Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_663.261567156782940.0
CAGL0F00671g1566157561650.0
YOR326W (MYO2)1574158261410.0
Kwal_26.70551555157654720.0
ADR354W1558158152210.0
KLLA0A03905g1550156850800.0
Sklu_2164.51350137647880.0
Scas_592.13*1419157235410.0
YAL029C (MYO4)1471152535370.0
CAGL0G06336g1418104028470.0
Scas_688.22187682312911e-149
ACR068W180581212501e-144
YHR023W (MYO1)1928108412351e-141
KLLA0E11572g1848105612261e-140
Kwal_23.5534190773112041e-137
KLLA0B12562g126071111291e-131
CAGL0J00693g188481111381e-128
Scas_721.119123271310941e-126
YMR109W (MYO5)121973810921e-126
Kwal_26.7587125074510831e-124
CAGL0K07590g125274310761e-123
CAGL0K03487g121774310721e-123
YKL129C (MYO3)127171210611e-121
AEL306C129274810311e-117
Sklu_2422.11920262990.002
Sklu_2418.61297199940.011
YBL047C (EDE1)1381155890.040
Kwal_56.242951154163870.062
ABR111C78972850.13
Scas_610.171305146820.29
CAGL0F04609g1311160771.2
KLLA0D12914g1494282761.4
Kwal_27.10895114109692.0
YJL070C888107742.3
YDL058W (USO1)1790183723.8
KLLA0D03883g491296714.4
Sklu_2432.71115147714.8
AFR670W71795715.2
Scas_683.381928147715.5
CAGL0H02805g1219125716.0
CAGL0J11660g744251697.7
Scas_592.322230687.7
CAGL0D05412g32269687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_663.26
         (1567 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_663.26                                                          3199   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  2379   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  2370   0.0  
Kwal_26.7055                                                         2112   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  2015   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  1961   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          1848   0.0  
Scas_592.13*                                                         1368   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1367   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1101   0.0  
Scas_688.22                                                           501   e-149
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   486   e-144
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   480   e-141
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   476   e-140
Kwal_23.5534                                                          468   e-137
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   439   e-131
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   442   e-128
Scas_721.119                                                          426   e-126
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   425   e-126
Kwal_26.7587                                                          421   e-124
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   419   e-123
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   417   e-123
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   413   e-121
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   401   e-117
Sklu_2422.11 YDL239C, Contig c2422 22194-24956 reverse complement      43   0.002
Sklu_2418.6 YBL047C, Contig c2418 10006-13899 reverse complement       41   0.011
YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein wit...    39   0.040
Kwal_56.24295                                                          38   0.062
ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH] (59...    37   0.13 
Scas_610.17                                                            36   0.29 
CAGL0F04609g 463702..467637 similar to sp|P34216 Saccharomyces c...    34   1.2  
KLLA0D12914g complement(1101471..1105955) weakly similar to sgd|...    34   1.4  
Kwal_27.10895                                                          31   2.0  
YJL070C (YJL070C) [2842] chr10 complement(307887..310553) Member...    33   2.3  
YDL058W (USO1) [807] chr4 (345665..351037) Coiled-coil protein w...    32   3.8  
KLLA0D03883g 328358..329833 weakly similar to sp|P32523 Saccharo...    32   4.4  
Sklu_2432.7 YNL243W, Contig c2432 14613-17960 reverse complement       32   4.8  
AFR670W [3863] [Homologous to ScYNL272C (SEC2) - SH] complement(...    32   5.2  
Scas_683.38                                                            32   5.5  
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...    32   6.0  
CAGL0J11660g 1133494..1135728 highly similar to sp|P04786 Saccha...    31   7.7  
Scas_592.3                                                             31   7.7  
CAGL0D05412g complement(516301..517269) similar to sp|P33759 Sac...    31   7.9  

>Scas_663.26
          Length = 1567

 Score = 3199 bits (8294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1545/1567 (98%), Positives = 1545/1567 (98%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60
            MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60

Query: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120
            PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY
Sbjct: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120

Query: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300
            DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM
Sbjct: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300

Query: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360
            NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS
Sbjct: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360

Query: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
            LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS
Sbjct: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420

Query: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 481  QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKL           WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 481  QHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600
            LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT
Sbjct: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600

Query: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660
            NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM
Sbjct: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660

Query: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720
            QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI
Sbjct: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720

Query: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780
            LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY
Sbjct: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780

Query: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840
            FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA
Sbjct: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840

Query: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900
            ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV
Sbjct: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900

Query: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960
            PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA
Sbjct: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960

Query: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020
            AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI
Sbjct: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020

Query: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080
            KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE
Sbjct: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080

Query: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV 1140
            ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV
Sbjct: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV 1140

Query: 1141 SVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSRR 1200
            SVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSRR
Sbjct: 1141 SVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSRR 1200

Query: 1201 DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANVR 1260
            DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANVR
Sbjct: 1201 DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANVR 1260

Query: 1261 ELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWXXXXXXX 1320
            ELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIW       
Sbjct: 1261 ELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWLKKLQKD 1320

Query: 1321 XXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIEN 1380
                AINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIEN
Sbjct: 1321 LQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIEN 1380

Query: 1381 EVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYL 1440
            EVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYL
Sbjct: 1381 EVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYL 1440

Query: 1441 QHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVA 1500
            QHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVA
Sbjct: 1441 QHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVA 1500

Query: 1501 DIVKKESTSAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVLPVTKRIVDLVAQ 1560
            DIVKKESTSAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVLPVTKRIVDLVAQ
Sbjct: 1501 DIVKKESTSAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVLPVTKRIVDLVAQ 1560

Query: 1561 QVTVPDA 1567
            QVTVPDA
Sbjct: 1561 QVTVPDA 1567

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 2379 bits (6165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1162/1575 (73%), Positives = 1332/1575 (84%), Gaps = 18/1575 (1%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60
            MSFEVGTRCWYPSKE GWIGAEVTKNDLKDGTY MEL LED + VN+ETKDLT+E D SL
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKSVNIETKDLTDESDESL 60

Query: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAY+GK+RGE+EPHLFAIAEEAYRLMK++K+NQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FAS +EENS     +QH  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASVEEENSMT---VQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300
            DK+T+IIGAK+RTYLLERSRLVYQP+TERNYHIFYQ++AGL    K ELHL  A+DY+YM
Sbjct: 238  DKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYM 297

Query: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360
            NQGG+ +I G+DD  EY  T+ ALTLVG++ ETQQHIFKILAALLHIGNIEIKKTRND+S
Sbjct: 298  NQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDAS 357

Query: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
            LSSDE NLKIACELLG+D  NFAKWITKKQI+TRSEKIVSNLNYSQALVARDSVAKFIYS
Sbjct: 358  LSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYS 417

Query: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV NINTVLCNPAV+D++ SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKL           WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600
            LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKA+T
Sbjct: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660
            N+TL  IL+++E +A K+E+AKK  A Q+ K   KP P+R VQRKPTLGSMFK SLIELM
Sbjct: 598  NETLINILDTLERNANKLEDAKK--AEQESKP-AKPGPMRTVQRKPTLGSMFKQSLIELM 654

Query: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720
             TI STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI
Sbjct: 655  TTIRSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 714

Query: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780
            LRYYIL+P  EW+ IF K D+TE DVI LC KILA TV++KEKYQIGNTKIFFKAGMLA+
Sbjct: 715  LRYYILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAF 774

Query: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840
             EKLRS KM+ + VLIQK+IR+KYYR++++ + ++++ L    KG V R  ++ E +  A
Sbjct: 775  LEKLRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKA 834

Query: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900
            AT IQ++ RGY +RS I  +ISSI  +Q ++R+EL ++  Q ++E++AA++IQS++R+F 
Sbjct: 835  ATEIQSLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFK 894

Query: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960
            PRKA+   RR T+VVQSLIRRR AQ+  K+LKADAKSV+HLKEVSYKLENKV++LTQNLA
Sbjct: 895  PRKAFLEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLA 954

Query: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020
            AKVKEN+ LS R+ ELQ ++   + LQ++L+  K ++   L +QKD F    K ++++L 
Sbjct: 955  AKVKENKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELN 1014

Query: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080
             AN  VE  K +L  LT +Y E +A +K+ L+ELE+TK  L E +T NSDL +E+ SLKE
Sbjct: 1015 AANLQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKE 1074

Query: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV 1140
            EL+ LQT I+LGTVT   N++P TPS++  M          +I P    ++    + D  
Sbjct: 1075 ELSRLQTQISLGTVT--ANVLPQTPSKDIHMQRNVTNGT--DIGPGSELNVRPVNSKDAG 1130

Query: 1141 SVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSRR 1200
            SV+  GMD    ++N LTQINEEL+RLLE  +VLNNEIT+GLLK F+VP AGV +QLSRR
Sbjct: 1131 SVSNMGMDSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRR 1190

Query: 1201 DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANVR 1260
            DVVYPARILII+LSEMWRFGLTKQSE FLAQVLTTIQKVVTTLKG DLIP+GAFWLANVR
Sbjct: 1191 DVVYPARILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVR 1250

Query: 1261 ELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWXXXXXXX 1320
            ELYSFVVFAQHSILTEESFK GM D+EY EYVSLVTELKEDFESLSYNIYNIW       
Sbjct: 1251 ELYSFVVFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRE 1310

Query: 1321 XXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIEN 1380
                A+NAVV+SE+LPGF+A +S G LNKIF+SGEEYTMDDILTFFN+I+W MKSF IEN
Sbjct: 1311 LQKKAVNAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIEN 1370

Query: 1381 EVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYL 1440
            EVF  V+ TLLNYVD ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHG+PDG   L
Sbjct: 1371 EVFHKVVTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCL 1430

Query: 1441 QHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVA 1500
            QHLIQT+KLLQ+RKY+IEDID++RGICSSL+PAQLQKLI+QY VADYESPIPQ+ILKYVA
Sbjct: 1431 QHLIQTSKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVA 1490

Query: 1501 DIVKKEST--------SAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVLPVTK 1552
            DIVK E++        +  NDIF+ PETGPFNDPF  ++T KFDQVEAYIP+WLVLP TK
Sbjct: 1491 DIVKSEASLSASSKAPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPAWLVLPTTK 1550

Query: 1553 RIVDLVAQQVTVPDA 1567
            RIV+LVAQQV+V ++
Sbjct: 1551 RIVELVAQQVSVQES 1565

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 2370 bits (6141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1155/1582 (73%), Positives = 1330/1582 (84%), Gaps = 33/1582 (2%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60
            MSFEVGTRCWYP KE GWIGAEV KN+  DG Y +EL LED+E+V+V+TKDL N+KD SL
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSL 60

Query: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            +QDMIQAY+GKRRGE+EPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  TQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FAS +EENS+ +   QH  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASVEEENSATV---QHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300
            DK+T+IIGA++RTYLLERSRLVYQP  ERNYHIFYQ++AGLP   K+ELHLT A DYFYM
Sbjct: 238  DKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYM 297

Query: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360
            NQGG+ +I GIDD  EY IT+ ALTLVG+  ETQ  IFKILAALLHIGNIEIKKTRND+S
Sbjct: 298  NQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDAS 357

Query: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
            LS+DEPNLK+ACELLG+D  NFAKW+TKKQI+TRSEKIVSNLNYSQALVA+DSVAKFIYS
Sbjct: 358  LSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYS 417

Query: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV NINTVLCNPAV DQI SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKL           WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600
            LYQTLDK PTNKVFSKPRFGQTKF+VSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKA+T
Sbjct: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660
            N+TL  ILE +E++A+K+EEAKK     +Q   KKP PIR V RKPTLGSMFK SLIELM
Sbjct: 598  NETLINILEGLEKAAKKLEEAKK--LELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELM 655

Query: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720
             TINSTNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF EF+
Sbjct: 656  NTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFV 715

Query: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780
            LRYYILIP  +W  IF+K + TE+D+I++ K IL ATV+DK KYQIGNTKIFFKAGMLAY
Sbjct: 716  LRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAY 775

Query: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840
             EKLRS KM+++IV+IQK IR+KYYRKQY+ +  ++  L    KG +IRQRV  E++ + 
Sbjct: 776  LEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNC 835

Query: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900
            ATL+Q  YRG+S R+ +  V+ +I  LQ +IR+EL+QR+++ ++E NAA++IQS++R F 
Sbjct: 836  ATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFE 895

Query: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960
            PR  +   ++DT+VVQSLIRRR AQR  K+LKADAKSV+HLKEVSYKLENKVI+LTQNLA
Sbjct: 896  PRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLA 955

Query: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020
            +KVKEN+++++R++ELQ  +   ++LQ+ LE  K E+   + +QK   +   K++++ L 
Sbjct: 956  SKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIENNLQ 1015

Query: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080
               + ++  + EL  +  ++ E++ ESK QL+ELE+TK  L E +T N DL +E+KSLKE
Sbjct: 1016 STEQTLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKE 1075

Query: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSG-----HMRAAEENISPNQL----KSI 1131
            E+A LQT+++LGTVT  T+++P TP ++  M  G     +M     ++SPN L    +S 
Sbjct: 1076 EIARLQTAMSLGTVT--TSVLPQTPLKD-VMGGGASNFNNMMLENSDLSPNDLNLKSRST 1132

Query: 1132 PSDTAADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDA 1191
            PS +  +H+      +  D  N    TQINEELYRLLE T++LN EITEGLLKGF+VPDA
Sbjct: 1133 PS-SGNNHID----SLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDA 1187

Query: 1192 GVAIQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPS 1251
            GVAIQLS+RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVT LKG DLIPS
Sbjct: 1188 GVAIQLSKRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPS 1247

Query: 1252 GAFWLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYN 1311
            G FWLANVRELYSFVVFA +SILTEE+FK GM DEEY EYVSLVTELK+DFE+LSYNIYN
Sbjct: 1248 GVFWLANVRELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYN 1307

Query: 1312 IWXXXXXXXXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFW 1371
            IW           AINAVV+SESLPGF+A E++GFLNKIF + EEYTMDDILTFFN+I+W
Sbjct: 1308 IWLKKLQKQLQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYW 1367

Query: 1372 CMKSFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTH 1431
            CMKSFHIENEVF  V+ TLLNYVD ICFN+LIMKRNFLSWKRGLQLNYNVTRLEEWCKTH
Sbjct: 1368 CMKSFHIENEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTH 1427

Query: 1432 GLPDGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPI 1491
            GL DG + LQHLIQTAKLLQ+RKYTIEDID++RGIC SL+PAQLQKLISQY VADYESPI
Sbjct: 1428 GLTDGTECLQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPI 1487

Query: 1492 PQDILKYVADIVKKES--TSAHND---------IFLHPETGPFNDPFVAVKTRKFDQVEA 1540
            PQ+IL+YVADIVKKE+  +S+ ND         IF+ PETGPF DPF  +KTRKFDQVEA
Sbjct: 1488 PQEILRYVADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVEA 1547

