Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_663.2473773728250.0
YOR329C (SCD5)8725749291e-113
CAGL0E05302g8295378701e-105
Kwal_26.70526326497521e-89
KLLA0F02596g6584476456e-74
ADR356C8064285912e-65
YIR006C (PAN1)148047741.2
YNL197C (WHI3)66148693.6
Sklu_2257.3144526669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_663.24
         (737 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_663.24                                                          1092   0.0  
YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy...   362   e-113
CAGL0E05302g complement(514064..516553) weakly similar to sp|P34...   339   e-105
Kwal_26.7052                                                          294   1e-89
KLLA0F02596g 235864..237840 some similarities with sp|P34758 Sac...   253   6e-74
ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH] (1333929..1...   232   2e-65
YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein in...    33   1.2  
YNL197C (WHI3) [4404] chr14 complement(267607..269592) Protein t...    31   3.6  
Sklu_2257.3 YIR006C, Contig c2257 2908-7245                            30   9.2  

>Scas_663.24
          Length = 737

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/737 (77%), Positives = 569/737 (77%)

Query: 1   MSFDWLNIPGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSFDFGFPMNGNNTGL 60
           MSFDWLNIPGL                                 VSFDFGFPMNGNNTGL
Sbjct: 1   MSFDWLNIPGLNTEDNTNINNNNNTGASTNNGPGGLNGSLGPPSVSFDFGFPMNGNNTGL 60

Query: 61  PTMDQSVRSQSDTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYI 120
           PTMDQSVRSQSDTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYI
Sbjct: 61  PTMDQSVRSQSDTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYI 120

Query: 121 IAKTHGKLVRLMDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQ 180
           IAKTHGKLVRLMDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQ
Sbjct: 121 IAKTHGKLVRLMDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQ 180

Query: 181 NVLPTRKMILDKAXXXXXXXXXXXSTDNDQEVYEEVDEDTPXXXXXXXXXXGKVDFDSFT 240
           NVLPTRKMILDKA           STDNDQEVYEEVDEDTP          GKVDFDSFT
Sbjct: 181 NVLPTRKMILDKAPIPKPKPIITISTDNDQEVYEEVDEDTPNTANGNNNENGKVDFDSFT 240

Query: 241 SLLLTGRTAXXXXXXXXXNAVFKNKRVRFAEHITFQEPPKPXXXXXXXXXXXXXXXXXXX 300
           SLLLTGRTA         NAVFKNKRVRFAEHITFQEPPKP                   
Sbjct: 241 SLLLTGRTARKRIRRKIKNAVFKNKRVRFAEHITFQEPPKPNSGNENNNNNAMILNQTTN 300

Query: 301 XXXMDDSSSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNXXXXXXXXXXXXXDM 360
              MDDSSSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPN             DM
Sbjct: 301 NNNMDDSSSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNEQQETEEEKEVLEDM 360

Query: 361 KDSLSHFKNITTVDSATLLPDSTSTMQPMYMXXXXXXXXXXXPSMNQVPLQPLKPTATGS 420
           KDSLSHFKNITTVDSATLLPDSTSTMQPMYM           PSMNQVPLQPLKPTATGS
Sbjct: 361 KDSLSHFKNITTVDSATLLPDSTSTMQPMYMNNENNALNQNNPSMNQVPLQPLKPTATGS 420

Query: 421 ANHLFRQEFAQNTNPISDSNQMPLQPLKPTATGSANYLFRSYFEXXXXXXXXXXXXXXXX 480
           ANHLFRQEFAQNTNPISDSNQMPLQPLKPTATGSANYLFRSYFE                
Sbjct: 421 ANHLFRQEFAQNTNPISDSNQMPLQPLKPTATGSANYLFRSYFEQPTQNQTTQQAQPPQT 480

