Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_661.2930030015150.0
YGL053W (PRM8)2372292364e-23
YAR031W (PRM9)2982282221e-20
Scas_611.63072731956e-17
Scas_460.22352471882e-16
YCR007C2392311761e-14
YAR033W (MST28)2341811724e-14
YGL051W (MST27)2341871601e-12
YAR023C1791561562e-12
YAR027W (UIP3)2352261565e-12
Sklu_2378.42362341407e-10
Sklu_2378.52252471399e-10
Kwal_27.100963401611392e-09
YHL044W2351451362e-09
Kwal_26.76733671671364e-09
Kwal_26.7243366721321e-08
YAR028W2341671212e-07
Kwal_56.22593200611166e-07
Kwal_49.19404200611166e-07
Scas_600.5d252581034e-05
YGL263W (COS12)3802181045e-05
YFL062W (COS4)3791351045e-05
YML132W (COS3)3791351002e-04
YBR302C (COS2)3791351002e-04
YNL336W (COS1)3811351002e-04
YGR295C (COS6)381135965e-04
YDL248W (COS7)383135956e-04
YHL048W (COS8)381138956e-04
YJR161C (COS5)383135930.001
YHL043W (ECM34)170158880.002
Kwal_26.904711953820.006
YIR044C6133780.007
KLLA0C19063g20952840.009
KLLA0A11957g20872830.013
Sklu_2402.320458810.020
YKL219W (COS9)407140760.15
YNR075W (COS10)374147750.18
Sklu_2266.528581720.36
YAR029W7449603.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_661.29
         (300 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_661.29                                                           588   0.0  
YGL053W (PRM8) [1926] chr7 (402590..403303) Member of the COS fa...    96   4e-23
YAR031W (PRM9) [80] chr1 (186832..187728) Member of the duplicat...    90   1e-20
Scas_611.6                                                             80   6e-17
Scas_460.2                                                             77   2e-16
YCR007C (YCR007C) [541] chr3 complement(126008..126727) Protein ...    72   1e-14
YAR033W (MST28) [81] chr1 (188103..188807) Member of the duplica...    71   4e-14
YGL051W (MST27) [1927] chr7 (403688..404392) Member of the dupli...    66   1e-12
YAR023C (YAR023C) [76] chr1 complement(179281..179820) Protein w...    65   2e-12
YAR027W (UIP3) [77] chr1 (183766..184473) Protein with strong si...    65   5e-12
Sklu_2378.4 , Contig c2378 9846-10556                                  59   7e-10
Sklu_2378.5 YCR007C, Contig c2378 11079-11756                          58   9e-10
Kwal_27.10096                                                          58   2e-09
YHL044W (YHL044W) [2244] chr8 (13563..14270) Member of the dupli...    57   2e-09
Kwal_26.7673                                                           57   4e-09
Kwal_26.7243                                                           55   1e-08
YAR028W (YAR028W) [78] chr1 (184888..185592) Protein with strong...    51   2e-07
Kwal_56.22593                                                          49   6e-07
Kwal_49.19404                                                          49   6e-07
Scas_600.5d                                                            44   4e-05
YGL263W (COS12) [1737] chr7 (2790..3932) Member of the COS famil...    45   5e-05
YFL062W (COS4) [1622] chr6 (6426..7565) Member of the duplicatio...    45   5e-05
YML132W (COS3) [3840] chr13 (7244..8383) Member of the COS famil...    43   2e-04
YBR302C (COS2) [478] chr2 complement(810296..811435) Member of t...    43   2e-04
YNL336W (COS1) [4279] chr14 (8330..9475) Member of the COS famil...    43   2e-04
YGR295C (COS6) [2237] chr7 complement(1081589..1082734) Member o...    42   5e-04
YDL248W (COS7) [629] chr4 (1802..2953) Member of the COS family ...    41   6e-04
YHL048W (COS8) [2241] chr8 (6400..7545) Member of the COS family...    41   6e-04
YJR161C (COS5) [3051] chr10 complement(742763..743914) Member of...    40   0.001
YHL043W (ECM34) [2245] chr8 (14899..15411) Protein possibly invo...    39   0.002
Kwal_26.9047                                                           36   0.006
YIR044C (YIR044C) [2706] chr9 complement(437991..438176) Protein...    35   0.007
KLLA0C19063g complement(1692492..1693121) no similarity, hypothe...    37   0.009
KLLA0A11957g 1041208..1041834 no similarity, hypothetical start        37   0.013
Sklu_2402.3 , Contig c2402 12663-13277                                 36   0.020
YKL219W (COS9) [3056] chr11 (14485..15708) Member of the COS fam...    34   0.15 
YNR075W (COS10) [4658] chr14 (779913..781037) Member of the COS ...    33   0.18 
Sklu_2266.5 YOR311C, Contig c2266 9409-10266                           32   0.36 
YAR029W (YAR029W) [79] chr1 (186317..186541) Protein of unknown ...    28   3.0  