Query: 1541 YIPSWLVLPVTKRIVDLVAQQV 1562
            YIP+WL LP TKRIVDLVAQQV
Sbjct: 1548 YIPAWLSLPSTKRIVDLVAQQV 1569

>Kwal_26.7055
          Length = 1555

 Score = 2112 bits (5472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1024/1576 (64%), Positives = 1268/1576 (80%), Gaps = 40/1576 (2%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTK-NDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPS 59
            MSFEVGTRCWYP K++GW+G+EVTK +  ++G + +EL LE+ E V +ET+ L   ++  
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 60   LPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQL 119
            LPLLRNPPILE+ EDLT+LSYLNEPAVLHAIK RY QLNIYTYSGIVLIATNPFDR++QL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 120  YSQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179
            YSQDMIQAY+G+RRGE+EPHLFAIA+EAYRLMK+DKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239
            YFAS ++ N+ N  +  H  +MSETEERILATNPIMEAFGNAKT+RNDNSSRFGKYLEIL
Sbjct: 181  YFASVEQANADNASS-DHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239

Query: 240  FDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFY 299
            FD+ T+IIGA++RTYLLERSRLV+QP+ ERNYHIFYQ++ GL E  K+ELHLTK +DY Y
Sbjct: 240  FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHY 299

Query: 300  MNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDS 359
            + QGG+  I G+DD +EY +T+ AL +VG + +TQ  +FKILAALLHIGNIE+KKTRND+
Sbjct: 300  LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDA 359

Query: 360  SLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIY 419
            SLSSDEPNLKIAC+LLG+D S F+KWITKKQI TRSEKIVSNL+++QALVARDSVAKFI+
Sbjct: 360  SLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIF 419

Query: 420  SALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479
            SALFDWLV NINTVLCNP V DQI SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF
Sbjct: 420  SALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479

Query: 480  NQHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ 539
            NQHVFKL           WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ
Sbjct: 480  NQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ 539

Query: 540  KLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAT 599
            KLYQTLDKPPTN VFSKPRFGQTKFVVSHYALDVAYDV GFIEKNRDTVSDGHLEVLKA+
Sbjct: 540  KLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKAS 599

Query: 600  TNDTLSTILESVEESARKVEEAKKNAASQDQKQ--LKKPTPIRQVQRKPTLGSMFKLSLI 657
             NDTL +IL++++          KNAA+  +KQ   KKP P R V +KPTLGSMFK SLI
Sbjct: 600  KNDTLLSILDTID----------KNAAALAEKQDANKKPGPARMV-KKPTLGSMFKQSLI 648

Query: 658  ELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFN 717
            ELM TI+STNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+N
Sbjct: 649  ELMNTIDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYN 708

Query: 718  EFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGM 777
            EF+LRY+ILIP   W  IF  ++ +E D+ NLCK+IL ATV D  KYQ+GNTKIFFKAGM
Sbjct: 709  EFVLRYHILIPSDNWTKIF-TSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGM 767

Query: 778  LAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELE 837
            LAY EKLRSTKM+++ VLIQK I+  YYRKQY+ +K ++  + A   G   RQ V++E +
Sbjct: 768  LAYLEKLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFK 827

Query: 838  QHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIR 897
              AA  +QT++RG  +R   +  ++SIV++QS +R+++ Q+E+  K +S AA++IQ +IR
Sbjct: 828  TLAAISLQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIR 887

Query: 898  AFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQ 957
             FVPR++Y + R  ++ +QSL+RR++AQ+  K+LKADAKSV+HL+EVSYKLENKVIQLTQ
Sbjct: 888  GFVPRQSYNATRGSSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQ 947

Query: 958  NLAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKD 1017
            +LA KVKENR ++ ++++LQ ++   + ++  L+AQK ++ + L +QK     +  + K 
Sbjct: 948  SLAEKVKENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKI 1007

Query: 1018 QLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKS 1077
            +L  A  +VE+ K E+  L ++  +++A+ + +++EL   +    +S+TQNSDL +E+KS
Sbjct: 1008 ELDNAKAEVEAAKKEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKS 1067

Query: 1078 LKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAA 1137
            LK+E+  LQTSI  G   +NT I+ HTP++  R  S H  ++  + SP QL  I      
Sbjct: 1068 LKDEINRLQTSIRSG-ANSNT-ILAHTPTKSRRF-SAH--SSLTDASPRQLNVI------ 1116

Query: 1138 DHVSVNGYGMDDDIINT-NTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQ 1196
               S+N  GM+DD  +T + L+QIN+ELY++LE T  LN EI EGLLKGF++P+ GVA +
Sbjct: 1117 ---SMNN-GMEDDARSTASALSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAE 1172

Query: 1197 LSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWL 1256
            L+R++V+YPARI+IIVLS+MWR GLTKQSESFLA+ ++TIQK+V+ LKG D+I  GAFWL
Sbjct: 1173 LTRKEVLYPARIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWL 1232

Query: 1257 ANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWXXX 1316
             NVRELYSFVVFAQ SIL ++S+  G+N++EY EY++LVTELK+DFESLSYNIYNIW   
Sbjct: 1233 TNVRELYSFVVFAQESILNDDSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKK 1292

Query: 1317 XXXXXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSF 1376
                    A++AVV+S+SLPGF A+ES+ FL K+F+    Y MDDILTFFNNI+W MK++
Sbjct: 1293 LQKDLEKKAVSAVVMSQSLPGFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTY 1352

Query: 1377 HIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDG 1436
            H+E EVFR VIITLL YVD+ICFNDLIM+RNFLSWKRGLQLNYNVTRLEEWCK+H +P+G
Sbjct: 1353 HVEQEVFREVIITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEG 1412

Query: 1437 AQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDIL 1496
               LQH++Q +KLLQL+K  ++DID++  ICSSL PAQ+QKLI+QY VADYE PIPQ+IL
Sbjct: 1413 TDCLQHMLQASKLLQLKKANLDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEIL 1472

Query: 1497 KYVADIVKKESTSAHN--------DIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVL 1548
             +VA+ VK ES+ + N        DIFL  E GPF DPF  ++TR+F ++EAYIP+W+ L
Sbjct: 1473 TFVANRVKSESSLSSNGKSQTHSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532

Query: 1549 PVTKRIVDLVAQQVTV 1564
            P+T+R+V+LV Q VTV
Sbjct: 1533 PLTRRVVELVTQHVTV 1548

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 2015 bits (5221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 979/1581 (61%), Positives = 1224/1581 (77%), Gaps = 43/1581 (2%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60
            MS+EVGTRCWYP KEQGWIG E+TK+ L    Y ++LTLE+ EVV +    +       L
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKHRLVGDKYQLDLTLENGEVVEITAPSVEEGSCEEL 60

Query: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAY+G+RRGE+EPHLFAIAEEAY LMKN KQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FA+ ++ N    G   H  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240

Query: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300
            DK+ +IIGA++RTYLLERSRLV+QP +ERNYHIFYQ+LAGLPE+ K+EL L   ++Y YM
Sbjct: 241  DKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHYM 300

Query: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360
            NQGG  EI G+DD  EY IT KAL+LV +   TQ  +FK+LAALLHIGNI++KKTRND+S
Sbjct: 301  NQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDAS 360

Query: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
            +S+ +P+L+IACELLG+D  NFAKWITKKQI TRSEKIVSNLNY QA+VARDSVAKFIYS
Sbjct: 361  VSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIYS 420

Query: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV NIN VLCNPAV+++I SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 481  QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKL           WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 481  QHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 540

Query: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYA DVAYDVEGFIEKNRDTVSDGHLEVLK +T
Sbjct: 541  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGST 600

Query: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTP-IRQVQRKPTLGSMFKLSLIEL 659
            N+TL  ILE+++ +A K+ E  ++         KKP P  R V RKPTLGS+FK SL+EL
Sbjct: 601  NETLLAILETIDRNAAKLAEKLESQ--------KKPGPTTRTVNRKPTLGSLFKQSLVEL 652

Query: 660  MQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 719
            M TINSTNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWT++EF
Sbjct: 653  MSTINSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEF 712

Query: 720  ILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLA 779
             LRY+IL+P   W  IF     TE+++  LCK IL  TV DKEKYQ+GNTKIFFKAGMLA
Sbjct: 713  ALRYHILVPSTNWTKIFATGT-TEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLA 771

Query: 780  YFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQH 839
            + EK R+ K+NS+  +IQK I+  YYR++Y+ +  ++    + +KG ++R R++ E +  
Sbjct: 772  FLEKKRTDKLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTW 831

Query: 840  AATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAF 899
            AA  IQ++YRG   R     ++ SI++ QS +R  L ++E++++ E++AAI+IQ  IRAF
Sbjct: 832  AAITIQSLYRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAF 891

Query: 900  VPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNL 959
             PR +Y + RR TIVVQSL+RRR A+R  + LK +AKSV HLKEVSYKLENKVI+LT++L
Sbjct: 892  KPRTSYITNRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESL 951

Query: 960  AAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQL 1019
            AAKVKEN+ L+ R++ELQ ++   + +++ L+ ++ E +K++  QKD      + +  +L
Sbjct: 952  AAKVKENKDLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRL 1011

Query: 1020 IKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLK 1079
              A K+V+  + E+  L +K  +++ E K +++EL + +  L++S+TQNSDL +E+ SLK
Sbjct: 1012 TLAMKEVDDARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLK 1071

Query: 1080 EELAHLQTSI----ALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDT 1135
            EE+A L  +I    A GT+         +P+R  R+ S            + L +I S  
Sbjct: 1072 EEIARLHNAIRNAPATGTL---------SPTRSKRISSY-----------SGLDNIGSPK 1111

Query: 1136 AADHVSVNGYGMDDDIIN-TNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVA 1194
              + VS+N   M+++  +  + L+QIN+ELY+LL     L +EI EGLLK  ++P  G A
Sbjct: 1112 QWNVVSLNNGLMEEETRSIMSQLSQINDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFA 1171

Query: 1195 IQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAF 1254
              L+R++V+YPAR+LII+LS+MWR GLT+QSE FLA+VL+TIQ +VT LKG ++I +GAF
Sbjct: 1172 ANLTRKEVLYPARVLIIILSDMWRLGLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAF 1231

Query: 1255 WLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWX 1314
            WL NVRELYSF ++A  SIL + ++ K +N++EY +YV+LV+ LK+DFESLSYNIYNIW 
Sbjct: 1232 WLTNVRELYSFAIYAHDSILNDNAYIKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWL 1291

Query: 1315 XXXXXXXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMK 1374
                      A++AVV+S+SLPGF   ES+ FL KIF+S   Y MDDILTFFN I+W MK
Sbjct: 1292 KKLQKELEKRAVSAVVMSQSLPGFIVPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMK 1351

Query: 1375 SFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLP 1434
            ++H+E EV+R VI++LL YVD ICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCK H +P
Sbjct: 1352 AYHVETEVYREVIMSLLRYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIP 1411

Query: 1435 DGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQD 1494
            +G+  L+H++Q +KLLQL+K  +EDI+++  ICSSL PAQ+QKLISQY  ADYE PIPQ+
Sbjct: 1412 EGSDCLEHMLQASKLLQLKKANMEDINIIWEICSSLKPAQIQKLISQYSAADYEVPIPQE 1471

Query: 1495 ILKYVADIVKKE--------STSAHNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWL 1546
            IL +VAD VKKE        S S  +DIFL   TG F DPF  ++ R+ +++EA+IP+WL
Sbjct: 1472 ILSFVADRVKKESALSNDGKSASHSSDIFLPVATGSFADPFSQIEPREINKIEAHIPAWL 1531

Query: 1547 VLPVTKRIVDLVAQQVTVPDA 1567
             LP+++R+V+L+ + V+  ++
Sbjct: 1532 NLPISRRVVELITENVSAQES 1552

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 1961 bits (5080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 964/1568 (61%), Positives = 1211/1568 (77%), Gaps = 27/1568 (1%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60
            M +EVGTRCWYPSK+QGWIGAEVTK+ L+  +Y +ELTLED + V +    L   K+PSL
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQKVELLVSSLDETKEPSL 60

Query: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDR+DQLY
Sbjct: 61   PLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQLY 120

Query: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQ+MIQAY+GK RGE+EPHLFAIAEEAYRLMK   QNQTI+VSGESGAGKTVSAKYIMRY
Sbjct: 121  SQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMRY 180

Query: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FAS +E N  N     H  EMSETE++ILATNPIMEAFGNAKT RNDNSSRFGKYLEILF
Sbjct: 181  FASVEENNEENA---HHNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILF 237

Query: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300
            D +T+IIGA++RTYLLERSRLV+QPKTERNYHIFYQIL+GL +D K +L LT   DY YM
Sbjct: 238  DDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYM 297

Query: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360
            NQGG+  I G+DD SEYG T++AL+LVG++ +TQ  +FKILAALLHIGNIE+KK RND+S
Sbjct: 298  NQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDAS 357

Query: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
            LSSDEPNL+IA +LLG+D  +FAKW+TKKQIVTRSEKIVS+L Y QA+V+RDSVAKFIYS
Sbjct: 358  LSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYS 417

Query: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV NINTVLCNP V+ +I++FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKL           WSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT K
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537

Query: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600
            LY+TL+KPPTN+VFSKPRFGQT+F+VSHYALDV YDV+GFIEKNRDTVSDGHLEVLKA+ 
Sbjct: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597

Query: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPI-RQVQRKPTLGSMFKLSLIEL 659
            N+TL +ILE+V+++A K+ E +    +Q Q+  KKP P  R++ RKPTLGSMFK SLI+L
Sbjct: 598  NETLLSILETVDKNAEKLAEKQ----AQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDL 653

Query: 660  MQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEF 719
            M+TINSTNVHYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EF
Sbjct: 654  METINSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEF 713

Query: 720  ILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLA 779
             LRY+IL+P   W+ I   +D +E+DV NLCK+IL  T+ D  KYQ GNTKIFFKAGMLA
Sbjct: 714  ALRYHILVPSELWSNILL-SDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLA 772

Query: 780  YFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQH 839
            + EKLR+ K+ S+ V+IQK I+  +YRK Y+    ++  L A   G +IR R E E + +
Sbjct: 773  HLEKLRTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNN 832

Query: 840  AATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAF 899
            AA LIQ+ YRG S R  +S +I SI+++QS  R+++  +E+  +   +AA++IQ  +R+F
Sbjct: 833  AALLIQSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSF 892

Query: 900  VPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNL 959
             PRK++  +++ T+V+QS IR+  AQR  K+LK++AKSV+HL+EVSYKLENKVI+LT++L
Sbjct: 893  QPRKSFLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESL 952

Query: 960  AAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQL 1019
            A+KVKEN++L  RLE LQ ++     ++  LE +K  + KALADQK     +   + DQL
Sbjct: 953  ASKVKENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQL 1012

Query: 1020 IKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLK 1079
            I A +++ S K E+  L  K   ++ E  + L+EL   +  L  S+++N+DL  E+ SLK
Sbjct: 1013 IAAKEEIISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLK 1072