Query: 481 XXXSNMNTLQLHPTATGSANYLMKQQGPTPSQGIRNETSPIQTPNIFVSPQTTGQFMNMN 540
              SNMNTLQLHPTATGSANYLMKQQGPTPSQGIRNETSPIQTPNIFVSPQTTGQFMNMN
Sbjct: 481 NNNSNMNTLQLHPTATGSANYLMKQQGPTPSQGIRNETSPIQTPNIFVSPQTTGQFMNMN 540

Query: 541 PSQHNTYLQQPQSHMNTLQQQNTYPGRFPPTQVHNQPQPSNNNLLAPTNAGNSYLQALLS 600
           PSQHNTYLQQPQSHMNTLQQQNTYPGRFPPTQVHNQPQPSNNNLLAPTNAGNSYLQALLS
Sbjct: 541 PSQHNTYLQQPQSHMNTLQQQNTYPGRFPPTQVHNQPQPSNNNLLAPTNAGNSYLQALLS 600

Query: 601 HSPSPSTSQLNLPTIXXXXXXXXXXXXHLRYNTTYQQPNGTTLXXXXXXXXMVSYGXXXX 660
           HSPSPSTSQLNLPTI            HLRYNTTYQQPNGTTL        MVSYG    
Sbjct: 601 HSPSPSTSQLNLPTINQQNNSNANQSSHLRYNTTYQQPNGTTLQYQQPQQQMVSYGQNPN 660

Query: 661 XXXXXXXXXXXXXXXXNVRFAAAPSSYNGAPMQGYPNNTTLQGNRPHSQSQGSEEILSNY 720
                           NVRFAAAPSSYNGAPMQGYPNNTTLQGNRPHSQSQGSEEILSNY
Sbjct: 661 QMLPPLPQQQHQSQHQNVRFAAAPSSYNGAPMQGYPNNTTLQGNRPHSQSQGSEEILSNY 720

Query: 721 RSLQNQVNSLQNTYGRI 737
           RSLQNQVNSLQNTYGRI
Sbjct: 721 RSLQNQVNSLQNTYGRI 737

>YOR329C (SCD5) [5110] chr15 complement(936726..939344) Multicopy
           suppressor of lethality caused by clathrin deficiency
           [2619 bp, 872 aa]
          Length = 872

 Score =  362 bits (929), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 250/574 (43%), Positives = 307/574 (53%), Gaps = 77/574 (13%)

Query: 1   MSFDWLNIPGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSFDFGFPMNGNNTGL 60
           MSFDWLN+PGL                                 VSFDFG      NT  
Sbjct: 1   MSFDWLNVPGLDLSSGDQAEKRPSNGLGPPS-------------VSFDFGI-----NTAA 42

Query: 61  PT----MDQSVRSQSDTSIV---NMSSTDA-----VSD-------------------YSE 89
           P      DQ  RS SDT++    N S+T A     VS                    Y+E
Sbjct: 43  PHDSSFWDQGSRSHSDTTLSYRNNHSNTAADNATNVSSPQKDNPPNGEVRTLSGGDVYAE 102

Query: 90  TSDDLRVPLSLSQTQLTNEELRTYLRWYNYIIAKTHGKLVRLMDVFKFLCNFNITDQLKN 149
           + +D++VPLSLSQ QLT+EE+RTYLRWY+YI  +THGKLVRL DVF+FL NFN++ ++K+
Sbjct: 103 SPEDMQVPLSLSQNQLTHEEIRTYLRWYHYICLRTHGKLVRLNDVFRFLTNFNLSQKVKD 162

Query: 150 RIMAIFRSCKNALNIGQFFAVLRLVSKALLQNVLPTRKMILDKAXXXXXXXXXXXSTDND 209
           RI+ IFRSCKNALNIGQFFAVLRLVS+A++  +LP R+MIL+KA                
Sbjct: 163 RIVEIFRSCKNALNIGQFFAVLRLVSRAIIYGILPLRRMILEKAPVPKPRPILSS----- 217

