Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_663.2755955923530.0
CAGL0G06314g6531703091e-29
YOR324C6021492602e-23
Scas_592.145491772583e-23
YAL028W5281472451e-21
Sklu_2164.44651351327e-08
KLLA0A03938g4201511237e-07
Kwal_26.70633781341032e-04
CAGL0J06996g110585702.2
Kwal_14.189047393658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_663.27
         (559 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_663.27                                                           910   0.0  
CAGL0G06314g complement(603668..605629) some similarities with s...   123   1e-29
YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protei...   104   2e-23
Scas_592.14                                                           103   3e-23
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...    99   1e-21
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         55   7e-08
KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...    52   7e-07
Kwal_26.7063                                                           44   2e-04
CAGL0J06996g complement(668088..671405) similar to sp|P32873 Sac...    32   2.2  
Kwal_14.1890                                                           30   8.3  

>Scas_663.27
          Length = 559

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/559 (82%), Positives = 463/559 (82%)

Query: 1   MNFLIDRIENPGTRTTLLPSSFPNKLQKKIDKSHEADLFSNNLKRKSAASKTRHLAPTKS 60
           MNFLIDRIENPGTRTTLLPSSFPNKLQKKIDKSHEADLFSNNLKRKSAASKTRHLAPTKS
Sbjct: 1   MNFLIDRIENPGTRTTLLPSSFPNKLQKKIDKSHEADLFSNNLKRKSAASKTRHLAPTKS 60

Query: 61  QNNIKLPILSINDEPILESEPSRIGLASYFSQRHNSEEGLSFKTSSRRKHLESQPLPDYS 120
           QNNIKLPILSINDEPILESEPSRIGLASYFSQRHNSEEGLSFKTSSRRKHLESQPLPDYS
Sbjct: 61  QNNIKLPILSINDEPILESEPSRIGLASYFSQRHNSEEGLSFKTSSRRKHLESQPLPDYS 120

Query: 121 AASLGTFSDCIFNDALSKEPTLTNAKGNYLDGGEKCLXXXXXXXXXXXXNTSPYKRRTSS 180
           AASLGTFSDCIFNDALSKEPTLTNAKGNYLDGGEKCL            NTSPYKRRTSS
Sbjct: 121 AASLGTFSDCIFNDALSKEPTLTNAKGNYLDGGEKCLRSRRQSSIYSSRNTSPYKRRTSS 180

Query: 181 FGASGPLGFSQVQNSGKQLKNKRSNSNNHSTNLASDKKRLVNEFLNCRNGPGKSPTISED 240
           FGASGPLGFSQVQNSGKQLKNKRSNSNNHSTNLASDKKRLVNEFLNCRNGPGKSPTISED
Sbjct: 181 FGASGPLGFSQVQNSGKQLKNKRSNSNNHSTNLASDKKRLVNEFLNCRNGPGKSPTISED 240

Query: 241 NLGETGWSIATKSNNNNQEQMNLFTDQSLSDILFHDLDTXXXXXXXXXXXXXXXXXXXXX 300
           NLGETGWSIATKSNNNNQEQMNLFTDQSLSDILFHDLDT                     
Sbjct: 241 NLGETGWSIATKSNNNNQEQMNLFTDQSLSDILFHDLDTPSQPISKSRSNSSSFPSSTST 300

Query: 301 XXXXXXXXKLPVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIPLPIMGKKTSLAISPK 360
                   KLPV                              PIPLPIMGKKTSLAISPK
Sbjct: 301 VLSSISPSKLPVTSSSLSIYSSSSTRSSFSSTSSSASSYETSPIPLPIMGKKTSLAISPK 360

Query: 361 ATSSAPEDLITNDELRATTTLNINCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEAD 420
           ATSSAPEDLITNDELRATTTLNINCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEAD
Sbjct: 361 ATSSAPEDLITNDELRATTTLNINCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEAD 420