Query: 1080 EELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADH 1139
            EE+A LQ+S+  G        +  TP +  R  +       +  SP QL         + 
Sbjct: 1073 EEVARLQSSMRSGVYVGGG--INATPVKNRRFSAN--STLNDGSSPKQL---------NV 1119

Query: 1140 VSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSR 1199
            VS+N     +D+  +  ++QIN+ELY++ E +  LN EI EGLLKG +VP  GV++ L+R
Sbjct: 1120 VSINNNFNTEDV--SALMSQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTR 1177

Query: 1200 RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANV 1259
            ++V+YP+R+LII+LS+MWR GLT QSE+FLA+VL  IQK+++ LK   +I  GAFW  NV
Sbjct: 1178 KEVLYPSRVLIIILSDMWRLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNV 1237

Query: 1260 RELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWXXXXXX 1319
            REL+SFVV+A  SI T+E++  GMN+EEYN YV+LV ELK+DFE+LS+N+YN+W      
Sbjct: 1238 RELHSFVVYAYESITTDETYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRK 1297

Query: 1320 XXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSFHIE 1379
                 A+ AVVVS+SLPGF   E + FL K   +   Y MDD+LTFFNNI+W MKS+ IE
Sbjct: 1298 NLEKIAVPAVVVSQSLPGFVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIE 1357

Query: 1380 NEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQY 1439
             EVF  VI  LL  +D +CFNDLI+++NFLSWKRGLQLNYNVTR+EEWCK+H + + +  
Sbjct: 1358 MEVFEDVITNLLKLLDALCFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVC 1417

Query: 1440 LQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYV 1499
            LQH++Q AKLLQL+K  + DID++  IC+ L P QL++LI+QY VADYE PI  +IL+YV
Sbjct: 1418 LQHILQAAKLLQLKKRIVADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYV 1477

Query: 1500 ADIVKKESTSA---HNDIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVLPVTKRIVD 1556
            A+ VK +++ A   +ND+FL  + GPF DP+  V+ R F ++EAYIP+WL LP+T+RIV+
Sbjct: 1478 AEKVKNDTSKAEVGNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAWLNLPITRRIVE 1537

Query: 1557 LVAQQVTV 1564
            LV Q V V
Sbjct: 1538 LVTQFVAV 1545

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 1848 bits (4788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/1376 (65%), Positives = 1107/1376 (80%), Gaps = 27/1376 (1%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSL 60
            MS+EVGTRCWYP K+QGWIG E+TK+      + +ELTLEDN++V +E++ L   KD  L
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTNLSNKHQLELTLEDNQIVEIESETLDETKDDRL 60

Query: 61   PLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLY 120
            PLLRNPPILE+TEDLT+LSYLNEPAVLHAIK RY+QLNIYTYSGIVLIATNPFDR++QLY
Sbjct: 61   PLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQLY 120

Query: 121  SQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180
            SQDMIQAY+GKRRGE+EPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY
Sbjct: 121  SQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRY 180

Query: 181  FASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 240
            FAS ++ N  N     H  EMSETE++ILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF
Sbjct: 181  FASVEQNNEENA---HHNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYM 300
            DKE +IIGA++RTYLLERSRLV+QPK+ERNYHIFYQ+LAGL  + K +L LT  +DY YM
Sbjct: 238  DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYM 297

Query: 301  NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSS 360
            NQGGE +I GIDD  EY  T++AL+LVG++ +TQ  +FKILAALLHIGN+EIKKTRND+S
Sbjct: 298  NQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDAS 357

Query: 361  LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
            LSSDEPNL IACELLG+D  NFAKWITKKQI TRSEKIVSNLNY+QALVARDSVAKFIYS
Sbjct: 358  LSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYS 417

Query: 421  ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALF+WLV NINTVLCNP V  +I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKL           WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 537

Query: 541  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATT 600
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYALDV+YDVEGFIEKNRDTVSDGHLEVLKA+T
Sbjct: 538  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELM 660
            N+TL +ILE++++ A K+ E ++          KKP P R V RKPTLGS+FK SLIELM
Sbjct: 598  NETLLSILETLDKHAAKLAEKEQVN--------KKPGPARMVNRKPTLGSIFKQSLIELM 649

Query: 661  QTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFI 720
             TINSTNVHYIRCIKPN  KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWT+NEF+
Sbjct: 650  GTINSTNVHYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFV 709

Query: 721  LRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGMLAY 780
            LRY+ILIP   W+ +F  +D TE+D+ +LC+ IL A V+DK+KYQ+GNTKIFFKAGMLAY
Sbjct: 710  LRYHILIPSEHWSKMFS-SDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAY 768

Query: 781  FEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELEQHA 840
             EKLRS +++++ VLIQK +++ YYRK+Y+ + +S+    + S+G + RQ+V+ E +  A
Sbjct: 769  LEKLRSDRLHNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQA 828

Query: 841  ATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFV 900
            A LIQ+M R  S R+    ++S+I +LQS +R++L Q+E+  + + +AA+SIQ +IRAF 
Sbjct: 829  AILIQSMVRSTSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFE 888

Query: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960
            PR+++ + RR T+VVQSL+R++ AQ+  K LK +AKSV+HLKEVSYKLENKVIQLT++LA
Sbjct: 889  PRQSFNTTRRSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLA 948

Query: 961  AKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLI 1020
             KVKEN+ ++ R++ELQ ++   + +++ L +QK E+ K L  QKD   +    ++++L+
Sbjct: 949  EKVKENKGMTARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLV 1008

Query: 1021 KANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKE 1080
             A K+VE  K E+  L AK  E++AE + +++EL + K   TE +TQNSDL +E+KSLK+
Sbjct: 1009 NAKKEVEEAKEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKD 1068

Query: 1081 ELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAADHV 1140
            E+A LQ ++  G  ++       +    +R  S H   A +  SP QL  I         
Sbjct: 1069 EIARLQAAVRSGVTSSTI----TSTPTASRRFSAHSSVA-DGTSPRQLNVI--------- 1114

Query: 1141 SVNGYGMDDDIINT-NTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQLSR 1199
            S+N  G++DD  +T + L+QIN+ELY+LLE T  LN EI EGLLKGF++P+ GVA++L+R
Sbjct: 1115 SMNNGGIEDDARSTASALSQINDELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTR 1174

Query: 1200 RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWLANV 1259
            ++V+YPARILIIVLS+MWR GLTKQSESFLA+VL+TIQK+VT LKG D+I  GAFWL NV
Sbjct: 1175 KEVLYPARILIIVLSDMWRLGLTKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNV 1234

Query: 1260 RELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWXXXXXX 1319
            RELYSFVVFAQ SIL ++S+  G+N++EY EYV+LVTELK+DFESLSYNIYNIW      
Sbjct: 1235 RELYSFVVFAQESILNDDSYNNGLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQK 1294

Query: 1320 XXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKS 1375
                 AI+AVV+S+SLPGF A ES+ FL K+F+    Y MDDI+TFFNNI+W  ++
Sbjct: 1295 DLERKAISAVVMSQSLPGFIAPESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350

>Scas_592.13*
          Length = 1419

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 735/1572 (46%), Positives = 983/1572 (62%), Gaps = 166/1572 (10%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPS- 59
            MSFEVGTRCWYP+ E GWIG EVTKND +DGTY +ELT E   V+ +ETK L +      
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTKNDFQDGTYHIELTSETGLVIPIETKHLESNNAMEN 60

Query: 60   ----LPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDR 115
                LP+LRNPPILE+T DLTTLSYLNEPAVLHAIK+RY+Q NIYTYSGIVLIATNPFD+
Sbjct: 61   NHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFDK 120

Query: 116  MDQLYSQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAK 175
            +++LYS +MIQAY+ K R E+ PH+FAIAEEAYR M N+ QNQTI+VSGESGAGKTVSAK
Sbjct: 121  VEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSAK 180

Query: 176  YIMRYFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKY 235
            YIMR+FAS +EE+ +  G+ +H  EMS+ E +ILATNP+MEAFGNAKTTRNDNSSRFGKY
Sbjct: 181  YIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGKY 240

Query: 236  LEILFDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKAD 295
            L+ILFD    IIG+ ++TYLLERSRLV+QP +ERNYHIFYQ+L+GL  D+K++L+LT A+
Sbjct: 241  LQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNAE 300

Query: 296  DYFYMNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKT 355
            D+FY+NQGGE  I GIDD  EY  TI++L+ VG+  E Q  IFKILAALLHIGNIEIKKT
Sbjct: 301  DFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKKT 360

Query: 356  RNDSSLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVA 415
            R D++LSS +P+L+ ACELLG+DP  F+KWITKKQI TRSEKI+SNL+++QALVARDSVA
Sbjct: 361  RTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSVA 420

Query: 416  KFIYSALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKL 475
            KFIYS+LFDWLV NIN VLC   V + I+SFIGVLDIYGFEHFE+NSFEQFCINYANEKL
Sbjct: 421  KFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEKL 480

Query: 476  QQEFNQHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE 535
            QQEFN HVFKL           WSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSDE
Sbjct: 481  QQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSDE 540

Query: 536  SWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEV 595
            SWT KLYQT +KPP+N VF KPRFGQ KF++SHYA+DV Y+V+GFIEKN+DT+S+  LEV
Sbjct: 541  SWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLEV 600

Query: 596  LKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLS 655
            LKATTN TL+TI E  E       E K N   Q     +K      + RKPTLGS+FK S
Sbjct: 601  LKATTNPTLATIFEFSE------AENKTNITEQAGTIQRKT-----INRKPTLGSIFKRS 649

Query: 656  LIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT 715
            L+ELM+TINSTNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW 
Sbjct: 650  LVELMETINSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWA 709

Query: 716  FNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKA 775
            F EFI RYY+L P  +W  +    +++ +D++  C  IL+  +  K+KYQIG TKIFFKA
Sbjct: 710  FEEFIQRYYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKA 769

Query: 776  GMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYE 835
            G+LAY EK+RS K+    VLIQKHIR+KYYR  Y+    S+    +  +G   RQRV++E
Sbjct: 770  GVLAYLEKIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFE 829

Query: 836  LEQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSR 895
            ++  AATL+QT++R    RS +   + +I+++Q+ IR  L    +Q ++ES +AI IQS+
Sbjct: 830  MKTDAATLLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSK 889

Query: 896  IRAFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQL 955
            IRA  P+  Y++ +  TI++Q+L+RR+ +Q   K+LK  A+S   LK  +  ++ ++I  
Sbjct: 890  IRANSPKHRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGF 949

Query: 956  TQNLAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSL 1015
             + L + +KEN                        +A+  E +  L       V  +   
Sbjct: 950  IEELISNIKEN------------------------DAKTTEYKSLLKHTSLPVVTGTNER 985

Query: 1016 KDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEI 1075
                I     VE  K  + T+  KY  ++   + +L  LE  +  + + K  +S      
Sbjct: 986  TAAYISTKNQVEEDKVTIRTILTKYETLKDLCRKELKSLESLEKGVNDEKFASS------ 1039

Query: 1076 KSLKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDT 1135
                     LQ+S+ L                            + +IS  ++ +I  D 
Sbjct: 1040 ---------LQSSLEL---------------------------IKRDISDLRINAIEKDN 1063

Query: 1136 AADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAI 1195
              +  S +    D      N + QI      L +    L N++   +   FQ+P  G   
Sbjct: 1064 --ERTSTSSELKDGTDCTDNAVVQI------LTKRQGDLINDLVNVVFLEFQIPQRGRTK 1115

Query: 1196 QLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFW 1255
                    YP ++LI +++ M +FGL K S S L Q +  +   ++++     +  G +W
Sbjct: 1116 DCEH---FYPVKLLISIVNLMNKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYW 1172

Query: 1256 LANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWXX 1315
            + ++ +L         S+  E +    + D+ Y       T LK+ F  +          
Sbjct: 1173 IISLHKL--------SSLPQEPAVLNKLQDKFYK------TWLKQCFNQMK--------- 1209

Query: 1316 XXXXXXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKS 1375
                      ++++++                  +F++  E+T+     FF         
Sbjct: 1210 ---------TVDSILI------------------LFDTISEFTL-----FFQGT------ 1231

Query: 1376 FHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPD 1435
                 E+   +I  LL +++   FNDL++K+N LSW  GL+ +  + ++ +WC +H + +
Sbjct: 1232 ----TELLTNIITALLQHINAKWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRN 1287

Query: 1436 GAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDI 1495
              +YL+++ Q  KLLQLR   I D  +V   C  LS  Q+  L+++Y    +E PIP D+
Sbjct: 1288 STEYLRNVNQACKLLQLRISNISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDV 1347

Query: 1496 LKYVADIVKKESTSAHNDIFLHPETGPFN-------DPFVAVKTR-KFDQVEAYIPSWLV 1547
            L ++++  ++E T+   ++ L   T  ++        P  A       +Q+   +PS   
Sbjct: 1348 LNHLSNTARRERTTMKRELTLDAGTETYSVENLFQGHPIEASDEHDDINQLINQLPSDKD 1407

Query: 1548 LPVTKRIVDLVA 1559
             PV K +  L+A
Sbjct: 1408 FPVIKELGSLLA 1419

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy chain,
            class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1367 bits (3537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1525 (48%), Positives = 982/1525 (64%), Gaps = 118/1525 (7%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKD-PS 59
            MSFEVGT+CWYP KEQGWIG EVTKND  +GT+ +EL LED E V++ET    N+ D P+
Sbjct: 1    MSFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPT 60

Query: 60   LPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQL 119
            LP+LRNPPILEST+DLTTLSYLNEPAVLHAIK+RY    IYTYSGIVLIA NPFD++D L
Sbjct: 61   LPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHL 120

Query: 120  YSQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179
            YS++MIQ YS KR+ E+EPHLFAIAEEAYR M ++K NQT+VVSGESGAGKTVSAKYIMR
Sbjct: 121  YSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMR 180

Query: 180  YFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239
            YFAS  E N     N +   EMS+ E +ILATNPIMEAFGNAKTTRNDNSSRFGKYL+IL
Sbjct: 181  YFASVQESN-----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235

Query: 240  FDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFY 299
            FD+ T I G+K+RTYLLE+SRLVYQP+TERNYHIFYQIL GLPE VKQELHL+   DY Y
Sbjct: 236  FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295

Query: 300  MNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDS 359
             NQGG+P IAGID+  EY IT  AL+LVG+  ETQ  IFKILA LLHIGNIE+K TRND+
Sbjct: 296  TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355

Query: 360  SLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIY 419
            SLSS+E NL+IACELLG+DP NFAKWI KKQIVTRSEKIV+NLNY+QAL+ARDSVAKFIY
Sbjct: 356  SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415

Query: 420  SALFDWLVTNINTVLCNPAV--LDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477
            S LFDWLV NIN  L +P +   D + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQ
Sbjct: 416  STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475

Query: 478  EFNQHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESW 537
            EFNQHVFKL           WSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW
Sbjct: 476  EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535

Query: 538  TQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLK 597
              KLY   +KPP+N+VFSKPRFGQTKF+VSHYA+DV Y+VEGFIEKNRD+VS GHL+V K
Sbjct: 536  ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595