Query: 210 QEVYEEVDEDTPXXXXXXXXXXGKVDFDSFTSLLLTGRTAXXXXXXXXXNAVFKNKRVRF 269
            E +EEV E+             KVDFDSF SLLLTG+T          N  FK+K+VRF
Sbjct: 218 -ENHEEVYEEVEDDDSSAKTGDQKVDFDSFASLLLTGKTTRKRVRRRIKNLNFKSKKVRF 276

Query: 270 AEHITFQEPPKPXXXXXXXXXXXXXXXXXXXXXXMDDSSSAVPQGPLDLSLPMDQLLKQM 329
           +EHITFQ+PP                         D+   +    PLD +LPMDQLLK++
Sbjct: 277 SEHITFQDPPN-----LNQESSNNSEARKQDPDAEDEDQDSNNDSPLDFTLPMDQLLKRL 331

Query: 330 ALRKKNNSALVSTLPNXXXXXXXXXXXXXDMKDSLSHFKNITTVDSATLLPDSTSTMQPM 389
             R+K NS LVS+LP+             DMKDSLSHFK I TVDSA+ LP S+  +Q  
Sbjct: 332 YKRRK-NSGLVSSLPSEQQETEEEKKVLEDMKDSLSHFKQIQTVDSAS-LPISSVFLQNG 389

Query: 390 YMXXXXXXXXXXXPSMNQVPLQPLKPTATGSANHLFRQEFAQNTNPISDSNQMPLQPLKP 449
                        P   Q+PL+PLKPTATGSANHL R+E+ Q  +P + + Q  LQPLKP
Sbjct: 390 NTLPTSNVNNTTVPQ--QLPLEPLKPTATGSANHLVREEYNQGLHPSNGAIQTGLQPLKP 447

Query: 450 TATGSANYLFRSYFEXXXXXXXXXXXXXXXXXXXSNMNTLQ-LHPTATGSANYLMKQQGP 508
           TATGSANYL RS+ E                   +N   LQ L PTATGSANYLMKQ   
Sbjct: 448 TATGSANYLMRSHME-----QPQSIKPSSTPETVTNSGGLQPLKPTATGSANYLMKQHI- 501

Query: 509 TPSQGIRNETSPI---QTPNIFVSPQTTG-QFMN 538
             S  + N  S +   Q  N   SPQ+TG  F+N
Sbjct: 502 --SPSVNNPVSSMFQAQFTNQSSSPQSTGPAFLN 533

>CAGL0E05302g complement(514064..516553) weakly similar to sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency, start by similarity
          Length = 829

 Score =  339 bits (870), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 222/537 (41%), Positives = 275/537 (51%), Gaps = 104/537 (19%)

Query: 1   MSFDWLNIPGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSFDFGFPMNGNNT-G 59
           MSFDWLN+PGL                                 VSFDFG   + +   G
Sbjct: 1   MSFDWLNVPGLNTATDDRQNSTLPT-------------------VSFDFGVTDDSSKEQG 41

Query: 60  LPTMDQSVRSQSDTSIVNM------------------------SSTDAVS---------- 85
           +  +D++++S SD S+V                           S +A++          
Sbjct: 42  MHFLDETMKSSSDPSLVRKLDEANSKLDVPPVSGAYLQQNGLHRSQEALATEEDHKTQKS 101

Query: 86  ----------------DYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYIIAKTHGKLV 129
                            Y ET DDLRVPLSLSQ QLT+EELRTY+RWYNYI A+THGKL+
Sbjct: 102 NINGNRYHNPIHEEEDSYVETPDDLRVPLSLSQNQLTHEELRTYIRWYNYITARTHGKLI 161

Query: 130 RLMDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQNVLPTRKMI 189
           +L DVF+FL NFN+ ++LK RI  IFRSCKNALNIGQFFAVLRL+++A+L+++LP+RKMI
Sbjct: 162 KLADVFQFLANFNVREELKKRIFKIFRSCKNALNIGQFFAVLRLLARAMLEDMLPSRKMI 221