>Scas_661.29
          Length = 300

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/300 (95%), Positives = 286/300 (95%)

Query: 1   MNATIKLTEVIFKKVVVRIHFEIFINRQPVAMSFKLKVRSNILQATLKTSIKNMGKKMPN 60
           MNATIKLTEVIFKKVVVRIHFEIFINRQPVAMSFKLKVRSNILQATLKTSIKNMGKKMPN
Sbjct: 1   MNATIKLTEVIFKKVVVRIHFEIFINRQPVAMSFKLKVRSNILQATLKTSIKNMGKKMPN 60

Query: 61  EEVHTPLNMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNE 120
           EEVHTPLNMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNE
Sbjct: 61  EEVHTPLNMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNE 120

Query: 121 DXXXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIIT 180
           D              GSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIIT
Sbjct: 121 DAIAIFLLLAILFFIGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIIT 180

Query: 181 FHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAAN 240
           FHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAAN
Sbjct: 181 FHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAAN 240

Query: 241 DETAPNENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELEGNSSMV 300
           DETAPNENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELEGNSSMV
Sbjct: 241 DETAPNENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELEGNSSMV 300

>YGL053W (PRM8) [1926] chr7 (402590..403303) Member of the COS
           family of subtelomerically-encoded proteins [714 bp, 237
           aa]
          Length = 237

 Score = 95.5 bits (236), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 106/229 (46%), Gaps = 20/229 (8%)

Query: 69  MEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXX 128
           +EE+V LP+DIFHS ++Y IY+  +   V  + ++  +LI  S I +   NE+       
Sbjct: 23  IEENVALPKDIFHSYLSYWIYEAAHCTPVMLLSLVIGVLI--SIIILFHDNENCVGVSVG 80

Query: 129 XXXXXXXGSFSFVIVRIVI---DQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNE 185
                    FS ++V ++I      + D   K KL  E++  KP +  K W  IT+ MN+
Sbjct: 81  FLLI-----FSGILVIVLILRFGPQISDEDFKCKLLMEIITRKPTVKGKEWRTITYKMNQ 135

Query: 186 YLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAANDETAP 245
           YL+ N  +  P+  Y    C+ +FL L    T      +S  ++ +       +NDETA 
Sbjct: 136 YLFDNDLWNTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQ-----SNDETAG 190

Query: 246 NENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELE 294
             N     +A + SS S     IK    A +       EYW+ E+P ++
Sbjct: 191 TPN-----EAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 234

>YAR031W (PRM9) [80] chr1 (186832..187728) Member of the duplication
           (DUP) family, has high similarity to uncharacterized S.
           cerevisiae Prm8p [897 bp, 298 aa]
          Length = 298

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 104/228 (45%), Gaps = 19/228 (8%)

Query: 69  MEEHVVLPRDIFHSQITYLIYQLFNSMA--VRWVLVINAILITGSAISIHKKNEDXXXXX 126
           +E++V LP+DIF S ++Y IY++    A  +  VL++ +IL+    +      E      
Sbjct: 85  IEKNVALPKDIFGSYLSYWIYEVTRHKAAVILLVLIVTSILL----LVFFYNTEFCVAFE 140

Query: 127 XXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEY 186
                    G+    +V I   + + D   K+KL  E++  KP +  K W  IT+ MN+Y
Sbjct: 141 ILLFSFCFPGT---CMVVIAFSEPIGDREFKVKLLMEIITRKPAVKGKEWRTITYKMNQY 197

Query: 187 LYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAANDETAPN 246
           L+ +G +  P+  Y    C+ +FL L    T      +S  ++ +       +NDETA  
Sbjct: 198 LFDHGLWDTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDA-----QSNDETAGT 252

Query: 247 ENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELE 294
            N     +A + SS S     IK    A +       EYW+ E+P ++
Sbjct: 253 PN-----EAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVD 295

