Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_663.230424010111e-138
YAL025C (MAK16)3062409151e-124
CAGL0G06248g2972408431e-113
KLLA0A04037g3022417911e-105
ADR349W3202407871e-104
Kwal_26.70822992407367e-97
CAGL0F00715g3102046412e-82
Sklu_2389.276784629.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_663.2
         (304 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_663.2                                                            394   e-138
YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   357   e-124
CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   329   e-113
KLLA0A04037g complement(359981..360889) some similarities with s...   309   e-105
ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   307   e-104
Kwal_26.7082                                                          288   7e-97
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   251   2e-82
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            28   9.4  

>Scas_663.2
          Length = 304

 Score =  394 bits (1011), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/240 (80%), Positives = 194/240 (80%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60
           MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120
           YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120

Query: 121 TERRLAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 180
           TERRLAMREEERHYVGVAPKVKRREQN                    DRLKSGAYGDKPL
Sbjct: 121 TERRLAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVLGHLXXXXXXXXXXXXXXXXXXXXXXXXXXYVADDAEGEYVDVDDLEKWL 240
           NVDEKIWKKVLGHL                          YVADDAEGEYVDVDDLEKWL
Sbjct: 181 NVDEKIWKKVLGHLDEEQEEEEEEDWDEEEEEESDEGEVEYVADDAEGEYVDVDDLEKWL 240

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  357 bits (915), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 184/240 (76%), Gaps = 2/240 (0%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60
           MSDEIVWQVINQSFCSHRIK+P+GQ FCR+ YNVTGLCTRQSCPLANSKYATV+ D G++
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120
           YLYMKTPERAHTPAKLWERIKLSKNY+KAL+QIDEHLLHW  FF HKCKQRFTKLTQV I
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120

Query: 121 TERRLAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 180
           TERRLA+REEERHYVGVAPKVKRREQN                    DRLKSGAYGDKPL
Sbjct: 121 TERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVLGHLXXXXXXXXXXXXXXXXXXXXXXXXXXYVADDAEGEYVDVDDLEKWL 240
           NVDEK+WKK++G +                          YVADD EGEYVDVDDLEKWL
Sbjct: 181 NVDEKVWKKIMGQM--EEENSQDEEEDWDEEEESDDGEVEYVADDGEGEYVDVDDLEKWL 238

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  329 bits (843), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 180/240 (75%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60
           MSDEIVWQVINQ FC++++K+  GQTFCR+ YNVTGLC+RQSCPLANSKYATV+++ GR+
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120
           YLY++T ERAHTPAK WE+I+LSKNYSKALKQID+HLL+W  F IHKCKQRFTKLTQVAI
Sbjct: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120

Query: 121 TERRLAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 180
           TERRLAMRE ERHYVGVAPKVKRRE+N                    DRLKSGAYGDKP+
Sbjct: 121 TERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAYGDKPM 180

Query: 181 NVDEKIWKKVLGHLXXXXXXXXXXXXXXXXXXXXXXXXXXYVADDAEGEYVDVDDLEKWL 240
           NVDEKIWKKV+GHL                          YV DD E E+VD++DLE+WL
Sbjct: 181 NVDEKIWKKVMGHLKDENDQEEEEDWESEEEEESDEGEVEYVEDDGEAEFVDMEDLEQWL 240

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  309 bits (791), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 173/241 (71%), Gaps = 3/241 (1%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60
           MSDEI+WQVINQ FC++++K+  GQ FCR+ YNVTGLC+RQ+CPLANSKYATV+   G +
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120
           YLYMKT ERAHTPAKLWER+KLSKNY+KAL QIDEHLL+W  F IHKCKQR TKLTQV I
Sbjct: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120

Query: 121 TERRLAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 180
           TERRLA+REEERHYVG+APKVKRRE+N                    +RLKSG YGDKPL
Sbjct: 121 TERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVYGDKPL 180

Query: 181 NVDEKIWKKVLGHLXXXXXXXXXXXXXXXXXXXXXXXXXXYVAD-DAEGEYVDVDDLEKW 239
           NVDEKIWKKV+G +                          +V D DAE E VD++DLEKW
Sbjct: 181 NVDEKIWKKVMGRV--EDEDLDEEENDWDEEEESDEGEVEFVEDEDAEDEMVDMEDLEKW 238