Query: 190 LDKAXXXXXXXXXXXSTDNDQEVYEEVDEDTPXXXXXXXXX----XGKVDFDSFTSLLLT 245
           L+KA              N  E YEEV+ED P               KVDFDSF SLLLT
Sbjct: 222 LEKAPIPRPRPILNKEGGN--EFYEEVEEDVPASSGTTTSNNQPPGEKVDFDSFASLLLT 279

Query: 246 GRTAXXXXXXXXXNAVFKNKRVRFAEHITFQEPPKPXXXXXXXXXXXXXXXXXXXXXXMD 305
           G+T          N+VFKNK+VRFAE +TFQ+ P                         D
Sbjct: 280 GKTVRKRIRRKVKNSVFKNKKVRFAEKVTFQDAPH-YGKDKQNKDTSTTTDDDSSYVSTD 338

Query: 306 DSSSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNXXXXXXXXXXXXXDMKDSLS 365
           +        PLDLSLPMDQLLK +A RKK NSALVS++P              DMKDSLS
Sbjct: 339 E--------PLDLSLPMDQLLKVIAKRKK-NSALVSSVPTEQQETEEEREILSDMKDSLS 389

Query: 366 HFKNITTVDSATLLPDSTSTMQPMYMXXXXXXXXXXXP-----SMNQVP-LQPLKPTATG 419
           HFK I   DS T +P   +  Q   +           P     S  Q P L+PLKPTATG
Sbjct: 390 HFKQIQGPDSVTQIPPLVAQGQQSTIFNTGYKVTGDQPPAQTTSQPQEPVLEPLKPTATG 449

Query: 420 SANHLFRQEFAQNTNPIS-DSN--QMP---------LQPLKPTATGSANYLFRSYFE 464
           SANHL +   + N+ P + DS   Q+P         L+PLKPTATGSANYL +  F+
Sbjct: 450 SANHLMKSHMSPNSIPGAFDSQPVQVPAIQATSSDVLEPLKPTATGSANYLMKQQFK 506

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 22/25 (88%)

Query: 713 SEEILSNYRSLQNQVNSLQNTYGRI 737
           +++IL + +SL+NQV++LQN YGR+
Sbjct: 805 TQDILGDLQSLKNQVDALQNQYGRL 829

>Kwal_26.7052
          Length = 632

 Score =  294 bits (752), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 241/649 (37%), Positives = 316/649 (48%), Gaps = 149/649 (22%)

Query: 1   MSFDWLNIPGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSFDFGFPMNGNNTGL 60
           MSFDWLN+PGL                                 VSF+FG      N  L
Sbjct: 1   MSFDWLNVPGLPSDDGDYAGASEPPPS-----------------VSFNFG------NVSL 37

Query: 61  PTMDQSVRSQSDTSIVNMSSTDAVS----------------DYSETSDDLRVPLSLSQTQ 104
             ++Q  +S + T    ++ST   S                +Y+ET +DL+VPLSLS++Q
Sbjct: 38  EPVEQRSQSITTTKHDRVNSTHEASQVSNRTQDHHGESQLVNYAETKEDLQVPLSLSKSQ 97

Query: 105 LTNEELRTYLRWYNYIIAKTHGKLVRLMDVFKFLCNFNITDQLKNRIMAIFRSCKNALNI 164
           LT EE RTYLRWY YI ++   KL+ L D+F+F+ NF + +  K RI  IF++C+N+LNI
Sbjct: 98  LTREEARTYLRWYGYISSRKEAKLISLDDIFRFMGNFPLAEMAKERIERIFKTCRNSLNI 157