>Scas_611.6
          Length = 307

 Score = 79.7 bits (195), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 111/273 (40%), Gaps = 50/273 (18%)

Query: 68  NMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXX 127
           N  E   LP   F S+  Y + +  +S+ V   L+I+ I  + + I +   ++D      
Sbjct: 16  NDRELAHLPCHKFPSKFRYFLSESCSSITVIIFLIIDLIFASATVIELLLTHDDSAAGGF 75

Query: 128 XXXXXXXXGSFSFVIVRIVI----DQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHM 183
                    S + VI+  +      +++     KMK + E+++YKPN   KSW++I  HM
Sbjct: 76  GIGLFA--SSLTTVIISCIFFFQRTETITGTQAKMKFFLEIIQYKPNATSKSWDVIAAHM 133

Query: 184 NEYLYQNGYFRNPFCLYDSSKCYNWFLELTNN------------GTIDGSGTASNDSMPE 231
           N Y Y+ G++ N    Y   +CYNWF+ELT                 D S    N   P 
Sbjct: 134 NTYFYREGHWANENFFYSGKECYNWFMELTTKVEYVPIEQPPRASQEDSSEPIENSKKPT 193

Query: 232 PTD------------LIDA------------ANDETAPNENSTANVQAKKGSSHSTEN-- 265
           PT             + DA            A ++T  N  S+   Q  K +   TE   
Sbjct: 194 PTSTTSIPIAQPIPHVADANPNANPVVINKWAQNKTPTNIISSKKNQRPKANMPLTERIV 253

Query: 266 ------ALIKYKNAAIDAYNISMNEYWQTEFPE 292
                  L +Y+  A+D Y  ++ +YW   +P+
Sbjct: 254 TTIDDLELKRYETVAVDVYRDAVRDYWCDAYPD 286

>Scas_460.2
          Length = 235

 Score = 77.0 bits (188), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 109/247 (44%), Gaps = 74/247 (29%)

Query: 70  EEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLV--------------INAILITG----- 110
           +++V LP  IF S  TY + +L+ S+  +  LV               N IL+ G     
Sbjct: 24  DQYVNLPSKIFKSWWTYELNELWQSLLFKSFLVSLVVAIPLVIYFSITNPILLIGIINVF 83

Query: 111 ------SAISIHKKNEDXXXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEV 164
                  ++++ K NE                       R++I Q  D+ +I  KL+ E+
Sbjct: 84  LVPLILGSLAVSKLNEK----------------------RLMIRQ--DNENIN-KLFLEI 118

Query: 165 LKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTA 224
           +++KPN++ +SW++I  H+N++LY+ G +  P   YD    Y WF        I     A
Sbjct: 119 IQWKPNVDPRSWDLIALHINQHLYEMGNWNTPGFFYDGHLVYAWF------KPIRAYYIA 172

Query: 225 SNDSMPEPTDLIDAANDETAPNENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNE 284
           + +             D T   ENS  ++  K+      E    +YK  A++AYN ++++
Sbjct: 173 NEEQ------------DRTVSTENSKNSILKKQ------EYQFKQYKKLAVEAYNAAVDD 214

Query: 285 YWQTEFP 291
           YWQ ++P
Sbjct: 215 YWQDQYP 221

>YCR007C (YCR007C) [541] chr3 complement(126008..126727) Protein
           with strong similarity to subtelomerically-encoded
           proteins such as Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p,
           Cos8p, Cos6p, Cos9p [720 bp, 239 aa]
          Length = 239

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 103/231 (44%), Gaps = 21/231 (9%)

Query: 67  LNMEEHVVLPRDIFHSQITYLIYQL--FNSMAVRWVLVINAILITGSAISIHKKNEDXXX 124
           L+  E++ LP D F S +TYL+Y++  +  M   ++ +  +ILI    +  H    +   
Sbjct: 25  LSSAENITLPEDTFKSYMTYLLYEMAHYKPMIFSFLALSVSILIV---VIFH----NVKA 77

Query: 125 XXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMN 184
                       S  F+   I  +  + D   ++KL  EV+ ++P +  K W  IT +MN
Sbjct: 78  CDVVFGFSIFVTSILFLSTLIPFNVYISDEGFRIKLLLEVITHRPAVKGKEWRAITDNMN 137

Query: 185 EYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDL-IDAANDET 243
           +YL  NG +   +  Y S +CY +F  L         G   N S+ + T   IDA  +E 
Sbjct: 138 QYLLDNGLWSTRYYFYSSERCYKFFRFLVKEKP---PGVNVNSSVKDATSTQIDAPANE- 193