Query: 598  ATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKK-PTPIRQVQRKPTLGSMFKLSL 656
            ATTN     IL++         E + + A ++Q   KK   P R  Q+KPTLGSMFK SL
Sbjct: 596  ATTNPIFKQILDN--------RELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSL 647

Query: 657  IELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTF 716
             ELM  INSTNVHYIRCIKPN EK+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWTF
Sbjct: 648  GELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTF 707

Query: 717  NEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAG 776
            +EF+ RY++L     W+ I    DL ++ ++N C+ IL AT+ D  KYQIGNTKIFFKAG
Sbjct: 708  DEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAG 767

Query: 777  MLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYEL 836
            MLA+ EKLR+ KMN   ++IQK IR++YYR QY+    S+    +  +  ++R RV++EL
Sbjct: 768  MLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHEL 827

Query: 837  EQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRI 896
            +  AA L+QT  R   KR Y    I  I+KLQ   + +L    +  K+   AA+ IQS I
Sbjct: 828  KTRAAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYI 887

Query: 897  RAFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLT 956
            R++  +  Y + +R +I+VQS +R ++A+R +  L+ + +  +        L  + I+  
Sbjct: 888  RSYGHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRASYGIGLLEEAIEFK 947

Query: 957  QNLAAKVKE-NRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSL 1015
             +    ++  N   ++  + LQ  +  +   Q Q E + + N         G+       
Sbjct: 948  NSFILNLEMLNDSYTRLTQLLQGDLSNIPSKQRQ-EYETIVN---------GY------- 990

Query: 1016 KDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQN------- 1068
             D++ K    +++++ E+     K        KN L E ++ ++ L +S  Q+       
Sbjct: 991  NDKISK----LKTLQVEIMNTLNK--------KNALKERKKKQSSLIQSHMQSLAAIKGN 1038

Query: 1069 --SDLYSEIKSLKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPN 1126
              S L  E+KS+K+ELA ++  IA    TT      ++ ++ +++    +  A + + P 
Sbjct: 1039 KPSRLSDEVKSMKQELAFIENVIAQDFTTT------YSANKNDKVKG--LGIAGQQVKPK 1090

Query: 1127 QLKSIPSDTAADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGF 1186
             +  I  ++                         N +L  LL   +    E+TEG LK  
Sbjct: 1091 LVNVIRRESG------------------------NPDLLELLMDLNCYTLEVTEGYLKKV 1126

Query: 1187 QVPDAGVAIQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGI 1246
             V       +++  +V+ P  ++  V+S + R GL  QS  F+++VL T++ +V +L   
Sbjct: 1127 NV------TEVNGDNVLGPIHVITTVVSSLVRNGLLIQSSKFISKVLLTVESIVMSLPKD 1180

Query: 1247 DLIPSGAFWLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLS 1306
            + +  G FWL+N+  L +F   A    L E +      DE+    +  + +L+ +   + 
Sbjct: 1181 ETMLGGIFWLSNLSRLPAFA--ANQKTLYEAN----GGDEKDKLTLIYLNDLENETLKVF 1234

Query: 1307 YNIYNIWXXX-XXXXXXXXAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTF 1365
              IY+ W             I  +V++E L                NSG+E     + TF
Sbjct: 1235 DKIYSTWLVKFMKHASAHIEIFDMVLNEKL--------------FKNSGDE-KFAKLFTF 1279

Query: 1366 FNNIFWCMKSFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLE 1425
             N     +  F + + +   +    L Y++ + FNDLI K   L+WK G +++ N+ RL 
Sbjct: 1280 LNEFDAVLCKFQVVDSMHTKIFNDTLKYLNVMLFNDLITKCPALNWKYGYEVDRNIERLV 1339

Query: 1426 EWCKTHGLPDGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVA 1485
             W +   + D    L  +IQ  K+LQL+   + +  ++     +L+PAQ+Q ++ +Y  A
Sbjct: 1340 SWFEPR-IEDVRPNLIQIIQAVKILQLKISNLNEFKLLFDFWYALNPAQIQAILLKYKPA 1398

Query: 1486 DY-ESPIPQDILKYVADIVKKESTS 1509
            +  E+ +P +IL Y+A+++K+E+ S
Sbjct: 1399 NKGEAGVPNEILNYLANVIKRENLS 1423

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
            cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
            cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1040 (54%), Positives = 731/1040 (70%), Gaps = 42/1040 (4%)

Query: 1    MSFEVGTRCWYPSKEQGWIGAEVTKNDLKDGTYFMELTLEDNEVVNVETKD------LTN 54
            M+FEVGTRCWYPS E GWI  EV+KN+ +DG Y ++ TLED  +++++T        L+N
Sbjct: 1    MTFEVGTRCWYPS-ENGWIPCEVSKNEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLSN 59

Query: 55   EKDPSLPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFD 114
            E  P +P+LRNP   EST+DLTTLSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF 
Sbjct: 60   EGSP-MPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFA 118

Query: 115  RMDQLYSQDMIQAYSG-KRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVS 173
            +M++LYS DMI+ YS    R E++PHLFAIA +AY  M +  +NQTIVVSGESGAGKTVS
Sbjct: 119  QMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVS 178

Query: 174  AKYIMRYFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFG 233
            AKYIMRYFAS D+ N++ +      +EMS+ E++ILATNPIMEAFGNAKT RNDNSSRFG
Sbjct: 179  AKYIMRYFASLDDNNAAVV------SEMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFG 232

Query: 234  KYLEILFDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTK 293
            KYL+I+FD +  IIGA++RTYLLERSRLV+Q ++ERNYHIFYQ+LAGLP  +K+EL ++ 
Sbjct: 233  KYLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISN 292

Query: 294  ADDYFYMNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIK 353
             + ++Y+NQG +P I G+DD  E+  TI AL+++G+    Q  +FKILA LLHIGNIEIK
Sbjct: 293  PEQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIK 352

Query: 354  KTRNDSSLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDS 413
            ++   SS+S DEPNLK+ACELLG+DP  F+KW+TKK+I TRSEKIV+NL   QALV RDS
Sbjct: 353  QSSTSSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDS 412

Query: 414  VAKFIYSALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANE 473
            V+KFIYS LFDWLV  INT+L    V DQ+ SFIGVLDIYGFEHFE NSFEQFCINYANE
Sbjct: 413  VSKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANE 472

Query: 474  KLQQEFNQHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGS 533
            KLQQEFNQHVFKL           WSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+
Sbjct: 473  KLQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGT 532

Query: 534  DESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHL 593
            DESWTQKLYQTLDKPP N+VFSKP+FGQTKFV+SHYA +V YDVEGFIEKNRDTVS+  +
Sbjct: 533  DESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLM 592

Query: 594  EVLKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFK 653
             VLK + NDTL ++ +  EE++    +            + +P   + + +KPTLG MFK
Sbjct: 593  NVLKNSQNDTLISLTKPTEETSTPPPQT---------ASISRP---KLINKKPTLGFMFK 640

Query: 654  LSLIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSR 713
             SL ELM+ IN+TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSR
Sbjct: 641  KSLGELMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSR 700

Query: 714  WTFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFF 773
            W+F EFI RYY+L+    W+ +   ++   +  I  CK+IL AT    EK QIG TKIFF
Sbjct: 701  WSFQEFIDRYYMLVDTTLWSDV-ASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFF 759

Query: 774  KAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVE 833
            K+G+LA  E LR  KM    + IQK IR+   R  Y+ +   +  L    +  ++R  VE
Sbjct: 760  KSGVLAELESLRLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVE 819

Query: 834  YELEQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQ 893
            ++L+   A ++Q   R Y  R  ++  +  I+ LQ + R  L QR +Q    + A+I IQ
Sbjct: 820  HQLKTKLALMMQATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQ 879

Query: 894  SRIRAFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVI 953
            S IR +  +  Y   R++   +Q+L R  +A+    KL+++++ V  +  V+Y    ++ 
Sbjct: 880  SYIRGYKHKTQYRYFRKNYQAIQALSRSMLARSLMLKLRSESE-VTQINGVTY---TELH 935

Query: 954  QLTQNLAAKVKENRQLSKRLEELQATM-----VTVSELQDQLEAQKMENQKALADQKDGF 1008
             + +++   +  N Q+ K L+E    +     +T ++L  + E    + QK +    +  
Sbjct: 936  SIVKDIHDSMTSNNQIIKELDEFNGVIDTQKSLTFTDLSAKAEQLNSDAQKIIIKHSN-- 993

Query: 1009 VLDSKSLKDQLIKANKDVES 1028
                K +KD L ++  DV+S
Sbjct: 994  --QEKQIKD-LKESKGDVDS 1010

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 89/177 (50%), Gaps = 8/177 (4%)

Query: 1348 NKIFNSGEEYTMDDILTF------FNNIFWCMKSFHIENEVFRTVIITLLNYVDTICFND 1401
            +K+FN      + ++++F         I   M +  IE  +F  +I TL+ Y++    N 
Sbjct: 1203 DKLFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVANH 1262

Query: 1402 LIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYLQHLIQTAKLLQLRKYTIEDID 1461
            +++K   + ++ G+ L  N+  L E+C+   L +     +   Q +KLLQL   ++E++ 
Sbjct: 1263 VLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEELR 1322

Query: 1462 MVRGICSSLSPAQLQKLISQYHVADYESPIPQDILKYVADIVK--KESTSAHNDIFL 1516
            +V   C +L+  Q+  L+++   +  E P+P  ++K V    +  K+ TS ++DI  
Sbjct: 1323 VVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSDIIF 1379

>Scas_688.22
          Length = 1876

 Score =  501 bits (1291), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 294/823 (35%), Positives = 472/823 (57%), Gaps = 82/823 (9%)

Query: 9   CWYPSKEQGWIGAEVTK-NDLKDGTYFME------LTLEDNEVVNVETKDLTNEKDPSLP 61
            W P  ++ +  AEV +   +K+    +E        +E  E + +E  +L+    PS  
Sbjct: 8   VWIPDPDKIFTLAEVARIESVKNARTNVEEEMATVRIMETGEELQIEKSNLS----PS-- 61

Query: 62  LLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYS 121
              NP   +  ++++ L++LNE +VLH +++RY    IYTYSG+ L+A NP+  + ++Y+
Sbjct: 62  ---NPTSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYT 117

Query: 122 QDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYF 181
           Q+ I  Y+G  + + +PH++AIAEEAY+ +  +KQ+Q+++V+GESGAGKT + K I++Y 
Sbjct: 118 QEYINLYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYL 177

Query: 182 ASCDEENS----SNMGNLQHTAEMSETEE---RILATNPIMEAFGNAKTTRNDNSSRFGK 234
           AS     S    +++   Q+  E+++ E    +IL +NPI+E+FGNA+T RN+NSSRFGK
Sbjct: 178 ASITSNKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGK 237

Query: 235 YLEILFDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLT-- 292
           +++I FD+   I GA +  YLLE+SR++ Q   ERNYHIFYQ+LAGL     ++L LT  
Sbjct: 238 FIKIEFDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSK 297

Query: 293 KADDYFYMNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEI 352
              DY Y+++   P I G++D  ++   +KA T VG   E   +I+++L+ +LHIGN++ 
Sbjct: 298 SVSDYKYLSKSN-PSIPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDF 356

Query: 353 KKTRNDSSLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARD 412
              ++  +   ++P+     +LLGV    F   +   +     E +  + N SQA    +
Sbjct: 357 TSEKSQQATFKNDPS--TLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILN 414

Query: 413 SVAKFIYSALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYAN 472
           S+++ +Y  LF ++V  IN  L + ++     ++IG+LDI GFE F+ NSFEQ CINY N
Sbjct: 415 SLSRTLYEKLFSFIVERINNSLDHSSM---TANYIGLLDIAGFEIFKHNSFEQLCINYTN 471

Query: 473 EKLQQEFNQHVFKLXXXXXXXXXXXWSFIEFN-DNQPCIDLIENK---LGILSLLDEESR 528
           EKLQQ FN H+F L           W+F++F  D Q  IDLIENK    G+L LLDEES 
Sbjct: 472 EKLQQFFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESI 531

Query: 529 LPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTK----FVVSHYALDVAYDVEGFIEKN 584
           LP  SD+S+  KL  T D+         P+F ++K    FV+ HYA +V Y++EG++ KN
Sbjct: 532 LPNSSDDSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSKN 584

Query: 585 RDTVSDGHLEVLKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQR 644
           +D +S+  + +L ++TN+ +++      ++ R       +A  ++Q+ L           
Sbjct: 585 KDPLSECMISMLSSSTNEIVTSFFNESNKNVRGSSFRTASARHREQQML----------- 633

Query: 645 KPTLGSMFKLSLIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIR 704
                         L++ + +T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IR
Sbjct: 634 --------------LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIR 679

Query: 705 ISCAGFPSRWTFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKY 764
           I+  G+P+R  F EF  RY +L     +A  F+KN          C+ +L++   D   Y
Sbjct: 680 IAREGYPNRIFFKEFFQRYRLLSDENHFATGFKKN----------CEILLSSLHLDPSLY 729

Query: 765 QIGNTKIFFKAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRK 807
           +IG +K+FFKAG+LA  E  +  ++ S ++    H+R +  RK
Sbjct: 730 KIGTSKLFFKAGVLAELETKKDQRIRSIVIRFNSHLRGRIIRK 772

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  486 bits (1250), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 294/812 (36%), Positives = 457/812 (56%), Gaps = 83/812 (10%)

Query: 10  WYPSKEQGWIGAEV-------TKNDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPSLPL 62
           W P  E+ ++  ++        K +  +    + +  ++ EV+ VET  +          
Sbjct: 9   WVPDAEEVFVKGQLVSTKTIKNKQNKDEKVCLVRVNGKEREVLEVETAAV---------- 58

Query: 63  LRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQ 122
             NP   +  +D++ L++LNE +VL+ ++ RY    IYTYSG+ L+A NP+  + ++Y+Q
Sbjct: 59  --NPSTFDKIDDMSELTHLNEASVLYNLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQ 115

Query: 123 DMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFA 182
           D +  Y G  + + EPH+FA+AE+AYR +   +Q+Q+++V+GESGAGKT + K I++Y A
Sbjct: 116 DYVNLYHGSPKEDNEPHIFAVAEQAYRNLLTQRQDQSVLVTGESGAGKTENTKKILQYLA 175

Query: 183 SCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDK 242
           S   +       L HT  +   E +IL  NPI+E+FGNA+T RN+NSSRFGK+++I FD+
Sbjct: 176 SITSDEK-----LAHT-NLESFERKILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDE 229

Query: 243 ETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKAD--DYFYM 300
              I GA +  YLLE+SR++ Q   ERNYH+FYQ+L+G+P    + L L      DY Y+
Sbjct: 230 FGKINGAHIEWYLLEKSRIIQQNIRERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYL 289

Query: 301 NQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRND-S 359
            +   P I G+DD  ++   + A  +VG   +    IF+ +A +LHIGN+E   TR + +
Sbjct: 290 -RDSNPSIPGVDDAHDFSSLLSAFNVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQA 348