Query: 165 GQFFAVLRLVSKALLQNVLPTRKMILDKAXXXXXXXXXXXSTDNDQEVYEEVDE--DTPX 222
           GQFFA+LRL+S+AL +NV+P R+MI   A               ++EVYEEV++  D P 
Sbjct: 158 GQFFAILRLISRALTENVMPMRRMISQAAPVPKPKSILAAG---NEEVYEEVEDSQDGPE 214

Query: 223 XXXXXXXXXGKVDFDSFTSLLLTGRTAXXXXXXXXXNAVFKNKRVRFAEH-ITFQEPPKP 281
                     KVDFDSF SLLLTG+           N   K KRVRF +  +TFQ+  +P
Sbjct: 215 L---------KVDFDSFASLLLTGQK-KKKMRRRITNHHKKQKRVRFTDKLVTFQDHAQP 264

Query: 282 XXXXXXXXXXXXXXXXXXXXXXMDDSSS---AVPQG--PLDLSLPMDQLLKQMALRKKNN 336
                                  D+++S    VP    PLDLSLPMDQLLK++A R +NN
Sbjct: 265 KT---------------------DENASEGNGVPDDNEPLDLSLPMDQLLKKLAAR-RNN 302

Query: 337 SALVSTLPNXXXXXXXXXXXX-XDMKDSLSHFKNITTVDSATL--LPDSTSTMQPMYMXX 393
           SALVS  P+              DM++SL+HF+ I  VDS ++  LP   ST+Q   +  
Sbjct: 303 SALVSKPPSEQEPESQEEKEVLDDMRESLNHFQQIHNVDSVSVGGLPAQVSTVQKNAVAE 362

Query: 394 XXXXXXXXXPSMNQVPLQPLKPTATGSANHLFRQEFAQNTNPISDSNQMPLQPLKPTATG 453
                           L+PLKPTATGSAN+LFR    Q T  ++ S   PLQPLKPTATG
Sbjct: 363 NH--------------LEPLKPTATGSANYLFRSS-QQQTPQVTISE--PLQPLKPTATG 405

Query: 454 SANYLFRSYFEXXXXXXXXXXXXXXXXXXXSNMNTLQLHPTATGSANYLMKQQGPTPSQG 513
           SANYLFRS                         +   L P  T  A+     Q P     
Sbjct: 406 SANYLFRS-----------------SQQSAPAADQKPLQPIKTNGAD-----QAP----- 438

Query: 514 IRNETSPIQTPNIFVSPQTTGQFMNMNPSQHN-------TYLQQPQSHMNTLQQQNTYPG 566
             N   P+Q PNI      TG      P+ H+          QQP +  N  Q  N  P 
Sbjct: 439 --NFLQPLQ-PNISSKSSQTG-----TPAMHHFSGQPLQPTAQQPNTFGNAHQTPNLLP- 489

Query: 567 RFPPTQVHN-QPQPSN-NNLLAPTNAGNSYLQALLSHSPSPSTSQLNLP 613
             PP +     PQP+N +  L+P    N+Y QALLS+SPSP+TS ++LP
Sbjct: 490 --PPRKDFGLSPQPTNQSQQLSPNMTANNYFQALLSNSPSPNTSTMHLP 536

>KLLA0F02596g 235864..237840 some similarities with sp|P34758
           Saccharomyces cerevisiae YOR329c SCD5 suppressor of
           clathrin deficiency singleton, hypothetical start
          Length = 658

 Score =  253 bits (645), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 167/447 (37%), Positives = 232/447 (51%), Gaps = 40/447 (8%)

Query: 72  DTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYIIAKTHGKLVRL 131
           D ++ + S +D  S Y ET+ +L+VPL++ + QLT +E + YLRW+  + ++ H + + L
Sbjct: 83  DGALHSHSESDIASSYVETAQELQVPLAVPEFQLTPDERKAYLRWFRDLSSRIHSRPITL 142

