Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_663.25112994104e-53
ADR355C109953688e-47
CAGL0G06358g113993628e-46
YOR327C (SNC2)115813558e-45
KLLA0A03883g110993401e-42
YAL030W (SNC1)117783297e-41
CAGL0E05258g108703192e-39
Kwal_26.705474742832e-34
Kwal_56.23743162751346e-11
Scas_564.4*237651314e-10
KLLA0F19448g231711296e-10
YLR093C (NYV1)253611244e-09
AGR054C248751229e-09
CAGL0C00429g234571201e-08
Kwal_47.1712120058866e-04
Sklu_2258.720058840.001
AER109W20058820.002
Scas_571.120058820.002
YKL196C (YKT6)20058810.003
CAGL0D03498g20549810.003
KLLA0D02684g20049730.029
CAGL0H02739g46552650.42
ADL007C13560601.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_663.25
         (112 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_663.25                                                           162   4e-53
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   146   8e-47
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   144   8e-46
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   141   8e-45
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   135   1e-42
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   131   7e-41
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...   127   2e-39
Kwal_26.7054                                                          113   2e-34
Kwal_56.23743                                                          56   6e-11
Scas_564.4*                                                            55   4e-10
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    54   6e-10
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    52   4e-09
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    52   9e-09
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    51   1e-08
Kwal_47.17121                                                          38   6e-04
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       37   0.001
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    36   0.002
Scas_571.1                                                             36   0.002
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    36   0.003
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    36   0.003
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    33   0.029
CAGL0H02739g 248511..249908 highly similar to sp|P10507 Saccharo...    30   0.42 
ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH] (696699..69...    28   1.6  

>Scas_663.25
          Length = 112

 Score =  162 bits (410), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 81/99 (81%), Positives = 81/99 (81%)

Query: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73
           EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG
Sbjct: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73

Query: 74  ANRVRKQMWWKDLKMRACXXXXXXXXXXXXXXXXXXHFT 112
           ANRVRKQMWWKDLKMRAC                  HFT
Sbjct: 74  ANRVRKQMWWKDLKMRACLVLVIIILLVVIIVPIVVHFT 112

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
           (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
           bp, 109 aa]
          Length = 109

 Score =  146 bits (368), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 73/95 (76%), Positives = 75/95 (78%)

Query: 18  GPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRV 77
           G +SQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRV
Sbjct: 15  GAQSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRV 74

Query: 78  RKQMWWKDLKMRACXXXXXXXXXXXXXXXXXXHFT 112
           RKQMWWKDLKMR C                  HFT
Sbjct: 75  RKQMWWKDLKMRLCLVLVVVLLLIVIIVPIVVHFT 109

>CAGL0G06358g complement(612827..613168) no similarity, hypothetical
           start
          Length = 113

 Score =  144 bits (362), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 72/99 (72%), Positives = 78/99 (78%), Gaps = 1/99 (1%)

Query: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73
           +ETN  +SQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLA+SAQGFKRG
Sbjct: 16  DETNE-QSQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRG 74

Query: 74  ANRVRKQMWWKDLKMRACXXXXXXXXXXXXXXXXXXHFT 112
           ANRVRKQMW+KDLKM+ C                  HF+
Sbjct: 75  ANRVRKQMWYKDLKMKFCLFVVIICLLVAIVVPIAVHFS 113

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [348 bp, 115 aa]
          Length = 115

 Score =  141 bits (355), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 69/81 (85%), Positives = 73/81 (90%), Gaps = 3/81 (3%)

Query: 14 EETNG---PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGF 70
          EE+N    P SQ+K AAL+ EIDDTVGIMRDNINKVAERGERLTSIEDKADNLA+SAQGF
Sbjct: 14 EESNSGANPNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGF 73

Query: 71 KRGANRVRKQMWWKDLKMRAC 91
          KRGANRVRKQMWWKDLKMR C
Sbjct: 74 KRGANRVRKQMWWKDLKMRMC 94

>KLLA0A03883g join(344642..344725,344850..345098) similar to
           sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
           synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
           SNC1 synaptic vesicle-associated membrane protein, start
           by similarity
          Length = 110

 Score =  135 bits (340), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 70/99 (70%), Positives = 73/99 (73%), Gaps = 3/99 (3%)

Query: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73
           EET G    SK AALK+EIDDTV IMRDNINKVAERGERLTSI+DKADNLAVSAQGFKRG
Sbjct: 15  EETAG---DSKTAALKSEIDDTVDIMRDNINKVAERGERLTSIQDKADNLAVSAQGFKRG 71

Query: 74  ANRVRKQMWWKDLKMRACXXXXXXXXXXXXXXXXXXHFT 112
           ANRVRKQMWWKDLKMR C                  HF+
Sbjct: 72  ANRVRKQMWWKDLKMRMCLVLVVIILLIVIIVPIAVHFS 110

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [354 bp, 117 aa]
          Length = 117

 Score =  131 bits (329), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 63/78 (80%), Positives = 69/78 (88%)

Query: 14 EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73
          E     +S+S+ A L+AEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG
Sbjct: 18 ERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 77

Query: 74 ANRVRKQMWWKDLKMRAC 91
          ANRVRK MW+KDLKM+ C
Sbjct: 78 ANRVRKAMWYKDLKMKMC 95

>CAGL0E05258g complement(511027..511353) highly similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2, start
          by similarity
          Length = 108

 Score =  127 bits (319), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 67/70 (95%)

Query: 22 QSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQM 81
          QSKAAALK+EIDDTV IMR+NINKVAERGE LTSI+DKADNLA+SAQGFKRGANRVR+QM
Sbjct: 18 QSKAAALKSEIDDTVDIMRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQM 77

