   0.0  
ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   640   0.0  
Scas_717.74                                                            37   0.025
CAGL0K03509g complement(326043..327626) similar to sp|Q04458 Sac...    31   2.6  
YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknow...    30   5.3  
YER091C (MET6) [1523] chr5 complement(339860..342163) Homocystei...    30   5.8  

>Scas_663.3
          Length = 457

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/457 (100%), Positives = 457/457 (100%)

Query: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60
           MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL
Sbjct: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60

Query: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120
           SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV
Sbjct: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180
           IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180

Query: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240
           QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL
Sbjct: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240

Query: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300
           EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD
Sbjct: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300

Query: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360
           KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI
Sbjct: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360

Query: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420
           VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS
Sbjct: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420

Query: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDLDVTRKITL 457
           YQYQIRGNGQIAGDYLGAGGNRAFIHKDLDVTRKITL
Sbjct: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDLDVTRKITL 457

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/450 (80%), Positives = 404/450 (89%)

Query: 2   SSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHLS 61
           S+A++IAQ+AR+AGN LKT+S++ RS ILY I D LKA A  IE ANK+DLQNAKET+LS
Sbjct: 54  STAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETNLS 113

Query: 62  DSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLVI 121
           DSL+KRLDLFKGDKFETMLQGIKDVA+LEDPVGKIKMARELDE LTLYQVTAPVGVLLVI
Sbjct: 114 DSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLLVI 173

Query: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAVQ 181
           FESRPEVIANITAL IKSGNA ILKGGKESVNTFREMSRIIN  I +NEK TGVP GAVQ
Sbjct: 174 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGAVQ 233

Query: 182 LIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADLE 241
           LIETRQDV+DLLDQD YIDLVVPRGSNALVR IK STKIPVLGHADGICS+Y+DE+ADLE
Sbjct: 234 LIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDADLE 293

Query: 242 KAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLDK 301
           KAKRI  DAKTNYPAGCNA+ET+LINP+  NWWEVLEN+T +G+V +H   DVK+AY+ K
Sbjct: 294 KAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYVSK 353

Query: 302 LTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAIV 361
           L + G  D+ ++   V+ +E  DFDKEFLSLDCAVKFV+ST+EA++HIN+HSS+HTDAI+
Sbjct: 354 LKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDAII 413

Query: 362 TENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 421
           TENK+ AE FLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY
Sbjct: 414 TENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 473

Query: 422 QYQIRGNGQIAGDYLGAGGNRAFIHKDLDV 451
           QYQIRG GQ+A DYLGAGGN+AFIHKDLD+
Sbjct: 474 QYQIRGTGQVASDYLGAGGNKAFIHKDLDL 503

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/457 (79%), Positives = 403/457 (88%), Gaps = 1/457 (0%)

Query: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60
           MSS+QQIA+ AR AGN LKTISN+ RS ILYKI DALKA A  IE ANK+DL  AKET L
Sbjct: 1   MSSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGL 60

Query: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120
           +DSLLKRLDLFKGDKFE MLQGIKDVA+LEDPVGK+KMARELD+GLTLYQVTAPVGVLLV
Sbjct: 61  ADSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180
           IFESRPEVIANITAL IKSGNA ILKGGKESVNTFREM++I+NDTI + + ETGVPVG+V
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSV 180

Query: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240
           QLIETRQDV+DLLDQDEYIDLVVPRGSNALVR IK++TKIPVLGHADGICS+Y+DE+ADL
Sbjct: 181 QLIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADL 240

Query: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300
            KAKRI  DAKTNYPAGCNAMETLLINP    WWEVLEN+T +G VT+H   D+K AY D
Sbjct: 241 IKAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFD 300

Query: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360
           KL +LG   + I+  TVD DE+ DFDKEFLSLD A KFV STE AI+HIN HSSRHTDAI
Sbjct: 301 KLNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAI 360

Query: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420
           VTENK +AE F+KGVDSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLVS
Sbjct: 361 VTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVS 420

Query: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDLDVTRKITL 457
           YQYQIRG+GQ+A DYLGAGGN+AF+HKDLD+ + +TL
Sbjct: 421 YQYQIRGDGQVASDYLGAGGNKAFVHKDLDI-KTVTL 456

>Kwal_26.7067
          Length = 457

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/451 (74%), Positives = 387/451 (85%)

Query: 2   SSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHLS 61
           S+++ IA+ AR+ GN LKTISN+ RS++LYKI D LKA A+ I+ ANK DL+ AKE +L+
Sbjct: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62

Query: 62  DSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLVI 121
           DSL +RLDLFKGDKF+TML GIKDVA+LEDPVGKIK+ARELDE L LYQVTAPVG LLVI
Sbjct: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122

Query: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAVQ 181
           FESRPEVIANIT+L IKSGNA ILKGGKESV+TFRE+SRIIN  I +NE  +G+P   +Q
Sbjct: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182

Query: 182 LIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADLE 241
           LIETRQDV+DLL QD YIDLVVPRGSN LVR IK STKIPVLGHADGICS+Y+DEEADL+
Sbjct: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242