Query: 244 APNENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELE 294
                  A+ +  K  S S++     Y   A++    +  EYW+ ++P+ +
Sbjct: 194 -------ASNEVIKCFSFSSDPIFEAYFVKAVEVEKQAQQEYWRKQYPDAD 237

>YAR033W (MST28) [81] chr1 (188103..188807) Member of the
           duplication (DUP) family, has very strong similarity to
           uncharacterized S. cerevisiae Ygl051p [705 bp, 234 aa]
          Length = 234

 Score = 70.9 bits (172), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 84/181 (46%), Gaps = 7/181 (3%)

Query: 69  MEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXX 128
           +E++V LP+DIF S ++Y IY++     V  + ++  +L+    I     NE        
Sbjct: 23  IEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGVLVL--LIIFFNDNEACVFNSAI 80

Query: 129 XXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLY 188
                  G    +I+     + +   + + +L  +V+  KP +  K W IIT++MN+YL+
Sbjct: 81  FAFTSLVGLL--IILSDGNPKLVSRRNFRTELLVDVITRKPAVEGKEWRIITYNMNQYLF 138

Query: 189 QNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMP---EPTDLIDAANDETAP 245
            +G +  P+  Y    CY +FL L    T       S  + P   +P D I++A+  +  
Sbjct: 139 NHGQWHTPYYFYSDEDCYRYFLRLVEGVTPKKQTATSIGNSPVTAKPEDAIESASPSSRL 198

Query: 246 N 246
           N
Sbjct: 199 N 199

>YGL051W (MST27) [1927] chr7 (403688..404392) Member of the
           duplication (DUP) family, has very strong similarity to
           uncharacterized S. cerevisiae Yar033p [705 bp, 234 aa]
          Length = 234

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 80/187 (42%), Gaps = 19/187 (10%)

Query: 69  MEEHVVLPRDIFHSQITYLIYQLFNSMAVR------WVLVINAILITGSAISIHKKNEDX 122
           +E++V LP+DIF S ++Y IY++     V        VLV+  I    +   +       
Sbjct: 23  IEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGVLVLLIIFFNDNEACVFNSAYYA 82

Query: 123 XXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFH 182
                        G+   V  R          + + +L  +V+  KP +  K W IIT++
Sbjct: 83  YLSLVVLLIILGDGNPKLVSRR----------NFRTELLVDVITRKPAVEGKEWRIITYN 132

Query: 183 MNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMP---EPTDLIDAA 239
           MN+YL+ +G +  P+  Y    CY +FL L    T       S  + P   +P D I++A
Sbjct: 133 MNQYLFNHGQWHTPYYFYSDEDCYRYFLRLVEGVTPKKQTATSIGNSPVTAKPEDAIESA 192

Query: 240 NDETAPN 246
           +  +  N
Sbjct: 193 SPSSRLN 199

>YAR023C (YAR023C) [76] chr1 complement(179281..179820) Protein with
           strong similarity to subtelomerically-encoded proteins
           such as Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p,
           Cos6p, Cos9p [540 bp, 179 aa]
          Length = 179

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 78/156 (50%), Gaps = 19/156 (12%)

Query: 139 SFVIVRIV-IDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPF 197
           S V+++I  I + + +   + KL  EV+ ++P+I  K W  IT++MN+YL++ G ++ P+
Sbjct: 37  SMVVLQIWSISRPISNETFRTKLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPY 96

Query: 198 CLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAANDETAPNENSTANVQAKK 257
             +   +CY +F +L     I G           P    D AN  T P  +   N  A +
Sbjct: 97  HFFCEHQCYEFFKDL-----IKGK---------YPDVQWDTAN--TQPFISVPENQAATQ 140

Query: 258 GSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPEL 293
            S          +K A I A+  ++ EYWQ+++P++
Sbjct: 141 NSDVEPTVKWCLFKAAEIQAH--AVREYWQSQYPDV 174

>YAR027W (UIP3) [77] chr1 (183766..184473) Protein with strong
           similarity to subtelomerically-encoded proteins such as
           Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p, Cos6p,
           Cos9p, and Ycr007p [708 bp, 235 aa]
          Length = 235

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 100/226 (44%), Gaps = 15/226 (6%)

Query: 69  MEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXX 128
           +EE+V LP D F+S  +Y++ ++     +  + +I   L+    + I   ++        
Sbjct: 23  IEENVALPEDTFNSYWSYILNEIARCKPLMIMFLIPVCLV----LLITFFHDIKGILVFL 78