Query: 360 SLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIY 419
           ++ +D   L   C+L+GVD + F   + K +     E +  + N +Q+    +S+++ +Y
Sbjct: 349 TIKNDVAPL---CKLIGVDEAAFKMAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLY 405

Query: 420 SALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479
             LF  +V  IN  L + ++ +   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ F
Sbjct: 406 EKLFAHIVRRINRSLDHGSMTE---NYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFF 462

Query: 480 NQHVFKLXXXXXXXXXXXWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSDE 535
           N H+F L           W FI++  D +  I+LIE K    GILS+LDEES LP  +DE
Sbjct: 463 NHHMFVLEQREYVKEDIQWDFIDYGKDLEYTIELIEKKNNPAGILSILDEESILPKSTDE 522

Query: 536 SWTQKLYQTLD-KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLE 594
           S+  KL    D K P    F + +  Q  FV+ HYA DV Y+V+ ++ KN+D ++D  L 
Sbjct: 523 SFYSKLMSAWDGKSPK---FKRSKLQQC-FVLEHYAADVEYNVKDWLSKNKDPLNDHLLT 578

Query: 595 VLKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKL 654
           +L  ++N  +S   E   E +R      K A+++ ++QL             TL      
Sbjct: 579 LLSESSNKLIS---EFYTEQSRG--HFSKTASNRHKEQL-------------TL------ 614

Query: 655 SLIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRW 714
               L+  ++ST+ H++RCI PN +K+A  FD  ++L QLR  GVLE IRI+  G+P+R 
Sbjct: 615 ----LLDQLSSTDPHFVRCIVPNTKKKAKTFDRKLILDQLRCNGVLEGIRIAREGYPNRI 670

Query: 715 TFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFK 774
            F EF  RY IL    +++   +KN          C+ +L+    D   Y++GNTK+FFK
Sbjct: 671 FFREFFQRYKILGADPKFSNNSKKN----------CEYLLSCISLDPSLYKVGNTKLFFK 720

Query: 775 AGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYR 806
           AG+LA  E  +  K++  +  +   I  K  R
Sbjct: 721 AGVLAQLETQKEEKISGIVTGLNAIIHGKTVR 752

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
            (myosin II), coiled-coil protein involved in septation
            and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  480 bits (1235), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 345/1084 (31%), Positives = 576/1084 (53%), Gaps = 121/1084 (11%)

Query: 65   NPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDM 124
            NP   +  E+++ L++LNEP+VL+ +++RY    IYTYSG+ L+A NP+  ++ LYS+D 
Sbjct: 70   NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLN-LYSEDH 128

Query: 125  IQAYSGKR------------RGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTV 172
            I  Y  K               ++ PH+FAIAEEAY  + ++ ++Q+I+V+GESGAGKT 
Sbjct: 129  INLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTE 188

Query: 173  SAKYIMRYFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRF 232
            + K I++Y AS    + SN+  +  ++ +   E +IL +NPI+E+FGNA+T RN+NSSRF
Sbjct: 189  NTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRF 248

Query: 233  GKYLEILFDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLT 292
            GK+++I F++   I GA +  YLLE+SR+V+Q   ERNYHIFYQ+L+GL +   + L L 
Sbjct: 249  GKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLK 308

Query: 293  KAD--DYFYMNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNI 350
              +  DY  ++   +  I GI+DV  +   + AL ++G + +  + IF+++A +L IGNI
Sbjct: 309  SRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNI 368

Query: 351  EIKKTRNDSSLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVA 410
            E    R  +  +S + ++   C  LGVD  +F   I + +     E +  + N  QA   
Sbjct: 369  EFVSDR--AEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFI 426

Query: 411  RDSVAKFIYSALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINY 470
             +++++ +Y  LF ++V  IN  L + +      ++IG+LDI GFE FE NSFEQ CINY
Sbjct: 427  LNALSRNLYERLFGYIVDMINKNLDHGSA---TLNYIGLLDIAGFEIFENNSFEQLCINY 483

Query: 471  ANEKLQQEFNQHVFKLXXXXXXXXXXXWSFIEFN-DNQPCIDLIENK---LGILSLLDEE 526
             NEKLQQ FN H+F L           W +I++  D Q  IDLIE+K    G+L LLDEE
Sbjct: 484  TNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEE 543

Query: 527  SRLPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRD 586
            + LP  +DES+  KL  T D+  +   F + R  +  F++ HYA DV Y VEG++ KN+D
Sbjct: 544  AVLPKSTDESFYSKLISTWDQNSSK--FKRSRL-KNGFILKHYAGDVEYTVEGWLSKNKD 600

Query: 587  TVSDGHLEVLKATTNDTLSTILE-SVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRK 645
             ++D  L +L ++ ND +S + +   E+S+    EA  N ++Q+ K+  + +  +     
Sbjct: 601  PLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEA--NISNQEVKKSARTSTFK----- 653

Query: 646  PTLGSMFKLSLIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRI 705
             T  S  +   I L+  + ST+ H++RCI PN  K+   F+  ++L QLR  GVLE IR+
Sbjct: 654  -TTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRL 712

Query: 706  SCAGFPSRWTFNEFILRYYILIPPVEWAPIFQKN--DLTEQDVINLCKKILAATVQDKEK 763
            +  G+P+R  F EF  RY IL P       F       T+Q+    C+ +L +   D + 
Sbjct: 713  AREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQN----CEFLLTSLQLDTKV 768

Query: 764  YQIGNTKIFFKAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYS 823
            Y+IGNTK+FFKAG+LA  EK +  K+N+ ++ +   IR                      
Sbjct: 769  YKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIR---------------------- 806

Query: 824  KGTVIRQRVEYELEQHAAT-LIQTMYRGYSKRSYISGVISSIVKLQ-------------- 868
             G  +R+ + Y L++   T +I   +R Y++        +  ++++              
Sbjct: 807  -GYTVRKEITYHLQKLKKTRVIGNTFRLYNRLVKEDPWFNLFIRIKPLLTSSNDMTRTKK 865

Query: 869  -----SRIREELEQREMQSKY---ESNAAISIQSRIRAFVPRKAYESKRRDTIVVQSLIR 920
                 ++++ +L++ E + K+   ++   ++     +  + ++    ++ ++++ +    
Sbjct: 866  FNEQINKLKNDLQEMESKKKFLEEKNQKTVNELENTQDLLNQEKENLRKNESLLNRVKTS 925

Query: 921  RRIAQRDFKKLKADAKSVHHLK-EVSYKLENKVIQLTQNLAAKVKE-----------NRQ 968
                Q+ F  L ++   +   K EV+  LE +  Q  Q L   ++E           N +
Sbjct: 926  SETLQKQFDDLVSEKDEISREKLEVAQNLE-EAHQKIQGLQETIREREATLEKLHSKNNE 984

Query: 969  LSKRLEELQATMVTVSELQDQLEAQKM--ENQ-KALADQKDGFVLDSKSLKDQLIKANKD 1025
            L K++ +L   +      Q  ++  K+  EN+ K L D  +    + KS  D+L  + +D
Sbjct: 985  LIKQISDLNCDISKEQSSQSLIKESKLKLENEIKRLKDVINSKEEEIKSFNDKLSSSEED 1044

Query: 1026 VESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKEELAHL 1085
            ++    +L TL           KN    + R ++L+TE    NSDL S+ ++ K+E A L
Sbjct: 1045 LD---IKLVTL----------EKNCNIAMSRLQSLVTE----NSDLRSKNENFKKEKAAL 1087

Query: 1086 QTSI 1089
               +
Sbjct: 1088 NNQL 1091

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 82/171 (47%), Gaps = 17/171 (9%)

Query: 926  RDFKKLKADAKSVHHLKEVSYKLENK------VIQLTQNLAAKVKENRQLSKRLEELQAT 979
            +D KK+ +D   + HLKE    +E++      + +L + L   +K    L K    L+  
Sbjct: 1559 QDVKKILSD--DLAHLKERLSAVEDRSQYTDEINRLKEELNCSLKAETNLKKEFATLKYK 1616

Query: 980  MVT--------VSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLIKANKDVESVKF 1031
            + T        +S+L  QL+    +  + L ++KD   L  K L  +    N + ES+K 
Sbjct: 1617 LETSTNDSEAKISDLLKQLD-HYTKVVEMLNNEKDAISLAEKELYQKYEALNTECESLKG 1675

Query: 1032 ELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKSLKEEL 1082
            ++ +LT    E+E++   + D L+ +   L+ S  +N ++  +IK L+E L
Sbjct: 1676 KIVSLTKIKQELESDLNQKTDALQISNAALSSSTQKNKEITEKIKYLEETL 1726

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
            Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
            (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  476 bits (1226), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 351/1056 (33%), Positives = 564/1056 (53%), Gaps = 124/1056 (11%)

Query: 65   NPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDM 124
            NP   +  +DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  + ++YS   
Sbjct: 59   NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNSY 117

Query: 125  IQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASC 184
            I+ Y G  + + +PH+FA+AE+AY+ + + KQ+Q+I+V+GESGAGKT + K I++Y AS 
Sbjct: 118  IKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI 177

Query: 185  DEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKET 244
                + +   L  T E    E +IL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+  
Sbjct: 178  ---TTDDKILLNQTNE--SFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFDEYG 232

Query: 245  AIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKAD-----DYFY 299
             I GA +  YLLE+SR++     ERNYHIFYQIL+G+    KQEL     +     DY Y
Sbjct: 233  KINGAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMS---KQELRAIGLESNSIVDYQY 289

Query: 300  MNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDS 359
            +     P I GIDD   Y   + A   VG   +  Q I K ++ +LHIGN+E    R  S
Sbjct: 290  LRHSN-PSIPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSER--S 346

Query: 360  SLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIY 419
              +S + ++K  C+LLGV   +F   + K +     E +    N SQA    +S+++ +Y
Sbjct: 347  EQASIKNDIKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSLY 406

Query: 420  SALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479
              LF+++V  IN  L + ++ +    FIG+LDI GFE F+ NSFEQ CINY NEKLQQ F
Sbjct: 407  EKLFEYIVNQINKSLEHGSMTE---YFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFF 463

Query: 480  NQHVFKLXXXXXXXXXXXWSFIEFN-DNQPCIDLIENK----LGILSLLDEESRLPAGSD 534
            N H+F L           W+FI++  D Q  IDLIE K     GIL +L+EES LP  SD
Sbjct: 464  NHHMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSSD 523

Query: 535  ESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLE 594
             S+  KL  + D   T   F + +     F++ HYA DV Y+V  ++ KN+D +++  L+
Sbjct: 524  ASFYSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLLQ 580

Query: 595  VLKATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKL 654
            VL    N  +S                                 IR        GS F+ 
Sbjct: 581  VLNDCANPLVSQFF---------------------------ADRIR--------GSSFRT 605

Query: 655  S-------LIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISC 707
            S       L  L++ + +T+ H++RCI PN +K+A  FD  ++L QLR  GVLE IRI+ 
Sbjct: 606  SSNKHREQLHTLIEQLGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIAR 665

Query: 708  AGFPSRWTFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIG 767
             G+P+R  F EF  RY IL     +    +KN          C+ +L++   D   Y++G
Sbjct: 666  DGYPNRIFFKEFFQRYKILSDECRFTNNSKKN----------CEILLSSLHLDPTIYKVG 715

Query: 768  NTKIFFKAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTV 827
            NTK+FFKAG+LA  E L+  ++++A+  +   I +   RK+   +++ L  L A     V
Sbjct: 716  NTKLFFKAGVLANLELLKEQRLSAAVTRLNAIISANSVRKE---IRSHLKKLQAARILKV 772

Query: 828  IRQRVEYELEQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQ-SKYES 886
                     E +   +    Y  Y K   +    ++I+K + +I E+++Q E + ++ E 
Sbjct: 773  T-------FETYDRLMENPWYNLYMKLLPLLDSSNTILKTK-KIAEQVKQLENKLAESEK 824

Query: 887  NAAISIQS---------RIRAFVPRKAYESKRRDTIVVQSLIRR-RIAQRDFKKLK-ADA 935
            +  + + +         +++A + ++  E ++   ++  +  ++ +I Q+  + L   D+
Sbjct: 825  STTVMVDAKRLVEQELEKVKALLLKETSELQQSQELLEATKTKQIQIQQKWDETLSIKDS 884

Query: 936  KSVHHLKEVSYKLENKVIQL--TQNLAAKVKEN--RQLSKRLEELQATMVTVSELQDQLE 991
                +L E+S + +N  ++L  T+N A+ + E+  R+LS   E+L+   +TV+EL+++L+
Sbjct: 885  LETENL-ELSKEADNLRLELEKTKN-ASDLSEDKFRELSHDKEKLE---ITVNELKNKLD 939

Query: 992  AQKMENQKALADQKDGFVLDSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQL 1051
              K  +++AL  +KD  + +   LK       K+++     L  + AK  + E     +L
Sbjct: 940  VVK-NDERALDSEKDKLIREISDLK-------KEIQEKTMSLKDMEAKVNDSEIAIDVKL 991

Query: 1052 DELER----TKTLLTESKTQNSDLYSEIKSLKEELA 1083
              LE+    T   +     +N+ L +++KSLK ++A
Sbjct: 992  KSLEKHLAATSNRMKGFFEENTQLAAQVKSLKNDIA 1027

>Kwal_23.5534
          Length = 1907

 Score =  468 bits (1204), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 272/731 (37%), Positives = 417/731 (57%), Gaps = 72/731 (9%)

Query: 65  NPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDM 124
           NP   +  +D++ L++LNEP+VLH ++ RY+  NIYTYSG+ L+A NP+  + ++YSQD 
Sbjct: 55  NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDY 113

Query: 125 IQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASC 184
           +  Y G  + + +PH+FAIAEEAY+ + +++++Q+I+V+GESGAGKT + K I++Y AS 
Sbjct: 114 VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 185 DEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKET 244
             ++  +    Q + E      +IL +NPI+E+FGNA+T RN+NSSRFGK+++I FD+  
Sbjct: 174 TSDDKLSPDTSQESFER-----KILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELG 228

Query: 245 AIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLP--EDVKQELHLTKADDYFYMNQ 302
            I GA +  YLLE+SR++ Q   ERNYHIFYQ+L+G+   E  +  L      DY Y+ +
Sbjct: 229 KINGAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYL-R 287

Query: 303 GGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLS 362
              P I G+DD  ++   + +  +VG + +  Q +   ++ +LHIGNIE    R +   +
Sbjct: 288 NSNPSIPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSERAEQ--A 345

Query: 363 SDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYSAL 422
           S + +++  C LLGV  ++F   + K +     + +    N  QA    +S+++ +Y  L
Sbjct: 346 SFDGSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENL 405

Query: 423 FDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQH 482
           F  +V  IN  L + ++ +   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H
Sbjct: 406 FAHIVQRINNNLDHGSMTE---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHH 462

Query: 483 VFKLXXXXXXXXXXXWSFIEFN-DNQPCIDLIEN---KLGILSLLDEESRLPAGSDESWT 538
           +F L           W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DES+ 
Sbjct: 463 MFVLEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFY 522