Query: 132 MDVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALLQNVLPTRKMILD 191
            DVF FL NF I D +K RI  IFR+C+ A+N  QF+A++RLV+  L Q+ LPTR MI +
Sbjct: 143 DDVFNFLANFRIDDTIKERITHIFRTCRYAVNEEQFYAIIRLVAHGLQQHFLPTRSMIPE 202

Query: 192 KAXXXXXXXXXXXSTDNDQEVYEEVDEDTPXXXXXXXXXXGKVDFDSFTSLLLTGRTAXX 251
           KA           S +  QEVYEEV+ED             KVDFD F SLLLTG+    
Sbjct: 203 KA--PVLRPKSILSANAGQEVYEEVEEDP------NNATDKKVDFDGFASLLLTGKAIQK 254

Query: 252 XXXXXXXNAVFKNKRVRFAEH-ITFQEPPKPXXXXXXXXXXXXXXXXXXXXXXMDDSSSA 310
                      + K+VRF+++ +TF                              D++++
Sbjct: 255 NIRRRIMKRRDQIKKVRFSKNLVTF-------ANDLSTKAMSSISRSGKPAVTAPDNAAS 307

Query: 311 VPQGP-----LDLSLPMDQLLKQMALRKKNNSALVSTLP-NXXXXXXXXXXXXXDMKDSL 364
               P     LDLSLPM+QLL +++ R +NNSALV  LP +             DMKDSL
Sbjct: 308 TESSPSDDSTLDLSLPMEQLLAKLSSRNRNNSALVKELPSDTQPETQEEREVLEDMKDSL 367

Query: 365 SHFKNITTVDSATLLPDSTSTMQPMYMXXXXXXXXXXXPSMNQVPLQPLKPTATGSANHL 424
           SHF+ I  VDS T LP++ S+ +                   +  L+PLKPTATGSAN+L
Sbjct: 368 SHFRQIQKVDSVTQLPNNMSSYESSNSSG------------REQALEPLKPTATGSANYL 415

Query: 425 FRQEF--AQNTNPISDSNQMPLQPLKPTATGSANYLFRSYFEXXXXXXXXXXXXXXXXXX 482
           FRQ    + N +   + N + L+PLKPTATGSAN +F++ F                   
Sbjct: 416 FRQTVPPSHNIDANKNDNHI-LEPLKPTATGSANEIFKNIFRRSKPAEHLPQQGRTAPFV 474

Query: 483 XSNMN---TLQLHPTATGSANYLMKQQ 506
                   T  + PT+TGSANYLMKQQ
Sbjct: 475 PPQRKVQFTEAMKPTSTGSANYLMKQQ 501

>ADR356C [2097] [Homologous to ScYOR329C (SCD5) - SH]
           (1333929..1336349) [2421 bp, 806 aa]
          Length = 806

 Score =  232 bits (591), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/428 (35%), Positives = 204/428 (47%), Gaps = 70/428 (16%)

Query: 1   MSFDWLNIPGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSFDFGFPMNGNNTGL 60
           MSFDWLN+PGL                                 VSF+F           
Sbjct: 1   MSFDWLNVPGLNVKDGPESSAGSAPPPT----------------VSFNFS---------- 34

Query: 61  PTMDQSVRSQSDTSIVNMSSTDAVSDYSETSDDLRVPLSLSQTQLTNEELRTYLRWYNYI 120
                    Q +       + D   +Y ET++DLRVPLSLS +QL  EEL+TY  WY  +
Sbjct: 35  -------EEQREDESAGRRTQDTQEEYRETAEDLRVPLSLSGSQLAPEELKTYRLWYKCM 87

Query: 121 IAKTHGKLVRLM-DVFKFLCNFNITDQLKNRIMAIFRSCKNALNIGQFFAVLRLVSKALL 179
           +++   + +RL  D+F+FL NF ++D +K R  +IFR+C+ A++ GQF+A++R ++ AL 
Sbjct: 88  VSRRRSRTLRLEEDIFRFLGNFQLSDSVKERTRSIFRTCQMAVSPGQFYAIMRTIAHALQ 147