Query: 421 LHGTLSKFDNLTFHLQNMKNRIDELYDVINEKYLSKIKTAFNXXXXXXXXXXLRTSVEAS 480
           LHGTLSKFDNLTFHLQNMKNRIDELYDVINEKYLSKIKTAFN          LRTSVEAS
Sbjct: 421 LHGTLSKFDNLTFHLQNMKNRIDELYDVINEKYLSKIKTAFNEDDESSFEFELRTSVEAS 480

Query: 481 IKQLEELENRMEYCQLKLQEQRETMRQLDNLILIENSLLESKKNVKHIYSYRXXXXXXXX 540
           IKQLEELENRMEYCQLKLQEQRETMRQLDNLILIENSLLESKKNVKHIYSYR        
Sbjct: 481 IKQLEELENRMEYCQLKLQEQRETMRQLDNLILIENSLLESKKNVKHIYSYRFLVFDILV 540

Query: 541 XXXXXXXGYWVKKIIGLFR 559
                  GYWVKKIIGLFR
Sbjct: 541 IFVVLYFGYWVKKIIGLFR 559

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score =  123 bits (309), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 102/170 (60%)

Query: 383 INCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRI 442
           +  NE +YYQ HI + L + E  +K +L++ ++KDE +L   ++ FDNLT  LQN+K++I
Sbjct: 478 LGTNETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNITSFDNLTSDLQNLKSQI 537

Query: 443 DELYDVINEKYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQLKLQEQR 502
             L + I  +YL+ +K  F+          LR +VE ++K LE LEN+M  CQ +L +Q+
Sbjct: 538 LGLKNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLEFLENKMSECQSQLVDQK 597

Query: 503 ETMRQLDNLILIENSLLESKKNVKHIYSYRXXXXXXXXXXXXXXXGYWVK 552
           ETMR++++L+ +ENSL+ SKKN    Y YR               GY++K
Sbjct: 598 ETMRKMESLLYLENSLMVSKKNTGLAYKYRYMLYDILTLGFLVLIGYYLK 647

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 21/165 (12%)

Query: 108 RKHLESQPLPDYSAASLGTFSDCIFNDALSKE-------------PT---LTNAKGNYLD 151
           +K L+   +PDY++ + G FS+C+FN  L K+             PT   L + +    +
Sbjct: 199 KKMLKRPTIPDYTSVNTGAFSECMFNTELEKQYNNNLSKTTKTEKPTPNRLGDQQEEVGN 258

Query: 152 GGEKCLXXXXXXXXXXXXNTSPYKRRTSSFGASGPLGFSQVQ--NSGKQLKNKRSNSNNH 209
           GG+  L            +    +R   S G +     +Q Q     K+ ++++S S ++
Sbjct: 259 GGQATLFTADKFIKSPVKSLDNEERPELSNGQNQSKNQNQTQFHKEHKKHRHQKSFSQSY 318

Query: 210 STNLASDKKRLVNEFLNCRNGPGKSPTISEDNLGETGWSIATKSN 254
            +N   D+KRLVN+FL      G +  +S +N    G +++   N
Sbjct: 319 GSN---DQKRLVNQFLQSIEKSGNNSALSSNNASAYGSTLSVGKN 360

>YOR324C (YOR324C) [5106] chr15 complement(923227..925035) Protein
           of the endoplasmic reticulum membrane [1809 bp, 602 aa]
          Length = 602

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 91/149 (61%)

Query: 384 NCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRID 443
           N +ELNYYQ HI   L + E  +++NL   +IK+E ++  T+ K+D L+  L  + + + 
Sbjct: 425 NIDELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLLDEMT 484

Query: 444 ELYDVINEKYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQLKLQEQRE 503
            L   +  ++L K+K+ F+          L+ SVE S+ QL+ LE RME CQ +L +Q+ 
Sbjct: 485 TLRTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLNKQKS 544