Query: 539 QKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKA 598
            KL +T           K    Q  FV+ HYA DV Y+V+G++ KN+D + +  L++L  
Sbjct: 523 SKL-ETF--YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSN 579

Query: 599 TTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIE 658
           ++N+ +                                        K + GS FK + I 
Sbjct: 580 SSNELIRGF----------------------------------YSEKDSRGSSFKTTSIR 605

Query: 659 -------LMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFP 711
                  L+  ++ST  H++RCI PN +K+A  F+  ++L QLR  GVLE IRI+  G+P
Sbjct: 606 HRDQLKSLLDRLSSTEPHFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYP 665

Query: 712 SRWTFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKI 771
           +R  F EF  RY IL     ++   +KN          C+ +L++   D   +++GN+K+
Sbjct: 666 NRIFFKEFFQRYKILSDEYRFSNTSKKN----------CEIVLSSLRLDPSVFKVGNSKL 715

Query: 772 FFKAGMLAYFE 782
           FFKAG+LA  E
Sbjct: 716 FFKAGVLASLE 726

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  439 bits (1129), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 263/711 (36%), Positives = 386/711 (54%), Gaps = 58/711 (8%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y GK R
Sbjct: 38  DLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPFRDLG-IYTDAVLESYKGKNR 96

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+          
Sbjct: 97  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASST------ 150

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
              H A + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+++      ++  
Sbjct: 151 ---HEASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQITN 207

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q + ERN+HIFYQ   G  +  +Q   + + D Y Y +  G   +  IDD
Sbjct: 208 YLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTIDD 267

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIACE 373
           + +Y  TIKA+ ++G++ E Q  IF++L+A+L IGN+   +    ++   D         
Sbjct: 268 LHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVTDFVAY 327

Query: 374 LLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVT 428
           L+ VD     K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+V 
Sbjct: 328 LMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWIVD 387

Query: 429 NINTVL-CNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLX 487
            +N  L   P  +      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K  
Sbjct: 388 RVNVSLKAFPGAVKS----IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSE 443

Query: 488 XXXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTL 545
                     W+ I++ DN+   DLIE+K   GI + LD+          +  Q   Q L
Sbjct: 444 QEEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQRL 503

Query: 546 DKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTLS 605
           +   TN  F       +KFV+ HYA DV YD+ G  +KN+D +     E+++ TTN  LS
Sbjct: 504 NLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFLS 560

Query: 606 TIL-ESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQTIN 664
           TI  +++++S+++                          R PT G+    S  EL++T++
Sbjct: 561 TIFPDTIDKSSKR--------------------------RPPTAGNKIIKSANELVETLS 594

Query: 665 STNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYY 724
                YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TF +F+ R+Y
Sbjct: 595 KAQPSYIRTIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFY 654

Query: 725 ILIPPVEWAPIFQKNDLTEQ-DVINLCKKILAATVQDKEKYQIGNTKIFFK 774
           +L P   +A      D T Q D +   K+IL        +YQ+G TK+F K
Sbjct: 655 LLSPKCSYA-----GDYTWQGDTLGAVKQILQDASIPTTEYQLGVTKVFIK 700

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  442 bits (1138), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 282/811 (34%), Positives = 434/811 (53%), Gaps = 83/811 (10%)

Query: 65  NPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDM 124
           NP   +  ++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS   
Sbjct: 61  NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYSNST 120

Query: 125 IQAY-SGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFAS 183
           I++Y S       +PH+F +AE AYR +K+ KQ+Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 121 IKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQYLAS 180

Query: 184 CDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKE 243
                +S+   + +  EM     +IL +NP++E+FGNA+T RN+NSSRFGK+++I FD+ 
Sbjct: 181 I----TSDSFEVSNNFEM-----KILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQS 231

Query: 244 TAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDY--FYMN 301
             I GA +  YLLE+SR+  + + ERNYHIFYQ+L G  +   + ++   ++D+  + + 
Sbjct: 232 GKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQIL 291

Query: 302 QGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIE-IKKTRNDSS 360
                 I G+DD +E+   + AL  VG   +    IFKI+A +LH GNIE + +    +S
Sbjct: 292 ANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQAS 351

Query: 361 LSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIYS 420
             SD   +     LLGV  S+F   I K +     E +    N +QA    +S+ + +Y 
Sbjct: 352 FKSD---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYE 408

Query: 421 ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            LF ++V  IN  L + ++     ++IG+LDI GFE FE NSFEQ CINY NEKLQQ FN
Sbjct: 409 HLFGYIVDTINMSLNHGSM---TANYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFN 465

Query: 481 QHVFKLXXXXXXXXXXXWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSDES 536
            H+F L           W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D S
Sbjct: 466 HHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSS 525

Query: 537 WTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVL 596
           +  KL  T  +  T   F + +     FV+ HYA DV Y V G++ KN+D +++  + +L
Sbjct: 526 FYSKLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVNIL 582

Query: 597 KATTNDTLSTILESVEESARKVEEAKK----------NAASQDQKQLKKPTPIRQVQRKP 646
             ++N  +S      E  +       +          N+  + +  LK     R  +++ 
Sbjct: 583 SVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTALS-RHREQQS 641

Query: 647 TLGSMFKLSLIELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRIS 706
           +L S   L           TN H++RCI PN +K +  FD  ++L QLR  GVLE IRI+
Sbjct: 642 SLLSQLAL-----------TNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIA 690

Query: 707 CAGFPSRWTFNEFILRYYILIPPVEWAPIFQKNDLTEQDVINL--CKKILAATVQ-DKEK 763
             G+P+R  F EF  RY IL   ++ +           D IN     +IL + +  D   
Sbjct: 691 REGYPNRILFKEFYERYRILSEHLDKSS----------DAINYKQSSQILISELHLDPTT 740

Query: 764 YQIGNTKIFFKAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYS 823
           Y++G +K+FFKAG LA  E  + + +    V     IR    RK+              +
Sbjct: 741 YKVGTSKLFFKAGTLAELESKKESILFEITVRFNSIIRGWSQRKR--------------T 786

Query: 824 KGTVIRQRVEYELEQHAATLIQTMYRGYSKR 854
           KG + + R        A+ +I  ++R Y+++
Sbjct: 787 KGEIQKMR--------ASEMIGNVFRKYNEK 809

>Scas_721.119
          Length = 1232

 Score =  426 bits (1094), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 264/713 (37%), Positives = 378/713 (53%), Gaps = 62/713 (8%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++  +   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPFRDLG-IYTDAIVESYKGKNR 98

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y AS    +S ++G
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIASASTTHSESIG 158

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
            ++         + +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       +  
Sbjct: 159 KIK---------DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 209

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q K ERN+HIFYQ   G  +  +Q   + K + Y Y +  G   +  IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTIDD 269

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIACE 373
           V++Y  T+KA+ ++G+  E Q  IF++LAA+L IGN+   +    ++   D         
Sbjct: 270 VNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVTDFVAY 329

Query: 374 LLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVT 428
           LL +D     K + ++ + T     R       LN  QA   RD++AK IY+ LF+W+V 
Sbjct: 330 LLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVG 389

Query: 429 NINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLXX 488
            +N  L      D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K   
Sbjct: 390 RVNVSLQAYPGADRS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 489 XXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 546
                    W+ I++ DN+   DLIE K   GI + +++          +  Q   Q L 
Sbjct: 447 ETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQRL- 505

Query: 547 KPPTNKVFSKPRF--GQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTL 604
               N   S P F     KFV+ HYA DV YDV G  +KN+D +    +E++  TTN  L
Sbjct: 506 ----NMFSSNPHFELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNPFL 561

Query: 605 STI--LESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQT 662
           S I  +E  +ES R                           R PT G     S  EL++T
Sbjct: 562 SGIFPVEVDKESKR---------------------------RPPTAGDKIIKSANELVET 594

Query: 663 INSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILR 722
           ++     YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TF +F+ R
Sbjct: 595 LSKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVER 654

Query: 723 YYILIPPVEWAPIFQKNDLTEQ-DVINLCKKILAATVQDKEKYQIGNTKIFFK 774
           +Y+L P   +A      D T Q + ++  + IL        +YQ+G T +F K
Sbjct: 655 FYLLSPHCSYA-----GDYTWQGETLDAVQHILNDASIPASEYQLGTTSVFIK 702

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  425 bits (1092), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 263/738 (35%), Positives = 386/738 (52%), Gaps = 57/738 (7%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++  Y GK R
Sbjct: 40  DLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLG-IYTDAVMNEYKGKNR 98

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH+FAIAE  Y  MK+  +NQ +++SGESGAGKT +AK IM+Y A+          
Sbjct: 99  LEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASST------ 152

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
              HT  + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       +  
Sbjct: 153 ---HTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITN 209

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q K ERN+HIFYQ   G  +  +Q   + K + Y Y    G      IDD
Sbjct: 210 YLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDD 269

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIACE 373
           + +Y  T+KA+ ++G+  E Q  IF++LAA+L IGN+   +    ++   D         
Sbjct: 270 LQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAY 329

Query: 374 LLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVT 428
           LL +D     K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+V+
Sbjct: 330 LLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVS 389

Query: 429 NINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLXX 488
            +N  L            IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K   
Sbjct: 390 RVNKSL---QAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 489 XXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 546
                    W+ I++ DN+   DLIE +   GI + +++          +  Q   Q L+
Sbjct: 447 ETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLN 506

Query: 547 KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTLST 606
              TN  F        KFV+ HYA DV YD++G  +KN+D +    +E++  TTN  L+T
Sbjct: 507 LFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLAT 563

Query: 607 IL-ESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQTINS 665
           I  ++V+  +++                          R PT G     S  +L++T++ 
Sbjct: 564 IFPDTVDRESKR--------------------------RPPTAGDKIIKSANDLVETLSK 597

Query: 666 TNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYI 725
               YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F +F+ R+Y+
Sbjct: 598 AQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYL 657

Query: 726 LIPPVEWAPIFQKNDLTEQ-DVINLCKKILAATVQDKEKYQIGNTKIFFKAG-MLAYFEK 783
           L P   +A      D T Q D ++  K IL  +   +++YQ+G T +F K    L   E 
Sbjct: 658 LSPHCSYA-----GDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEH 712

Query: 784 LRSTKMNSAIVLIQKHIR 801
           +R    ++    IQ+  R
Sbjct: 713 MRDRYWHNMAARIQRAWR 730

>Kwal_26.7587
          Length = 1250

 Score =  421 bits (1083), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 260/745 (34%), Positives = 394/745 (52%), Gaps = 59/745 (7%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++ A+   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPFRDLG-IYTDSVLRSYVGKNR 98

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH+FAIAE  Y  MK   +NQ +++SGESGAGKT +AK IM+Y A+  E +S ++G
Sbjct: 99  LEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASETHSDSIG 158

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
            ++         + +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       +  
Sbjct: 159 KIK---------DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITN 209

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q K ERN+HIFYQ   G  ++ +Q   + K + Y Y +  G   +  IDD
Sbjct: 210 YLLEKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTIDD 269

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIACE 373
           +S++  T+ A++++G+    Q  +F+ LAA+L IGNI   +    ++   D         
Sbjct: 270 LSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFVAY 329

Query: 374 LLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVT 428
           LL VD +   + + ++ + T     R       LN  QA   +D++AK IY+ LFDW V 
Sbjct: 330 LLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWTVD 389

Query: 429 NINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLXX 488
            +N  L     L   +  IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K   
Sbjct: 390 RVNLSL---QALPGANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 489 XXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 546
                    W+ I++ DN+   DLIE +   GI++ +++         ++  Q   Q L 
Sbjct: 447 EEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQRL- 505

Query: 547 KPPTNKVFSKPRF--GQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTL 604
               N   S P F    +KF++ HYA DV YD+ G  +KN+D +    +E++K ++N+ L
Sbjct: 506 ----NLFSSNPHFELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNEFL 561

Query: 605 STILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQTIN 664
            ++  +V +   K                         +R P+ G     S  EL++T++
Sbjct: 562 CSLFPTVVDKNSK-------------------------RRPPSAGDKIIKSANELVETLS 596

Query: 665 STNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYY 724
                YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F++F+ R+Y
Sbjct: 597 KAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFY 656

Query: 725 ILIPPVEWAPIFQKNDLTEQ-DVINLCKKILAATVQDKEKYQIGNTKIFFKAG-MLAYFE 782
           +L P   +A      D T Q D +   K IL        +YQ+G +K+F K    L   E
Sbjct: 657 LLSPQCSYA-----GDYTWQGDTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALE 711

Query: 783 KLRSTKMNSAIVLIQKHIRSKYYRK 807
            +R    ++    IQ+  R    R+
Sbjct: 712 TMRDKYWHNMAARIQRAWRRFLLRR 736

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  419 bits (1076), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 268/743 (36%), Positives = 387/743 (52%), Gaps = 54/743 (7%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF  +  +Y+ D +++Y GK R
Sbjct: 40  DLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPFRDLG-IYTDDTMKSYQGKNR 98

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E  PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A+          
Sbjct: 99  LEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSS------- 151

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
              H+  +S+ ++ +LATNP++E+FG AKT RN+NSSR GKYLEI FD         +  
Sbjct: 152 --THSESISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITN 209

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q K ERN+HIFYQ   G PE+ +Q   + + + Y Y +      +  +DD
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDD 269

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIACE 373
           V E+  T+ A+  +G+    Q  IF+ LAA+L IGNI   +    ++   D+        
Sbjct: 270 VEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAY 329

Query: 374 LLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVT 428
           LL V      K + ++ I T     R     S LN  QA   RD++AK IY+ LF+W+V 
Sbjct: 330 LLEVQEELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVE 389

Query: 429 NINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLXX 488
            +N  L      D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K   
Sbjct: 390 RVNNSLQAFPGADK---SIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 446

Query: 489 XXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 546
                    W+ IE+ DN+   DLIE K   GI + +++         ++  Q   Q L+
Sbjct: 447 DTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRLN 506

Query: 547 KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTLST 606
              TN  F      Q KFVV HYA DV YD+ G  +KN+D +    +E+L  T+N  +  
Sbjct: 507 LFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVRE 563

Query: 607 ILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQTINST 666
           I                     DQ Q          +R PT G     S  EL++T++  
Sbjct: 564 IFP-------------------DQPQTD------SRRRPPTSGDKIIKSANELVETLSKA 598

Query: 667 NVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL 726
              YIR IKPN  K +  +D+  VL Q++  G+ E +RI  AGF  R  F +F+ R+Y+L
Sbjct: 599 QPSYIRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLL 658

Query: 727 IPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFK-AGMLAYFEKLR 785
            P   +A  +    + + + ++  K IL        +Y+IG T+IF K    L   E +R
Sbjct: 659 SPQCSYAGDY----VWDGETLDAVKLILQDASIPTTEYEIGVTQIFIKHPETLFALENMR 714