Query: 129 XXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLY 188
                       + +   + ++L+   I +KL  EV+  KP +  K W II ++MN+YL+
Sbjct: 79  VISLILSIIILLIGITAFVSETLNKGFI-IKLLVEVITRKPAVGGKEWRIIAYNMNQYLF 137

Query: 189 QNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTDLIDAANDETAPNEN 248
            +G +  P+  +   +C+ +F  L          T SN  +  PT+  +     T   E 
Sbjct: 138 DHGIWHTPYYFFCEHRCHKFFKSLIKQ-------TRSNAHLSSPTNGAENTQSNTPAKEV 190

Query: 249 STANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELE 294
           S   V   K    S++  L  Y   A + +  +  EYW+ ++PE++
Sbjct: 191 SNEMV---KPYIFSSDPVLEAYLIKAAEIHKEAEFEYWRKQYPEVD 233

>Sklu_2378.4 , Contig c2378 9846-10556
          Length = 236

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 101/234 (43%), Gaps = 30/234 (12%)

Query: 75  LPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXXXXXX 134
           LPRDIF ++  +  Y+L+ S+A+R  L+I   LI     + +   E              
Sbjct: 22  LPRDIFKTRSRWRCYKLYKSIAIRISLLI--FLIAQVLATFYGGIEGFGLCLIPTLILIL 79

Query: 135 XGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNG-YF 193
              FS +IV +    SL     +M+   +V   +P +++  W+II   MNEY+   G + 
Sbjct: 80  ---FSALIV-LTTSSSLG-LKGQMEFLVQVTTLRPGLDISRWDIIANRMNEYMLNTGKWL 134

Query: 194 RNPFCLYDSSKCYNWFLELT--------NNGTIDGSGTASNDSMPEPTDLIDAANDETAP 245
              +  +D  +C+ +F E           +  +D + T  N +  +PT+     +DET  
Sbjct: 135 SENYFFFDGEECFKYFREWCILPSQREEKDKKLDNTDTPHN-TKDDPTET--QQSDETPI 191

Query: 246 NENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPELEGNSSM 299
           N +   N +  K            Y   A++AYN  +N  W+     + G+SS+
Sbjct: 192 NSDPYWNCKELK-----------PYIARAVEAYNEDVNISWERACAMVIGSSSV 234

>Sklu_2378.5 YCR007C, Contig c2378 11079-11756
          Length = 225

 Score = 58.2 bits (139), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 106/247 (42%), Gaps = 32/247 (12%)

Query: 60  NEEVHTPL----NMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISI 115
            E V  P+      E    LPRD F  + ++  Y LF++    W ++ + +L+  + ++ 
Sbjct: 4   KESVELPMITQSGTESQPKLPRDAFRCKFSWKCYLLFSNT---WFIISSMLLVILTLLAA 60

Query: 116 HKKNEDXXXXXXXXXXXXXXGSFSFVIVRIVI-DQSLD-DAHIKMKLYSEVLKYKPNINL 173
           H                     F+ V   +VI  + +  D   + +L  E+   +P +++
Sbjct: 61  HFGG-----FVMLVPTLALCPIFTVVPATVVIATRGIGLDLQGRARLLVEITVTRPALDM 115

Query: 174 KSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPT 233
             W+II   +N ++ + G + +    Y+  +C+++F +     +   S +A++DS PE  
Sbjct: 116 SKWDIIAADINNFMLKKGKWSSKQYFYNGEECFDFFKKGYLIPSAGISRSANSDSSPE-- 173

Query: 234 DLIDAANDETAPNENSTANVQAKKGSSHSTENALIKYKNAAIDAYNISMNEYWQTEFPEL 293
                       ++N++A   A +     T   L  Y + A+ AY   +  +WQ E   +
Sbjct: 174 -----------SDQNASAASDASR-----TYMELKPYADKAVQAYFEDLEAHWQRECEAV 217

Query: 294 EGNSSMV 300
             +SSM+
Sbjct: 218 VASSSML 224

>Kwal_27.10096
          Length = 340

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 70/161 (43%), Gaps = 30/161 (18%)

Query: 67  LNME-EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXX 125
           ++ME E + +P+D+FHS+  +  +Q       R   +    LIT   I   +        
Sbjct: 1   MSMEKEALTIPKDVFHSKFRWSFFQ------ARKDPIFCLFLITCVVIKFSR-------- 46