Query: 504 TMRQLDNLILIENSLLESKKNVKHIYSYR 532
           ++R++D+LI ++N L +SK N K IY YR
Sbjct: 545 SLREMDSLIELKNVLNKSKNNTKSIYLYR 573

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 67/165 (40%), Gaps = 39/165 (23%)

Query: 1   MNFLIDRIENPGTR-TTLLPSSFPNKLQK--------KIDKSHEADLFSNNLKRKSAASK 51
           MN LIDR+ENPG+R  TLLP SFP    K         +             +   A + 
Sbjct: 1   MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGLQPQPQPEPLQAKTN 60

Query: 52  TRHLAPTKSQNNIKLPILSINDEPILESEPSRIGLASYF---------------SQRH-- 94
             H + + S    +LP++++ND P++    + + L S                  +RH  
Sbjct: 61  VAHFSKSSS----RLPVIAVNDNPVVPRPSTEVNLGSLLQKEREKEKEEQPALHDRRHLY 116

Query: 95  ---NSEEGLSFKTSSRRKHLESQPLPDYSAASLGTFSDCIFNDAL 136
              N   G+      R++ LE   LP   +   G FSD +F D +
Sbjct: 117 VTKNRAHGV------RQRSLEMTSLPVLGSTKTGKFSDFLFEDDI 155

>Scas_592.14
          Length = 549

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 96/177 (54%)

Query: 379 TTLNINCNELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNM 438
           T L+++CNE++YYQ HI   L + E L+K+NL+  ++K E DLH  L  FD     L+ +
Sbjct: 371 TDLSLSCNEIDYYQRHIAIRLKKSEALMKENLRDIILKRENDLHNNLQNFDTYLHDLKKL 430

Query: 439 KNRIDELYDVINEKYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQLKL 498
           K +I  L  ++   YL  +K  F+          L   +  ++ +L++LE RME    +L
Sbjct: 431 KYQIISLQKLVRNDYLVILKEDFDVNNKNSFENHLTEILNKNVTKLQDLERRMESSGERL 490

Query: 499 QEQRETMRQLDNLILIENSLLESKKNVKHIYSYRXXXXXXXXXXXXXXXGYWVKKII 555
            EQ+ETM++++NLI +ENSL  S+KN   +   +               GY ++K+I
Sbjct: 491 NEQKETMKRMENLINLENSLKLSQKNASWVSKNKAIVYDLSVVFILLLSGYLLQKLI 547

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 83/323 (25%), Positives = 131/323 (40%), Gaps = 87/323 (26%)

Query: 1   MNFLIDRIENPGTRT------------TLLPSSFP--NKLQKKI--DKSHEADLFSNNLK 44
           M+ LI R+E+PG R+            TL+    P  N+ +KKI   ++H  +  S+   
Sbjct: 1   MDRLIARMEDPGKRSPSPMASSTEEPLTLVAGMNPSINRAKKKILRRETHTPENTSSEES 60

Query: 45  RKSAASKTRHLAPTKSQNNIKLPILSINDEPILESEPSRIGLASYFSQRHNSEEGLSFKT 104
            K + S+     P      +++P + +N+EPI E +P  +        R  S+  L    
Sbjct: 61  LKPSGSEMEEPKPETIPKTVEIPTIRVNNEPI-EDQPKLV--------RQQSQPNLVALG 111

Query: 105 SSRRKHLESQPL----PDYSAASLGTFSDCIFNDALSKEPTLTNAKGNYLDGGEKCLXXX 160
           +    H ES  L    PDY++A+ G FSD IFN++ +             DG        
Sbjct: 112 AKANGHRESATLRSGKPDYTSANTGMFSDHIFNESTA-------------DG-------- 150

Query: 161 XXXXXXXXXNTSPYKRRTSSFGASGPLGFSQVQNSGKQLKNKRSNSNNHSTNLA------ 214
                    N  P+   T++        F+Q QN  ++        ++ S+ L+      
Sbjct: 151 ----LIPRQNELPF-MDTNTDNPVKLTPFAQAQNEAERSGRHHRRHHSGSSELSRRSRAS 205