Query: 786 STKMNSAIVLIQKHIRSKYYRKQ 808
                +    IQ+  R +Y +K+
Sbjct: 715 DKYWYNMAARIQRAWR-RYLQKR 736

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  417 bits (1072), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 262/743 (35%), Positives = 391/743 (52%), Gaps = 55/743 (7%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT L+ +++ ++   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y GK R
Sbjct: 41  DLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPFRDLG-IYTDAIMKSYQGKNR 99

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH++AI+E  Y  +K   +NQ +++SGESGAGKT +AK IM Y A+    +S ++G
Sbjct: 100 LEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSESIG 159

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
            ++         + +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       +  
Sbjct: 160 KIK---------DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITN 210

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q   ERN+HIFYQ   G  ++ +Q   +   + Y Y +      +  IDD
Sbjct: 211 YLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDD 270

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIACE 373
           V ++  TIKA+ ++G+A E Q  IF++LAA+L IGNI   +    ++   D         
Sbjct: 271 VKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAY 330

Query: 374 LLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWLVT 428
           LL VD  +  K + ++ + T     R       LN  QA   RD++AK IY+ LF+W+V 
Sbjct: 331 LLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVD 390

Query: 429 NINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLXX 488
            +N  L      D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K   
Sbjct: 391 RVNKSLHAYPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQ 447

Query: 489 XXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQTLD 546
                    W+ I++ DN+   DLIE K   GI + +++          +  Q   Q L 
Sbjct: 448 DTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRLS 507

Query: 547 KPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTLST 606
              +N  F +    Q KFV+ HYA DV YDV G  +KN+D +    +E++  TTN  L+T
Sbjct: 508 LFSSNPHFEQ---RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLTT 564

Query: 607 ILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQTINST 666
           +                N   +D K           +R PT G     S  EL++T++  
Sbjct: 565 LFP--------------NQVDKDNK-----------RRPPTAGDKIIKSANELVETLSKA 599

Query: 667 NVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYIL 726
              YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R  F +F+ R+Y+L
Sbjct: 600 QPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLL 659

Query: 727 IPPVEWAPIFQKNDLT-EQDVINLCKKILAATVQDKEKYQIGNTKIFFKAG-MLAYFEKL 784
            P   +A      D T   D++   + IL   +  +++YQ+G T++F K    L   E +
Sbjct: 660 SPRCSYA-----GDYTWTGDILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENM 714

Query: 785 RSTKMNSAIVLIQKHIRSKYYRK 807
           R    ++    IQ+  R    R+
Sbjct: 715 RDKFWHNMAARIQRAWRRYLQRR 737

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  413 bits (1061), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 257/712 (36%), Positives = 376/712 (52%), Gaps = 61/712 (8%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++ ++   +K+R+    IYTY G VLI+ NPF  +  +Y+  ++++Y GK R
Sbjct: 40  DLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLG-IYTNAVLESYKGKNR 98

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH+FAIAE  Y  +K+  +NQ +++SGESGAGKT +AK IM+Y A+    +S ++G
Sbjct: 99  LEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIG 158

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
            ++         + +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +       +  
Sbjct: 159 KIK---------DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITN 209

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q K ERN+HIFYQ   G  +  KQ   +   + Y Y    G       D 
Sbjct: 210 YLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAG---CTSADQ 266

Query: 314 V--SEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIA 371
           +   +Y  T++A+  +G+  E Q  IF++LAA+L IGNI   +    ++   D       
Sbjct: 267 LMRKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFV 326

Query: 372 CELLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYSALFDWL 426
             LL VD S   K + ++ + T     R       LN  QA   RD++AK IY+ LFDW+
Sbjct: 327 AYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWI 386

Query: 427 VTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           V  +N  L            IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 387 VDRVNVSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKA 443

Query: 487 XXXXXXXXXXXWSFIEFNDNQPCIDLIE--NKLGILSLLDEESRLPAGSDESWTQKLYQT 544
                      W+ I++ DN+   DLIE  N  GIL+ +++          +  Q   Q 
Sbjct: 444 EQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQR 503

Query: 545 LDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKATTNDTL 604
           L+   +N  F        KFV+ HYA DV YD+ G  +KN+D +    +E++  TTN  L
Sbjct: 504 LNLFNSNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFL 560

Query: 605 STIL-ESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSLIELMQTI 663
           STI  + V++ +++                          R PT G     S  EL++T+
Sbjct: 561 STIFPDDVDKDSKR--------------------------RPPTAGDKIIKSANELVETL 594

Query: 664 NSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRY 723
           +     YIR IKPN  K    +D+  VL Q++  G+ E +RI  AGF  R TF +F+ R+
Sbjct: 595 SKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERF 654

Query: 724 YILIPPVEWAPIFQKNDLT-EQDVINLCKKILAATVQDKEKYQIGNTKIFFK 774
           Y+L P   +A      D T + D +   K IL   +  ++++Q+G T +F K
Sbjct: 655 YLLSPDCSYA-----GDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIK 701

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  401 bits (1031), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 264/748 (35%), Positives = 391/748 (52%), Gaps = 77/748 (10%)

Query: 74  DLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQLYSQDMIQAYSGKRR 133
           DLT LS +++  +   +K+R+   +IYTY G VLI+ NPF  +  +Y+  +++ Y G+ R
Sbjct: 39  DLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPFRDLG-IYTDQVLETYKGRNR 97

Query: 134 GEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASCDEENSSNMG 193
            E+ PH+FAIAE  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+    + +++G
Sbjct: 98  LEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHEASIG 157

Query: 194 NLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKETAIIGAKMRT 253
            ++         + +LATNP++E+FG AKT RN+NSSR GKYLEI F+ +      ++  
Sbjct: 158 RIK---------DMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQITN 208

Query: 254 YLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFYMNQGGEPEIAGIDD 313
           YLLE+ R+V Q K ERN+HIFYQ   G  +  ++   +   + Y Y +  G   +  IDD
Sbjct: 209 YLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTIDD 268

Query: 314 VSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDSSLSSDEPNLKIA-- 371
           +++Y  T++A+ ++G++   Q  IF++L+A+L IGN+          +  DE N KIA  
Sbjct: 269 LNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTF--------MEDDEGNAKIADT 320

Query: 372 ------CELLGVDPSNFAKWITKKQIVT-----RSEKIVSNLNYSQALVARDSVAKFIYS 420
                   LL VD     K + ++ I T     R       LN  QA   RD++AK IY+
Sbjct: 321 SITDFVAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAIYN 380

Query: 421 ALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            LF+W+V  +N  L     L      IG+LDIYGFE FE NSFEQ CINY NEKLQQ F 
Sbjct: 381 NLFEWIVDRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFI 437

Query: 481 QHVFKLXXXXXXXXXXXWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWT 538
           Q   K            W+ I++ DN+   +LIE K   GI + L++          +  
Sbjct: 438 QLTLKSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNAAD 497

Query: 539 QKLYQTLDKPPTNKVFSKPRF--GQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVL 596
           Q   Q L     N   S P F    +KFV+ HYA DV YD+ G  +KN+D +    +E+L
Sbjct: 498 QAFAQRL-----NLFTSNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVELL 552

Query: 597 KATTNDTLSTILESVEESARKVEEAKKNAASQDQKQLKKPTPIRQVQRKPTLGSMFKLSL 656
            +T+N  L+TI                +   +D K++             T G     S 
Sbjct: 553 NSTSNTFLATIFP--------------DTGDKDSKRIPS-----------TAGDKIIRSA 587

Query: 657 IELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTF 716
            EL+ T++     YIR IKPN  K    +D+  VL Q++  G+ E +RI  A +  R  F
Sbjct: 588 NELVDTLSKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIF 647

Query: 717 NEFILRYYILIPPVEWAP--IFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFK 774
           ++F+ R+Y+L P   +A    +Q N L   D +NL   IL  T     +YQ+G TK+F K
Sbjct: 648 DKFVERFYLLSPQCSYAGDYTWQGNTL---DAVNL---ILRDTSIPVTEYQLGVTKVFIK 701

Query: 775 AG-MLAYFEKLRSTKMNSAIVLIQKHIR 801
               L   E +R    ++    IQ+  R
Sbjct: 702 TPETLFALENMRDKYWHNMASRIQRAWR 729

>Sklu_2422.11 YDL239C, Contig c2422 22194-24956 reverse complement
          Length = 920

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 129/262 (49%), Gaps = 47/262 (17%)

Query: 842  TLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIRAFVP 901
            T IQT+ +    R       S+I KL+++IRE+ +  E+    +S+ A   Q+ I     
Sbjct: 245  TDIQTLQKTLDSRH------STIQKLENKIREKQDLVELTQTEKSSVAGRYQAEIEEL-Q 297

Query: 902  RKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYK------LENKVIQL 955
            R+    K ++  + Q  ++ ++ +           SV HLK    K      L N++ +L
Sbjct: 298  RQLKTIKEKNEEIDQ--LKHQLHE-----------SVEHLKVAEEKNIEVDQLRNQLKEL 344

Query: 956  TQNLAA-KVKENR---QLSKRLEELQATMVTVSELQDQLEAQKMENQKALAD-QKDGFVL 1010
               +   K K N+   +  K LE+ +A +     L +QL   KM+ +KAL + ++D   +
Sbjct: 345  VNEVETHKAKYNQVTVEYEKSLEDQKANLERSETLVEQL---KMQKEKALEEKEQDKETI 401

Query: 1011 DSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSD 1070
            DS  LK++++  NK ++S++ +       YTE   + KNQ+  LE     L   +T+N++
Sbjct: 402  DS--LKEKILDQNKRLDSLELQ-------YTERSNDGKNQISLLEEKNKGL---ETENAN 449

Query: 1071 LYSEIKSLKEELAHLQT-SIAL 1091
            +  E+K L+ +L  +Q  +IAL
Sbjct: 450  IRGELKDLRNDLKKMQDRNIAL 471

>Sklu_2418.6 YBL047C, Contig c2418 10006-13899 reverse complement
          Length = 1297

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 97/199 (48%), Gaps = 20/199 (10%)

Query: 893  QSRIRAFVPRKAYES--KRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLEN 950
            Q +I A V + AY S            + +R +   D   L AD+ +   L + + +L N
Sbjct: 520  QGQIPASVDKPAYTSILPSVPNFASAPMPQRSVQNND---LFADSAASAQLSQATTELAN 576

Query: 951  KVIQLTQNLAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVL 1010
                L+  +++  K+  +++ +    Q  +  V++L+  +E+ K+   +A  DQ+   V 
Sbjct: 577  ----LSNQVSSLTKQATEVNDKKARAQQELQRVTQLKTSIES-KLATLRASYDQE---VQ 628

Query: 1011 DSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSD 1070
             ++ ++  L+++ KD E+++ EL+   A Y  +E     +L EL++    L +S+  NS 
Sbjct: 629  QTEKVESLLLQSRKDTETLQQELSVAEANYHAVEG----KLTELQKE---LQDSEQSNSQ 681

Query: 1071 LYSEIKSLKEELAHLQTSI 1089
            L  +I +L    A LQT +
Sbjct: 682  LKEQIGNLNAMAASLQTEL 700

>YBL047C (EDE1) [147] chr2 complement(127860..132005) Protein with
            role in endocytosis, has similarity to cytoskeletal
            proteins Uso1p and Pan1p and to mouse tyrosine kinase
            substrate eps15 [4146 bp, 1381 aa]
          Length = 1381

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 83/155 (53%), Gaps = 24/155 (15%)

Query: 943  EVSYKLENKVIQLTQNLAAKVKE--------NRQLSKRLEELQATMVTVSELQDQLEAQK 994
            E S +L N   ++  NL+ +V          N + S+  +EL+     V+E+++ ++  K
Sbjct: 594  EASAQLSNATTEMA-NLSNQVNSLSKQASITNDKKSRATQELK----RVTEMKNSIQI-K 647

Query: 995  MENQKALADQKDGFVLDSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDEL 1054
            + N ++  DQ    V  ++ L+ Q+++ NK+ E++  +LA   A Y    AESK  L+EL
Sbjct: 648  LNNLRSTHDQN---VKQTEQLEAQVLQVNKENETLAQQLAVSEANY--HAAESK--LNEL 700

Query: 1055 ERTKTLLTESKTQNSDLYSEIKSLKEELAHLQTSI 1089
                T L ES+T+N++L  +I +L    A LQ+ +
Sbjct: 701  ---TTDLQESQTKNAELKEQITNLNSMTASLQSQL 732

>Kwal_56.24295
          Length = 1154

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 79/163 (48%), Gaps = 29/163 (17%)

Query: 787 TKMNSAIVLIQKHIRSKYYRKQYMLMKASLS-------LLGAYSKGTVIRQRV---EYEL 836
           T++   ++ +Q  +RS + RK    +  SL+        + A S+  +IR  +   + EL
Sbjct: 615 TRILPQVITLQGLLRSHHLRKHRKSIYFSLNEQLNRLVTMQALSRSIIIRGTINSLQEEL 674

Query: 837 EQHAATL--IQTMYRGYSKRSYISGVISSI-------VKLQSRIREELEQREMQ---SKY 884
             H++T+  +  + +G  KR+ +  + +++       V LQ+  R  L +  ++      
Sbjct: 675 RAHSSTIFNLSAILKGSFKRTSVKSLATAVRDSKDPVVSLQALSRGVLARFALELIADIV 734

Query: 885 ESNAAISIQSRIRAFVPRKAYESK----RRDTI---VVQSLIR 920
           ESN  +++QS  R F+ R+A+  +    RR+ I    VQS +R
Sbjct: 735 ESNNLVNVQSMARGFIIRRAHNERARFFRRNVIKVVKVQSFVR 777

>ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH]
            (591654..594023) [2370 bp, 789 aa]
          Length = 789

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 37/72 (51%)

Query: 1362 ILTFFNNIFWCMKSFHIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNV 1421
            I+  F  + + ++S  +   +    + T + +  T  FN ++  + +LS  + +Q+  N+
Sbjct: 452  IVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNL 511

Query: 1422 TRLEEWCKTHGL 1433
            + +E+W K H +
Sbjct: 512  STIEDWVKNHDM 523

>Scas_610.17
          Length = 1305

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 73/146 (50%), Gaps = 17/146 (11%)

Query: 954  QLTQNLAAKVKENRQLSKRLEEL--QATMVTVSELQDQLEAQKMENQKALADQK------ 1005
            Q +  L++   E   LS ++  L  QAT+    + +   E +++ + KA  + K      
Sbjct: 532  QASAQLSSATTELANLSNQVNSLSKQATITNDKKARAAQELKRVNDMKASIENKLSTLRK 591

Query: 1006 --DGFVLDSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTE 1063
              D  +  ++ L+ QL+++NK  E++K +L    A Y  +E+    +L+EL    T LT 
Sbjct: 592  THDDNMKQTEVLESQLLESNKQTETLKQQLGVTEANYHAIES----KLNEL---TTELTT 644

Query: 1064 SKTQNSDLYSEIKSLKEELAHLQTSI 1089
            ++  N++L  +I +L    A LQT +
Sbjct: 645  AQESNTNLKDQIANLNSMTATLQTQL 670