Query: 126 XXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKM-----KLYSEVLKYKPNINLKSWNIIT 180
                     GS S ++  I++   L  A   +     KL +EV+  +P  +   WN+IT
Sbjct: 47  --------FEGSVSVLV--ILVGSYLAGARRALKKNIEKLCNEVIDQRPGADTLKWNLIT 96

Query: 181 FHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGS 221
             +N  LY  G + NP+C++D   C   F EL    ++  S
Sbjct: 97  QRLNGLLYDEGLYNNPYCIFDGEHCQELFRELVLEPSLQKS 137

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 168 KPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWF-LELTNN 215
           +P+  ++ WN++   MN+Y+Y+   + +    +D   C  +F +E T++
Sbjct: 264 RPHAQVEGWNVVAKRMNKYMYEEKGWHSKEFFHDGEDCSRYFKMEFTSS 312

>YHL044W (YHL044W) [2244] chr8 (13563..14270) Member of the
           duplication (DUP) family, has low similarity to
           uncharacterized S. cerevisiae Ycr007p [708 bp, 235 aa]
          Length = 235

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 71/145 (48%), Gaps = 16/145 (11%)

Query: 149 QSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNW 208
           + LDD   K KL +EV+ +KPN++L +W+ I + MN+++Y      +    YD S CY  
Sbjct: 103 RCLDD-DCKFKLLAEVITHKPNMDLSTWDRIAYDMNQFVYDRRICADRSFFYDGSYCYQV 161

Query: 209 FLELTNNGTIDGSGTASNDSMPEPTDLIDAANDETAPNENSTANVQAKKGSSHSTENALI 268
           F +L     +  S   S        DL   +N  T  N++  +++  + G+         
Sbjct: 162 FKKLVATPYLVNSNMNS-----IYADLEMRSNGATNINDSGNSSLHIELGT--------- 207

Query: 269 KYKNAAIDAYNISMNEYWQTEFPEL 293
            Y   A+  +  S+++YW+ ++PE+
Sbjct: 208 -YIFKALAVFRNSVDKYWEDKYPEM 231

>Kwal_26.7673
          Length = 367

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 72/167 (43%), Gaps = 29/167 (17%)

Query: 69  MEE--HVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXX 126
           MEE     LP   F +  T+++YQ F +     V  +  +LI G +    KK +      
Sbjct: 1   MEEICQSYLPCANFRNVYTWILYQHFRTP----VHYLIGLLICGFSFWFFKKGD------ 50

Query: 127 XXXXXXXXXGSFSFVI----VRIVIDQSLDDAHIKMKL---YSEVLKYKPNINLKSWNII 179
                     S+SF+     V + I  S     +   L     EV+K +P  NL  W+++
Sbjct: 51  ----------SYSFLPALPNVLLAIGYSASTRAVTQHLEVLCEEVIKIQPGANLSKWDVV 100

Query: 180 TFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASN 226
             H+NE LY++G + NP+C+YD   C + F  L       G+    N
Sbjct: 101 AAHINERLYRSGAWYNPYCIYDGEYCISLFRLLVLGPFYKGTHDEQN 147

>Kwal_26.7243
          Length = 366

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 160 LYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTID 219
           L  EV++ +P  +L+ W+++  H+NE LY++G + +P+C++D   CY+ F  L       
Sbjct: 82  LCEEVIEVQPGADLRKWDVVAAHINERLYKSGVWHSPYCVFDGKSCYSIFRLLVLTPFYQ 141

Query: 220 GSGTASNDSMPE 231
           G     N  + E
Sbjct: 142 GKCDKQNTQLAE 153

>YAR028W (YAR028W) [78] chr1 (184888..185592) Protein with strong
           similarity to subtelomerically-encoded proteins such as
           Cos5p, Ybr302p, Cos3p, Cos1p, Cos4p, Cos8p, Cos6p,
           Cos9p, and Ycr007p [705 bp, 234 aa]
          Length = 234

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 76/167 (45%), Gaps = 8/167 (4%)

Query: 47  LKTSIKNMGKKMPNEEVHTPLNMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAI 106
           ++T  +N   KM   +  +   +EE+V LP D F S ++Y++Y++ +   + + ++I  +
Sbjct: 1   MQTPSENTDVKMDTLDEPSAHLIEENVALPEDTFSSHLSYVLYEIAHCKPIMF-MIIIIV 59