Query: 242 KAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLDK 301
           KA RI  DAKT+YPAGCNAMETLLINP    WW+VLEN+++ GDVTLH   DVK +Y  K
Sbjct: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302

Query: 302 LTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAIV 361
           L +    DDVI   TVD +   DFDKEFLSLDCAVKFV+STE+A+ HIN+HSS+HTDAI+
Sbjct: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362

Query: 362 TENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 421
           TENK +AE F+KGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY
Sbjct: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422

Query: 422 QYQIRGNGQIAGDYLGAGGNRAFIHKDLDVT 452
           QYQ+RG+GQIA DY+G+GG RAF+HK+LD++
Sbjct: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNLDIS 453

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/452 (75%), Positives = 394/452 (87%), Gaps = 1/452 (0%)

Query: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60
           MSSA++IA++AR+AGN LKTIS++NRS ILY+IRDAL     +IE+ANK DL+ A+   L
Sbjct: 1   MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGL 60

Query: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120
           +DSL+KRLDLFKGDKF+ MLQGI DVADLEDPVGK+KMARE+D GL LYQVTAPVGV+LV
Sbjct: 61  ADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180
           IFESRPEVIANITALCIKSGNAGILKGGKESVNTF+ M++++N TIE+ + ETGVPVGAV
Sbjct: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAV 180

Query: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240
           QLIETRQDV+DLL QDEYIDLVVPRGSN+LVR IK+STKIPVLGHADGICS+Y+D +ADL
Sbjct: 181 QLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADL 240

Query: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300
           EKAKRIV DAKTNYPAGCNAME LL+NP    W +VL ++  +G VT+H   DVK+A+L 
Sbjct: 241 EKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLK 300

Query: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360
           KL   G  +D IK   VD  +  DFDKEFLSLDCAVKF+ +T +AI HIN HSS+HTDAI
Sbjct: 301 KLQDSGKLNDDIKAKIVDAKDG-DFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAI 359

Query: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420
           +TE+K+ AE FLKG+DSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+
Sbjct: 360 ITESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 419

Query: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDLDVT 452
           YQYQIRG+GQ+A DYLGAGGN+AF+HKD+DVT
Sbjct: 420 YQYQIRGDGQVASDYLGAGGNKAFVHKDIDVT 451

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/451 (75%), Positives = 387/451 (85%), Gaps = 9/451 (1%)

Query: 1   MSSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHL 60
           MS ++ IA+ AR AGN LKT+S++ RS+ILYKI D LKA A+ IEAANKLDL+ AK T+L
Sbjct: 1   MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNL 60

Query: 61  SDSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLV 120
           SDSL+KRLDLFKGDKFETMLQGI DVA+L+DPVGK+  ARE+DE LTLYQ+TAPVGVLLV
Sbjct: 61  SDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLV 120

Query: 121 IFESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAV 180
           IFESRPEVIANITAL IKSGNA ILKGGKES+NTF+EMSRI+ND +E+NEK T VPVGAV
Sbjct: 121 IFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAV 180

Query: 181 QLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADL 240
           QLIETR+DV+DLL QDEYIDLV+PRGSNALVR IK+STKIPVLGHADGICS+Y+DE AD+
Sbjct: 181 QLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADI 240

Query: 241 EKAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLD 300
            KAKRI+ DAKTNYPAGCNA+ETLLINP   +WWEVL ++   G VTLH   +VKK Y +
Sbjct: 241 GKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENG-VTLHVSKEVKKQYKE 299

Query: 301 KLTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAI 360
             +   TSD     H VD+DE  DFDKEFLSLD AV FV STE A+ HIN HSS+HTDAI
Sbjct: 300 HNS---TSD-----HIVDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAI 351

Query: 361 VTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVS 420
           VTEN ++AE FLK VDSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+
Sbjct: 352 VTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVT 411

Query: 421 YQYQIRGNGQIAGDYLGAGGNRAFIHKDLDV 451
           YQYQ+RGNGQIA DYLGAGG +AF+HKDLDV
Sbjct: 412 YQYQLRGNGQIASDYLGAGGKKAFVHKDLDV 442

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/447 (68%), Positives = 370/447 (82%), Gaps = 5/447 (1%)

Query: 4   AQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHLSDS 63
           A+ IA++AR+AGN LKT+SN+ R+ +L +I D L A   DI  AN+ DL+ A + +L+ +
Sbjct: 5   AESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNNLAPA 64

Query: 64  LLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLVIFE 123
           L++RL+LFKGDKFE MLQGI DVA LEDPVGK++M RELDEGLTLY+VTAPVGV+L+IFE
Sbjct: 65  LVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVMLIIFE 124

Query: 124 SRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAVQLI 183
           SRPEVIANI+ALCIKSGNAGILKGGKE+VNTFRE++ +IN  + ++E ETGVPV AVQL+
Sbjct: 125 SRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHAVQLV 184