Query: 82 WWKDLKMRAC 91
          W+KDLKMR C
Sbjct: 78 WYKDLKMRMC 87

>Kwal_26.7054
          Length = 74

 Score =  113 bits (283), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/74 (72%), Positives = 55/74 (74%)

Query: 39  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRACXXXXXXX 98
           MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR C       
Sbjct: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLVVII 60

Query: 99  XXXXXXXXXXXHFT 112
                      HF+
Sbjct: 61  LLVVIIVPIVVHFS 74

>Kwal_56.23743
          Length = 162

 Score = 56.2 bits (134), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%)

Query: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73
           EE         A A + ++ D + +M DNI+K  +R ER++ + D+   L  S+  FKR 
Sbjct: 66  EELLSFHDPGAAEATEQDLQDIIHLMNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRK 125

Query: 74  ANRVRKQMWWKDLKM 88
           A R++ +MWW+++K+
Sbjct: 126 AVRIKTKMWWQNVKL 140

>Scas_564.4*
          Length = 237

 Score = 55.1 bits (131), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 43/65 (66%)

Query: 23  SKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMW 82
           S+ A+ + ++ D V IM +NI+K  ER ER++ + DK   L  ++  FK+ A R++++MW
Sbjct: 150 SEGASTENDLQDVVNIMNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKERMW 209

Query: 83  WKDLK 87
           W+ +K
Sbjct: 210 WQRMK 214

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 54.3 bits (129), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 45/71 (63%)

Query: 20  ESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRK 79
           E Q  AA+ + E+ + + IM DNI+K  +R ER++ + D  + L  ++  F+R ++++ +
Sbjct: 142 EGQQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVDNTNQLNENSFKFQRKSSKIMR 201

Query: 80  QMWWKDLKMRA 90
           +MWW ++K  +
Sbjct: 202 KMWWNNVKFYS 212

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 52.4 bits (124), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%)

Query: 27  ALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDL 86
           A + +I D + IM DNI+K  ER ER++ + DK   L  S+  F+R A  +++ MWW+ +
Sbjct: 170 ATEDQIKDVIQIMNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKV 229

Query: 87  K 87
           K
Sbjct: 230 K 230

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 42/75 (56%)

Query: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRG 73
           +E       + + A   ++   V +M DNI+K  +R ER++ + D+   L  S+  F+R 
Sbjct: 153 QELLSYHDPTSSNATDQDLQTIVSVMNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRK 212

Query: 74  ANRVRKQMWWKDLKM 88
           A R++++MWW ++K 
Sbjct: 213 AVRIKRKMWWNNIKF 227

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 50.8 bits (120), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 40/57 (70%)

Query: 31  EIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLK 87
           ++ + + IM DNI+K  ER ER++ + DK  +L  +++ FKR A +++++MWW+ +K
Sbjct: 155 DMQEVIQIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>Kwal_47.17121
          Length = 200

 Score = 37.7 bits (86), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%)

Query: 19  PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           P        ++ E+D+T  ++   I  V +RGERL ++ DK+++L+ S++ F + A +
Sbjct: 135 PSQADSIMRVQQELDETKIVLHKTIESVLQRGERLDNLVDKSESLSASSRMFYKQAKK 192

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%)

Query: 19  PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           P        ++ E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 135 PSQADSIMKVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%)

Query: 19  PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           P        ++ E+D+T  ++   I  V +RGE+L ++ DK+++L+ S++ F + A +
Sbjct: 135 PSQADSIMRVQQELDETKIVLHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKK 192

>Scas_571.1
          Length = 200

 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%)

Query: 19  PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           P        ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 135 PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 35.8 bits (81), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%)

Query: 19  PESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           P        ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 135 PSQADAIMKVQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 35.8 bits (81), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 28  LKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           ++ E+D+T  ++   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 149 VQQELDETKIVLHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 197

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 32.7 bits (73), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 32/49 (65%)

Query: 28  LKAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 76
           ++ E+D+T   +   I  V +RGE+L ++ DK+++L+ +++ F + A +
Sbjct: 144 VQQELDETKITLHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKK 192

>CAGL0H02739g 248511..249908 highly similar to sp|P10507
           Saccharomyces cerevisiae YLR163c MAS1, start by
           similarity
          Length = 465

 Score = 29.6 bits (65), Expect = 0.42,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 14  EETNGPESQSKAAALKAEIDDTVGIMRDNINKVAERGERLTSIE--DKADNL 63
           +E N  ++Q KAA L + +DDT  I+ D   ++   G+RL+  E  +K DN+
Sbjct: 374 DEVNRSKAQLKAALLLS-LDDTTAILEDIGRQIVTTGKRLSPEEVFEKVDNI 424

>ADL007C [1735] [Homologous to ScYIL004C (BET1) - SH]
          (696699..697106) [408 bp, 135 aa]
          Length = 135

 Score = 27.7 bits (60), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 21 SQSKAAALKAEIDDTVGIMRDNINKVAERGERL-TSIEDKADNLAVSAQGFKRGANRVRK 79
          SQS  A L+++ D  VG+MR+ I  +    ER+   I   +  L      F   AN++++
Sbjct: 40 SQSTLAQLESQSDADVGVMREKIMALKTLSERMGEEIRGSSKTLDSLGSTFDATANKLKR 99

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,272,590
Number of extensions: 69219
Number of successful extensions: 260
Number of sequences better than 10.0: 29
Number of HSP's gapped: 260
Number of HSP's successfully gapped: 29
Length of query: 112
Length of database: 16,596,109
Length adjustment: 82
Effective length of query: 30
Effective length of database: 13,757,433
Effective search space: 412722990
Effective search space used: 412722990
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)