Query: 107 LITGSAISIHKKNEDXXXXXXXXXXXXXXGSFSFVIVR-IVIDQSLDDAHIKMKLYSEVL 165
            +    +  H    D               S + ++V      +++ +    +KL  EV+
Sbjct: 60  SLISLIVLFH----DNDGCTVILVMSLIVASMALMVVAAFTFGKAITEQEFMIKLLVEVI 115

Query: 166 KYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLEL 212
             KP    K W  + ++MN+YL+    +  P+  Y   KC+ +F  L
Sbjct: 116 ARKPA--GKEWGTVAYNMNQYLFMKRLWYTPYYFYSGKKCHEFFTTL 160

>Kwal_56.22593
          Length = 200

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%)

Query: 157 KMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNG 216
           +++L   V K +P++NLK WN I  HMN Y+++ G +  P+  +D  +C  +FL + +  
Sbjct: 110 RVELCKLVSKDRPSLNLKKWNSIAVHMNNYIFEQGLYSMPYFFWDGEECRIFFLGMGDTC 169

Query: 217 T 217
           +
Sbjct: 170 S 170

>Kwal_49.19404
          Length = 200

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%)

Query: 157 KMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNG 216
           +++L   V K +P++NLK WN I  HMN Y+++ G +  P+  +D  +C  +FL + +  
Sbjct: 110 RVELCKLVSKDRPSLNLKKWNSIAVHMNNYIFEQGLYSMPYFFWDGEECRIFFLGMGDTC 169

Query: 217 T 217
           +
Sbjct: 170 S 170

>Scas_600.5d
          Length = 252

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%)

Query: 158 MKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNN 215
           + L+ E++   PN    SW+I T H+N+ LY+   +   + ++D  +C+ WF+  T++
Sbjct: 152 LSLFKEIIDRTPNSTTASWDITTSHLNDMLYEGKKWPTKYMMWDGKECHAWFINQTSS 209

>YGL263W (COS12) [1737] chr7 (2790..3932) Member of the COS family
           of subtelomerically-encoded proteins [1143 bp, 380 aa]
          Length = 380

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 83/218 (38%), Gaps = 35/218 (16%)

Query: 55  GKKMPNEEVHTPLNMEE--HVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSA 112
           G K  N     P  + +  +  LP+++F S +T+  Y+ FNS+  R  L++   LI    
Sbjct: 3   GAKFENTVAFLPSEIFDCYNSTLPKNVFRSFVTWSCYEKFNSLEFRTWLLMWLPLIIAWK 62

Query: 113 ISIHKKNEDXXXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNIN 172
           I   K++                 ++S++     + + +       +   E++   P I+
Sbjct: 63  IR-GKRHYLVIVTALMFEVLYFLWTYSYIFRERTLGKQVS------QFAKEIITNTPGID 115

Query: 173 LKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEP 232
            + W  +  + N YLY+N  +   +  +D S C   F ++                + EP
Sbjct: 116 TEDWERVAVNFNSYLYENKLWNTEYFFFDGSSCQEAFRKM----------------LLEP 159

Query: 233 TDLIDAANDETAPNENSTANVQAKKGSSHSTENALIKY 270
             L           +N  AN +   GS   TE AL  Y
Sbjct: 160 FSL----------KKNDFANAKVPDGSVCYTEKALQVY 187

>YFL062W (COS4) [1622] chr6 (6426..7565) Member of the duplication
           (DUP) family, has strong similarity to uncharacterized
           S. cerevisiae Cos1p [1140 bp, 379 aa]
          Length = 379

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + +VLP+D+F S  T+  Y+++ S+A R    I  +L    ++     N           
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFR----IWMLLWLPLSVWWKLSNNWIYPLMVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI R+   +SL       +   E+ K  P+ +   W ++  ++N YLY+N
Sbjct: 79  VLFWGPVFVLVIFRLSRKRSLSKQLT--QFCKEITKSTPSSDPHDWEVVAANLNSYLYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +   +  +++  C
Sbjct: 137 KAWNIRYFFFNAMGC 151

>YML132W (COS3) [3840] chr13 (7244..8383) Member of the COS family
           of subtelomerically-encoded proteins [1140 bp, 379 aa]
          Length = 379

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + +VLP+D+F S  T+  Y+++ S+A R    I  +L    ++     N           
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFR----IWMLLWLPLSVWWKLSNNCIYPLIVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI  +   +SL    I+     E+ +  P+ +   W ++  ++N YLY+N
Sbjct: 79  VLFLGPIFVLVICGLSRKRSLSKQLIQ--FCKEITENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +   +  +++  C
Sbjct: 137 NVWNTKYFFFNAMVC 151