>CAGL0F04609g 463702..467637 similar to sp|P34216 Saccharomyces
            cerevisiae YBL047c, start by similarity
          Length = 1311

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 78/160 (48%), Gaps = 26/160 (16%)

Query: 933  ADAKSVHHLKEVSYKLENKVIQLTQ--NLAAKVKENRQLSKRLEELQATMVTVSELQDQL 990
            AD +S   L   +  L N   Q     N A    E +  SK  +ELQ     V+E++  +
Sbjct: 585  ADGESSRQLSTATTDLANLSNQANSLSNQAGIASEKK--SKVSQELQ----RVNEMKANI 638

Query: 991  EAQKMENQKALADQKDGFVLDSKSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQ 1050
            E+ K+   +A  DQ    V  ++ ++ QL + N++VE++  +L  + A Y   E+    +
Sbjct: 639  ES-KLATLRAKYDQD---VKATEEMETQLTQTNREVETLNQQLGVVEANYHATES----K 690

Query: 1051 LDELERTKTLLTESKTQNSDLYSEIKSLKEELAHLQTSIA 1090
            L+EL   KT   E++ +NS        LKE++A+  T IA
Sbjct: 691  LNEL---KTQYEEAQQKNS-------KLKEDIANFNTMIA 720

>KLLA0D12914g complement(1101471..1105955) weakly similar to
            sgd|S0006163 Saccharomyces cerevisiae YPL242c IQG1
            involved in cytokinesis, has, hypothetical start
          Length = 1494

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 116/282 (41%), Gaps = 72/282 (25%)

Query: 782  EKLRSTKM-NSAIVLIQKHIRSKYYRKQYM-------LMKASLSLLGAYSKGTVIRQRVE 833
            EKLR   +      ++Q  IR+K  R  +M       ++ +  S L A S+G ++R R+ 
Sbjct: 529  EKLRYKSIYGDTFSVLQAVIRAKLQRGNFMSYHNISNIVSSEASALQALSRGRIVRLRM- 587

Query: 834  YELEQHAATL---IQTMYRGYSKRS-----------------------YI---------S 858
              +E  +  L   +Q + RG  +RS                       YI         S
Sbjct: 588  --MEASSGDLQIKLQALLRGAFQRSKLQRVKEVMSCDQFQNFGPILKGYIVARRYTDAPS 645

Query: 859  GVISSIVKLQSRIREELEQREMQ---SKYESNAAISIQSRIRAFVPRKA-------YESK 908
             V + IV   + ++  L +  M+      E N   S+QS++  ++ RK        Y+ +
Sbjct: 646  KVANEIVSFNAVVKGMLTRFAMELIIDIAEQNNIDSLQSKVLGYLIRKRVSQKKSFYKMR 705

Query: 909  RRDTIVVQSLIRRRIAQRDFK--------KLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960
              + I++Q  IRR   Q  +K        KL    K VH L +   +L +  +Q      
Sbjct: 706  ESEIIIIQKNIRRYQLQNAYKVLMSTGSPKLSTVRKFVHILNQSDNELFSANLQ------ 759

Query: 961  AKVKEN-RQLSKRLEELQATMVTVSELQDQLEAQKMENQKAL 1001
             K+K N   ++  + ELQ ++     ++D LE ++++  K L
Sbjct: 760  -KLKANINDVNDEVGELQESLRKKVLMKDSLEKRRIDVCKFL 800

>Kwal_27.10895
          Length = 114

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 21/109 (19%)

Query: 1188 VPDAGVAIQLSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQK---VVTTLK 1244
            VP    + QLSRRD                   LTKQ  S   +  T ++K   V+T L+
Sbjct: 8    VPSKEYSKQLSRRD------------------ELTKQESSLKREYTTMLRKMASVMTVLQ 49

Query: 1245 GIDLIPSGAFWLANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVS 1293
             ++ IP  +    +   L       Q+S L E+   K ++D E  E++S
Sbjct: 50   ELEEIPKASDATISEEALEKIPDLKQYSRLLEDIDAKALDDIEIPEFLS 98

>YJL070C (YJL070C) [2842] chr10 complement(307887..310553) Member of
            the adenosine and AMP deaminase family, which catalyze
            hydrolytic deamination of adenosine, has low similarity
            to a region of AMP deaminase (S. cerevisiae Amd1p), which
            converts AMP to IMP and ammonia [2667 bp, 888 aa]
          Length = 888

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 1385 TVIITLLNYVDTICFNDLIMKR-NFLSWKRGLQLNYNVTRLEEWCKTHGLPDGAQYLQHL 1443
            T II L  ++  +C  DL++K  +   WK    +N    + + W      P  A Y+ ++
Sbjct: 560  TDIIGLQFFLSNVCSMDLVIKESDEYYWKEFTDMN---CKPKFWTAQGDNPTVAHYMYYI 616

Query: 1444 IQT-AKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYES 1489
             ++ AK+  LR   +++   +R  CS LS    Q  +  Y     ES
Sbjct: 617  YKSLAKVNFLRSQNLQNTITLRNYCSPLSSRTSQFGVDLYFTDQVES 663

>YDL058W (USO1) [807] chr4 (345665..351037) Coiled-coil protein with
            similarity to mammalian integrin, required for protein
            transport from ER to Golgi [5373 bp, 1790 aa]
          Length = 1790

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 91/183 (49%), Gaps = 22/183 (12%)

Query: 925  QRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLAAKVKENRQLSKRLEELQATMVTVS 984
            Q + KK + DA ++  +KE+  K E     L +++ +   E  ++ +  +E       VS
Sbjct: 1217 QSNLKKSEIDALNLQ-IKELKKKNETNEASLLESIKSVESETVKIKELQDECNFKEKEVS 1275

Query: 985  ELQDQLEAQKMENQKALADQKDGFV----LDSKS--LKDQLIKA---NKDVESVKFELAT 1035
            EL+D+L+A + +N K L  QK+       LD+K+  LK QL K    +K  E  + EL+ 
Sbjct: 1276 ELEDKLKASEDKNSKYLELQKESEKIKEELDAKTTELKIQLEKITNLSKAKEKSESELSR 1335

Query: 1036 LTAKYTEMEAESKNQLDEL-----------ERTKTLLTESKTQNSDLYSE-IKSLKEELA 1083
            L    +E    ++ QL++L           E+ + LL E  +  +  YSE I +L++EL 
Sbjct: 1336 LKKTSSEERKNAEEQLEKLKNEIQIKNQAFEKERKLLNEGSSTITQEYSEKINTLEDELI 1395

Query: 1084 HLQ 1086
             LQ
Sbjct: 1396 RLQ 1398

>KLLA0D03883g 328358..329833 weakly similar to sp|P32523 Saccharomyces
            cerevisiae YLL036c PRP19 non-snRNP sliceosome component
            required for DNA repair singleton, start by similarity
          Length = 491

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 122/296 (41%), Gaps = 43/296 (14%)

Query: 901  PRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQNLA 960
            P KA  S     I  Q LI + I Q+    +  D      L E++     ++       +
Sbjct: 10   PIKAVLSPNSKCIFEQHLIEQYIEQKGTDPITDDPLQKTDLVEIN-ATPQQISLSESLSS 68

Query: 961  AKVKENRQLSKRLEELQ----ATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLK 1016
            + +  N  +   L  LQ    A M+   EL+ QL+  K    K L+D    F   + +  
Sbjct: 69   STIANNYSIPSLLSTLQKEWDAVMLENFELRKQLDVCK----KNLSDTLYRFDAVASAAA 124

Query: 1017 DQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLL----TESKTQNSDLY 1072
               ++ ++    +K ELA LT+  T    E+   +D+L+ +  +L    +E  T++ +  
Sbjct: 125  KAFVERDQ----LKQELAELTSAITSSNVENDGTIDKLQNSDQILSDFTSELSTKSQEYV 180

Query: 1073 SEIKSLKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIP 1132
            +  K  K++L H           +N ++V  T   E  + S +     ++++ N+   + 
Sbjct: 181  TNSKKSKKKLQHF----------SNVSVVQSTDFSEIDLISRN-----QHVNLNERSVVV 225

Query: 1133 SDTAADHVSVNGYGMDDDIINTNTLTQINEELYRLLEGTDVLNNEITEGLLKGFQV 1188
             D     V    +G  D I++ +  T+       L+E  DVL    T+GLL  + +
Sbjct: 226  KDNDKAFV----FGPQDSILDVSQATE------YLVEFKDVLYT-FTQGLLAAYDL 270

>Sklu_2432.7 YNL243W, Contig c2432 14613-17960 reverse complement
          Length = 1115

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 71/147 (48%), Gaps = 30/147 (20%)

Query: 964  KENRQLSKRLEELQATMVTVSE-------LQDQLEAQKMENQKALAD---QKDGFVLDSK 1013
            +E+ QL ++ ++LQ T  +  E       L+  L+A+ +E    LAD   ++D   LD  
Sbjct: 535  QEHLQLLQKFKKLQQTASSAQEAIDKREKLERDLKAKNIE----LADLIRERDRARLDGD 590

Query: 1014 SLKDQLIKANKDVESVKFELATLTAKYTEME-----------AESKNQLDELERTKTLLT 1062
             LK      ++ ++ ++ +L  LT +  + E           A+ K +LD+L  +K L T
Sbjct: 591  RLKG---DKDRKIDDLELQLRELTRRLEDQESTHSENLSTVFAQHKRELDDL--SKRLAT 645

Query: 1063 ESKTQNSDLYSEIKSLKEELAHLQTSI 1089
            E+  Q  DL   +   +EEL  +Q S+
Sbjct: 646  EASPQLQDLQRRLHDKEEELEIVQQSM 672

>AFR670W [3863] [Homologous to ScYNL272C (SEC2) - SH]
            complement(1667974..1670127) [2154 bp, 717 aa]
          Length = 717

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 964  KENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLIKAN 1023
            +ENR++S ++  L   ++   + Q +LE Q    +KALA QKD                 
Sbjct: 14   EENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVV--------------- 58

Query: 1024 KDVESVKFELATLTAKYTEMEAESKNQLDELERTK 1058
            K  ES + E   L ++  + + E + Q +ELE  +
Sbjct: 59   KQCESARGEAQQLRSQLADRDTELERQGEELEEAR 93

>Scas_683.38
          Length = 1928

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 71/147 (48%), Gaps = 22/147 (14%)

Query: 941  LKEVSYKLENKVIQLTQNLAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQK- 999
            LKE   KL+N   QL   + AK K    ++K   EL A    +S  + +LE     NQK 
Sbjct: 804  LKEYKEKLQNIETQLQTIILAKQKAEEGVNKMNRELFA----LSREKQELEG----NQKI 855

Query: 1000 ALAD-QKDGFVLDS--KSLKDQLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELER 1056
            AL D QK   VL+   + L D+L +  KD+  +  ELATL      +E+E   +  E+E 
Sbjct: 856  ALKDLQKKTAVLEKEKRQLSDKLNEKEKDITRLNEELATLENTVKSLESEKNEKRKEVEE 915

Query: 1057 TKTLLTESKTQNSD-----LYSEIKSL 1078
             K     SK QN D     L  ++KSL
Sbjct: 916  WK-----SKFQNHDNLVPKLTDKLKSL 937

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 64/125 (51%), Gaps = 6/125 (4%)

Query: 920  RRRIAQRDFKKLKADAKSV-HHLKEVSYKLENKVIQLTQNLAAKVKENRQ--LSKRLEEL 976
            RR+I+ R F +L+++ K + HHLKE   K  N +++       K KE R   ++ +++EL
Sbjct: 353  RRKISPR-FDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKEL 411

Query: 977  QATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKDQLIKANKDVESVKFELATL 1036
              ++ T+     +L+ QK      + + ++       SL    IKA  ++E ++ EL  L
Sbjct: 412  SESINTMKASTTELKEQKSSIDVKINESENNIEELEDSLNGPGIKA--EIEDIEKELINL 469

Query: 1037 TAKYT 1041
              KYT
Sbjct: 470  RRKYT 474

>CAGL0J11660g 1133494..1135728 highly similar to sp|P04786
           Saccharomyces cerevisiae YOL006c TOP1 DNA topoisomerase
           I, hypothetical start
          Length = 744

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 106/251 (42%), Gaps = 45/251 (17%)

Query: 762 EKYQIGNTKIFF---KAGMLAYFEKLRSTKMNSAIVLIQKHIRSKYYR--KQYMLMKASL 816
           EK    N KIF    K      F++L  + +N  +      + +K +R       M+  L
Sbjct: 445 EKQVFKNLKIFKRPPKKDGDDLFDRLDPSILNKYLQNYMPGLTAKVFRTYNASKTMQDQL 504

Query: 817 SLLGAYSKGTVIRQRVEYELEQHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELE 876
            L+   ++GTV  + ++Y     A  ++        +RS   G   S+ K+  +I E L 
Sbjct: 505 DLIP--NEGTVAEKLLKYNAANRAVAILCN-----HQRSVTKGHAQSVEKMNQKIEELLW 557

Query: 877 QREMQSKYESNAAISIQSRIRAFVPRKAYESKR-----RD-TIVVQSLIRRRIAQRDFKK 930
           Q+           I ++  I    P +A ++K+      D T V Q+ I +RI  R+ ++
Sbjct: 558 QK-----------IRLKKGILQLEPSRAQKNKKYFKEINDMTKVEQATIHKRIVDRERER 606

Query: 931 LKA-----DAKSVHHLKEVSYKLE-----NKVIQLTQNLAAKVKENRQLSKRLEELQATM 980
           LK      + K V   K+   K E      KV  L +    ++K  +       EL+ATM
Sbjct: 607 LKKKFERDNEKLVAEKKDPLPKTELKEWLKKVDDLEKQYKTELKTGKV------ELKATM 660

Query: 981 VTVSELQDQLE 991
            +V +L+ Q+E
Sbjct: 661 QSVEKLEKQVE 671

>Scas_592.3
          Length = 222

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 1056 RTKTLLTESKTQNSDLYSEIKSLKEELAHL 1085
            RTK LL+E K++NSDL ++I+S    L  L
Sbjct: 44   RTKNLLSEGKSKNSDLINQIESQTSHLDQL 73

>CAGL0D05412g complement(516301..517269) similar to sp|P33759
            Saccharomyces cerevisiae YBR251w MRPS5, hypothetical
            start
          Length = 322

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 1417 LNYNVTRLEEWCKTHGLPDGAQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQ 1476
            +N+    LE++ K H   D A+   H+   +   ++RKY  +DI+  +   S L P   +
Sbjct: 64   VNFAPPYLEDYSKLHPFWDYAKNEPHIHMDSLNEEVRKYQWDDINFQQN--SKLPPGTFE 121

Query: 1477 KLISQYHVA 1485
            K I + HV 
Sbjct: 122  KEIVEAHVG 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 50,461,866
Number of extensions: 2281134
Number of successful extensions: 10743
Number of sequences better than 10.0: 392
Number of HSP's gapped: 10669
Number of HSP's successfully gapped: 649
Length of query: 1567
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1452
Effective length of database: 12,615,039
Effective search space: 18317036628
Effective search space used: 18317036628
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)