Query: 215 -----SDKKRLVNEFLNCRNGP------------GKSP--TISEDNLGETGWSIATKSNN 255
                +DKKRLVN+FL     P             K P    +  N   TG S  T+S++
Sbjct: 206 TLTNVTDKKRLVNQFLESVEAPSTLQLRFPDSLAAKRPKQMYNTSNFSSTGHS--TRSSD 263

Query: 256 NNQEQMNLFTDQSLSDILFHDLD 278
            +    N F  QSL   L+HDL+
Sbjct: 264 THMTTANSF--QSL---LYHDLE 281

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 88/147 (59%)

Query: 386 NELNYYQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDEL 445
           +EL+YYQ HI   L + E LLK +L+  V+KDE DL   ++ FD +   L+++++R    
Sbjct: 356 DELDYYQRHIGLQLQQTEALLKHSLKDEVLKDENDLVKNIANFDKIVKELRDLRSRTIGW 415

Query: 446 YDVINEKYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQLKLQEQRETM 505
            +++ E YL  +K  F+          L  ++  ++ +L++LE RM  C+ +L  ++E M
Sbjct: 416 KELVEEDYLMNLKQDFDKENPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVM 475

Query: 506 RQLDNLILIENSLLESKKNVKHIYSYR 532
           R++++L+ +ENSL+ SKKNV     YR
Sbjct: 476 RKMESLLSLENSLMISKKNVTFASKYR 502

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 94/234 (40%), Gaps = 44/234 (18%)

Query: 77  LESEPSRIGLASY--FSQRHNSEEGLSFKTSSRRKHLESQPLPDYSAASLGTFSDCIFND 134
           +E++P+    AS+   +  H  E+    +    R  L  Q +PDY++AS   FSDC+FN 
Sbjct: 51  VETKPNVGWQASHSNLAALHEKEQKYEMEHHHARHKLHRQVIPDYTSASTAMFSDCMFNA 110

Query: 135 ALSKEPTLTNAKGNYLDGGEKCLXXXXXXXXXXXXNTSPYKRRTSSFGASGPL--GFSQV 192
           A  K  +L+  K + L                      P+ + +     S PL  G+S  
Sbjct: 111 APDKVRSLSTMKSSGL--------SPKHPFNVVATFKGPFPQHSVE---SKPLDGGYSAK 159

Query: 193 QN--SGKQLKNKRSNSNNH------------STNLASDKKRLVNEFLNCRN--------- 229
            +  S K L+ ++  ++ H            S +   DKKRLV+ FL             
Sbjct: 160 DHFPSFKMLQAQQHPAHRHYKDNDKYGLKSPSRSFVKDKKRLVHRFLKSMEPSSSGQSKD 219

Query: 230 ----GPGKSPTISEDNLGETGWSIATKSNNNNQEQMNLFTDQSLSDILFHDLDT 279
                P   P +   N+        T  ++++    +  TD SL  +L+HDL++
Sbjct: 220 SSALAPAFDPILP--NVISKPSKRPTHHSHSSDGSSSTQTDISLQSLLYHDLES 271

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 68/135 (50%)

Query: 391 YQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDELYDVIN 450
           Y+ +I N + +FE ++K  +   +   E  +  +      L   L+ ++ RI EL+  + 
Sbjct: 295 YKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSFQTLSTLEKELRRIRTRIVELHYEVK 354

Query: 451 EKYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQLKLQEQRETMRQLDN 510
           E YL +++T FN          L   ++  +  LE+LE R++  +  L  Q+  +  +++
Sbjct: 355 ENYLVELETHFNATDSESFISQLDEIIQEHLSSLEKLEVRIKNSKDVLARQKNALEDMES 414

Query: 511 LILIENSLLESKKNV 525
           ++ ++  + +SKKN+
Sbjct: 415 IVKLKQLVADSKKNM 429

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 12/17 (70%), Positives = 15/17 (88%)