Query: 184 ETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADLEKA 243
           E+R +V+DLL QDEYIDLVVPRGSNALV+ IK STKIPVLGHADGICS+Y+D +ADL KA
Sbjct: 185 ESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADADLAKA 244

Query: 244 KRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLDKLT 303
           KRIV D+KTNY A CNA E+LLINP C  W EVL ++   G+V LH   DVK+A+     
Sbjct: 245 KRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF---- 300

Query: 304 QLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAIVTE 363
                D  +K + VD +E  DF +EFLSLD AVKF++S +EA+ HIN HSS+HTDAIVTE
Sbjct: 301 AYAGDDAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDAIVTE 359

Query: 364 NKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSYQY 423
            K +A+ FLKG+DS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+YQY
Sbjct: 360 CKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTYQY 419

Query: 424 QIRGNGQIAGDYLGAGGNRAFIHKDLD 450
           Q+RG GQ+A DY+GAGG+RAF+HKDLD
Sbjct: 420 QVRGTGQVASDYIGAGGDRAFVHKDLD 446

>Scas_717.74
          Length = 522

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 20/163 (12%)

Query: 117 VLLVIFESRPEVIANI-TALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGV 175
           VL++   + P ++A +  A  I +GN+ ILK  + + +T   M RII        +E G 
Sbjct: 127 VLVISPFNFPVLLALVPVAHAIGAGNSVILKPSERTAHTALVMQRII--------EEAGF 178

Query: 176 PVGAVQLIETRQDVNDLLDQDEYIDLVVPRGSNALVRNI-----KNSTKIPVLGHADGIC 230
           P G VQ+++   D    L   + +D++   GS  +   I     KN T  P +    G  
Sbjct: 179 PDGLVQVVQGAIDETQRLITSKDLDMIFYTGSPTVGSIIAQEAAKNLT--PCVLELGGKS 236

Query: 231 SVYIDE---EADLEKA-KRIVFDAKTNYPAGCNAMETLLINPS 269
             +I E   + +L+ A KRI F A  N    C + + LL++ S
Sbjct: 237 PTFITENFNDKNLKTALKRIFFGAFGNSGQICVSPDYLLVHES 279

>CAGL0K03509g complement(326043..327626) similar to sp|Q04458
           Saccharomyces cerevisiae YMR110c aldehyde-dehydrogenase
           like protein, hypothetical start
          Length = 527

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 80/187 (42%), Gaps = 23/187 (12%)

Query: 117 VLLVIFESRPEVIANITALC-IKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGV 175
           VL++   + P ++A     C + +GN  ILK          EM+      +E   K   +
Sbjct: 128 VLVISPFNFPVLLALAPVACALSAGNTVILKPS--------EMTPHCALVLEDIVKSCQL 179

Query: 176 PVGAVQLIETRQDVNDLLDQDEYIDLVVPRGS---NALVRNIKNSTKIPVLGHADGICSV 232
           P G +Q+++   +    L   E +D++   GS    ++V        +P +    G    
Sbjct: 180 PEGVLQIVQGGVEQTTKLINSESLDMIFYTGSPRVGSIVAQAAAKNLVPCVLELGGKSPT 239

Query: 233 YID---EEADLEKA-KRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRK-GDVT 287
           +I    ++ +LE A KRI F A  N    C + + LL++ S      + ++V ++ G V 
Sbjct: 240 FITGSLQKKNLETALKRIFFGAFGNAGQICVSPDYLLVHES------IYDDVVKESGKVM 293

Query: 288 LHCMPDV 294
               PD+
Sbjct: 294 KELYPDL 300

>YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1044 bp, 347 aa]
          Length = 347

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 360 IVTENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHAR 410
            + ENK S +  L  ++   V+      FAD  ++G  T  GI +  IH++
Sbjct: 183 FLKENKSSVKFTLSTINPGFVF--GPQMFADSLKHGINTSSGIVSELIHSK 231

>YER091C (MET6) [1523] chr5 complement(339860..342163) Homocysteine
           methyltransferase (5-methyltetrahydropteroyl
           triglutamate-homocysteine methyltransferase), methionine
           synthase, cobalamin-independent [2304 bp, 767 aa]
          Length = 767

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 114 PVGVLLVIFESRPEVIANITALC--IKSGNAGILKGGKESVNTFREMSRIINDTIEKNEK 171
           PV  L V F   PE    + A     ++ + GI+ G     N F++ S I+N  IEK   
Sbjct: 267 PVAALHVDFVRAPEQFDEVVAAIGNKQTLSVGIVDGRNIWKNDFKKSSAIVNKAIEKLGA 326

Query: 172 ETGVPVGAVQLIETRQDVND 191
           +  V   +  L+ T  D+N+
Sbjct: 327 DRVVVATSSSLLHTPVDLNN 346

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,692,160
Number of extensions: 672783
Number of successful extensions: 1948
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1986
Number of HSP's successfully gapped: 33
Length of query: 457
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 352
Effective length of database: 12,961,219
Effective search space: 4562349088
Effective search space used: 4562349088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)