Query: 240 L 240
           L
Sbjct: 239 L 239

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  307 bits (787), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/240 (61%), Positives = 171/240 (71%), Gaps = 4/240 (1%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60
           MSDEI+WQVINQ FC+++IK+  GQ FCR+ YNVTG C R SCPLAN+KYATV+   G++
Sbjct: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120
           YLYMKT ERAHTPAKLWERI+LSKNYS ALKQIDEHLL W  F IHKCKQR TKLTQV I
Sbjct: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141

Query: 121 TERRLAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 180
           TERR+A+REEERHYVGVAPKVKRR++N                    DRLKSGAYGDKPL
Sbjct: 142 TERRMALREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 201

Query: 181 NVDEKIWKKVLGHLXXXXXXXXXXXXXXXXXXXXXXXXXXYVADDAEGEYVDVDDLEKWL 240
           NVDEKIWK+V+GH+                          YV DD E + V+V+DL++WL
Sbjct: 202 NVDEKIWKRVMGHV----EQEQEQDEDYDEDEESDLGEVEYVEDDGEDDLVEVEDLQRWL 257

>Kwal_26.7082
          Length = 299

 Score =  288 bits (736), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 174/240 (72%), Gaps = 5/240 (2%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60
           MSDEI+WQVINQ FC++++K+  GQ FCR+ YNVTGLC RQSCPLAN+KYATV+   GR+
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60

Query: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120
           YLYMKT ERAHTPAKLWERI+LSKNY+KAL Q+D+HLL+W  F IHKCKQR T+LTQ+A+
Sbjct: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120

Query: 121 TERRLAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAYGDKPL 180
           TERR+ +REEERHYVGVAPKVKRR++N                    +RLKSGAYGDKPL
Sbjct: 121 TERRMELREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVLGHLXXXXXXXXXXXXXXXXXXXXXXXXXXYVADDAEGEYVDVDDLEKWL 240
           NVDEKIWKKVLGH+                          YV DD + + VDV+D+E+WL
Sbjct: 181 NVDEKIWKKVLGHV-----EDEQEEDYDEEEEEESDAEIEYVEDDGDEDLVDVEDIERWL 235

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  251 bits (641), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 147/204 (72%), Gaps = 10/204 (4%)

Query: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVR--ADKG 58
           +SD+++W +IN  FC+ +IK+  GQTF RDPYNVTGL TRQSCPLANSKYATVR   DKG
Sbjct: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62

Query: 59  RIYLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQV 118
           R+YL +KTPERAHTPAK+W+RI+LS NYSKALKQIDEHL++W  FF+H+CKQR+ KL+Q+
Sbjct: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122

Query: 119 AITERR---LAMREEERHYVGVAPKVKRREQNXXXXXXXXXXXXXXXXXXXXDRLKSGAY 175
            + ERR   L M  E++  VG+APKVKRRE N                    +RLKSGAY
Sbjct: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182

Query: 176 GD-----KPLNVDEKIWKKVLGHL 194
            +      PLNVDE IW K++G L
Sbjct: 183 SNADKTLTPLNVDENIWNKIMGKL 206

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 8/84 (9%)

Query: 43  CPLANSKYATVRADKGRIYLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKN 102
           C     ++AT  +   RI++   T E+        +R   S N SK +K       H + 
Sbjct: 688 CTYCTKQFAT--SSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKHMK------THERK 739

Query: 103 FFIHKCKQRFTKLTQVAITERRLA 126
           +   KCK+ F +L Q+ + + R +
Sbjct: 740 YKCEKCKRSFNQLEQLRLHQNRCS 763

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,749,578
Number of extensions: 223157
Number of successful extensions: 508
Number of sequences better than 10.0: 9
Number of HSP's gapped: 492
Number of HSP's successfully gapped: 9
Length of query: 304
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 203
Effective length of database: 13,099,691
Effective search space: 2659237273
Effective search space used: 2659237273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)