Query: 117 PDYSAASLGTFSDCIFN 133
           PDY++AS G FSDCIF+
Sbjct: 73  PDYTSASTGKFSDCIFH 89

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 74/151 (49%), Gaps = 5/151 (3%)

Query: 381 LNINCNEL-NY----YQTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHL 435
           ++++C ++  Y    Y  HI   L   E  LK  L   ++  E D    ++   NL+  +
Sbjct: 234 IDVDCKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQEMDFTQNINHVSNLSKSV 293

Query: 436 QNMKNRIDELYDVINEKYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQ 495
             +   I+++     + YL K+  AFN          L T +++ + +L+ LE +    Q
Sbjct: 294 TQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTLMDSHVSRLQALEGKTVDFQ 353

Query: 496 LKLQEQRETMRQLDNLILIENSLLESKKNVK 526
            +L+ ++  +R+L+NLI + + + + K+N+K
Sbjct: 354 NELEAKKLQLRKLENLIKLNDMIGDFKRNMK 384

>Kwal_26.7063
          Length = 378

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/134 (19%), Positives = 65/134 (48%), Gaps = 1/134 (0%)

Query: 392 QTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDELYDVINE 451
           Q +  N L++F+  ++ +L   +  DE+ +  T ++ D+L  H++  K+ I ++   I +
Sbjct: 208 QQYFANELSKFDHYIR-DLMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQD 266

Query: 452 KYLSKIKTAFNXXXXXXXXXXLRTSVEASIKQLEELENRMEYCQLKLQEQRETMRQLDNL 511
           + +  ++ +F              ++    + L   E R+  C++ L  Q+ T+ +L+  
Sbjct: 267 QDIKMLRKSFESEDESSFISRFSAAIATYSESLASFEKRIGKCKVDLTTQKATVHKLETT 326

Query: 512 ILIENSLLESKKNV 525
           I +   + +S+ N+
Sbjct: 327 IKLNEMIQDSQSNM 340

>CAGL0J06996g complement(668088..671405) similar to sp|P32873
           Saccharomyces cerevisiae YPL115c BEM3 GTPase-activating
           protein for CDC42P and RHO1P, hypothetical start
          Length = 1105

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 12/85 (14%)

Query: 7   RIENPGTRT---TLLPSSFPNK--LQKKIDKSHEADLFSNNLKRKSAASKTRHLAPTK-- 59
           ++  PGT +   +++P S PN+  L +  +  HE +   +N +R+   S   H++P K  
Sbjct: 405 QMSTPGTSSIVSSIVPGSLPNETPLGRADNLRHEREYLPSNEQRQETPS---HISPQKPP 461

Query: 60  --SQNNIKLPILSINDEPILESEPS 82
             SQ  +++ + S+N +  L S PS
Sbjct: 462 ANSQQGLRVDLTSVNRDNSLRSNPS 486

>Kwal_14.1890
          Length = 473

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 12/93 (12%)

Query: 58  TKSQNNIKLPILSINDEPILESEPSRIGLASYFSQRH-NSEEGLSFKTSSRRKHLESQPL 116
           TK  +   +P+  +ND+P+L   P           RH N  EG S + S  R   +SQ +
Sbjct: 155 TKFSDASPVPVYEVNDKPML-PRPDE-------DHRHINRYEGASNELSHPRNGAKSQVM 206

Query: 117 PDYSAASLGT---FSDCIFNDALSKEPTLTNAK 146
           P+YS  S  T    S+  ++   +  PT+   K
Sbjct: 207 PNYSPESRRTEQLASNAPYDHRFAASPTIKPTK 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,766,369
Number of extensions: 663225
Number of successful extensions: 2537
Number of sequences better than 10.0: 48
Number of HSP's gapped: 2565
Number of HSP's successfully gapped: 56
Length of query: 559
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 452
Effective length of database: 12,891,983
Effective search space: 5827176316
Effective search space used: 5827176316
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)