Query: 180 QNVLPTRKMILDKAXXXXXXXXXXXSTDNDQEVYEEVDEDTPXXXXXXXXXXGKVDFDSF 239
            NVLPTR+MIL++A           S D   E YEEV+ED             +VDFDSF
Sbjct: 148 ANVLPTRRMILERAAVPEPRSIL--SLDAGPETYEEVEED------PKSAADNRVDFDSF 199

Query: 240 TSLLLTGRTAXXXXXXXXXNAVFKNKRVRFAEH-ITFQEPPKPXXXXXXXXXXXXXXXXX 298
            SLLLTG+T              + K+V F+E+ +TF E                     
Sbjct: 200 ASLLLTGKTVRKNIRRKINKRNGRVKKVSFSENLVTFHE-----------------ELPE 242

Query: 299 XXXXXMDDSSSAVPQGPLDLSLPMDQLLKQMALRKKNNSALVSTLPNXXXXXXXXXXXXX 358
                     S  P  PLD S+PMDQLLK+MA RK  N+ALVS  P              
Sbjct: 243 EEAAEDAADGSEDPNEPLDFSMPMDQLLKKMAERKTRNTALVSEAPK-QPETVEEREELA 301

Query: 359 DMKDSLSHFKNITTVDSATLLPDSTSTMQPMYMXXXXXXXXXXXPSMNQVPLQPLKPTAT 418
           DM+DSL+HFK+I T D+      +  +    YM            S  +  L+PLKPTAT
Sbjct: 302 DMRDSLNHFKHIQTADNV-----AQGSFATQYMASVSSNAD----SGEEPALEPLKPTAT 352

Query: 419 GSANHLFR 426
           GSANHLFR
Sbjct: 353 GSANHLFR 360

>YIR006C (PAN1) [2671] chr9 complement(365463..369905) Protein
           involved in organization of the actin cytoskeleton and
           in endocytosis, binds to the ARP2/3 complex to stimulate
           actin polymerization [4443 bp, 1480 aa]
          Length = 1480

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 24/47 (51%), Gaps = 14/47 (29%)

Query: 410 LQPLKPTATGSANHLFRQEFAQNTNPISDSNQMPLQPLKPTATGSAN 456
           LQPLKP  TG     + Q            NQ PL+PLKPTATG  N
Sbjct: 213 LQPLKPQQTG----FYLQP----------QNQAPLEPLKPTATGFVN 245

>YNL197C (WHI3) [4404] chr14 complement(267607..269592) Protein that
           downregulates Cln3p function and is involved in
           sporulation, filamentous growth, and regulation of cell
           size, contains one RNA recognition motif (RRM) domain
           [1986 bp, 661 aa]
          Length = 661

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 537 MNMNPSQHNTYLQQPQ-SHMNTLQQQNTYPGRFPPTQVHNQPQPSNNN 583
           MN+ P + N ++QQPQ  HM  + Q NT P + PP ++ +      NN
Sbjct: 452 MNITPQKQNRFMQQPQPEHMYPVNQSNT-PQKVPPARLSSSRNSHKNN 498

>Sklu_2257.3 YIR006C, Contig c2257 2908-7245
          Length = 1445

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 16/26 (61%)

Query: 431 QNTNPISDSNQMPLQPLKPTATGSAN 456
           Q T   S   Q PL+PLKPTATG  N
Sbjct: 146 QQTGFYSQGQQQPLEPLKPTATGFVN 171

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.128    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,574,169
Number of extensions: 750930
Number of successful extensions: 2432
Number of sequences better than 10.0: 64
Number of HSP's gapped: 2428
Number of HSP's successfully gapped: 74
Length of query: 737
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 628
Effective length of database: 12,822,747
Effective search space: 8052685116
Effective search space used: 8052685116
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)