>YBR302C (COS2) [478] chr2 complement(810296..811435) Member of the
           duplication (DUP) family, has very strong similarity to
           uncharacterized S. cerevisiae Cos3p [1140 bp, 379 aa]
          Length = 379

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + +VLP+D+F S  T+  Y+++ S+A R    I  +L    ++     N           
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFR----IWMLLWLPLSVWWKLSNNCIYPLIVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI  +   +SL    I+     E+ +  P+ +   W ++  ++N YLY+N
Sbjct: 79  VLFLGPIFVLVICGLSRKRSLSKQLIQ--FCKEITENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +   +  +++  C
Sbjct: 137 NVWNTKYFFFNAMVC 151

>YNL336W (COS1) [4279] chr14 (8330..9475) Member of the COS family
           of subtelomerically-encoded proteins [1146 bp, 381 aa]
          Length = 381

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + +VLP+D+F S  T+  Y+++ S+A R    I  +L    ++     N           
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFR----IWMLLWLPLSVWWKLSNNCIYPLIVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI  +   +SL    I+     EV +  P+ +   W ++  ++N YLY+N
Sbjct: 79  VLFLGPIFVLVICGLSRKRSLSKQLIQ--FCKEVTENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +   +  +++  C
Sbjct: 137 KAWNTKYFFFNAMVC 151

>YGR295C (COS6) [2237] chr7 complement(1081589..1082734) Member of
           the COS family of subtelomerically-encoded proteins
           [1146 bp, 381 aa]
          Length = 381

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 54/135 (40%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           +  VLP+D+F S  T+  Y+++ S+  R    I  +L    ++     N           
Sbjct: 23  QKTVLPQDLFRSSFTWFCYEIYKSLVFR----IWMLLWLPLSVWWKLSNNWIYPLMVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI R+   +SL     +     E+ K  P+ +   W ++  ++N Y Y+N
Sbjct: 79  VLFWGPVFVLVIFRLSRKRSLSKQLTQ--FCKEITKNTPSSDPHDWEVVAANLNSYFYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +   +  + +  C
Sbjct: 137 KAWNTKYFFFSAMSC 151

>YDL248W (COS7) [629] chr4 (1802..2953) Member of the COS family of
           subtelomerically-encoded proteins [1152 bp, 383 aa]
          Length = 383

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + +VLP+D+F S  T+  Y+++ S+A R    I  +L    ++     N           
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLAFR----IWMLLWLPLSVWWKLSNNCIYPLIVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI  +   +SL    I+     E+ +  P+ +   W ++  ++N YLY+N
Sbjct: 79  VLFLGPIFVLVICGLSRKRSLSKQLIQ--FCKEITENTPSSDPHDWEVVVANLNSYLYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +      ++++ C
Sbjct: 137 KAWNTKNFFFNATDC 151

>YHL048W (COS8) [2241] chr8 (6400..7545) Member of the COS family of
           subtelomerically-encoded proteins [1146 bp, 381 aa]
          Length = 381

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 63/138 (45%), Gaps = 12/138 (8%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVR-WVLVINAILITGSAIS--IHKKNEDXXXXXX 127
           +  VLP+D+F +++T+  Y+++ S+A R W+L+   + +     S  IH           
Sbjct: 23  QKTVLPQDVFRNELTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSSNWIHP--------LI 74

Query: 128 XXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYL 187
                   G F FV+V   + +    +   ++   E+ +  P+ +   W ++  ++N Y 
Sbjct: 75  VSLLVLFLGPF-FVLVICGLSRKRSLSKQLIQFCKEITEDTPSSDPHDWEVVAANLNSYF 133

Query: 188 YQNGYFRNPFCLYDSSKC 205
           Y+N  +   +  +++  C
Sbjct: 134 YENKTWNTKYFFFNAMSC 151

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 65/150 (43%), Gaps = 12/150 (8%)

Query: 61  EEVHTPLNMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNE 120
           E+  +P ++E+ + LP++ +  ++T+++ ++FN   +   L    I+ T         N 
Sbjct: 204 EKEESPFDLED-IQLPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSG-------NA 255

Query: 121 DXXXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIIT 180
           D               +  F  +R+++  S+   H KM+  S ++  + +     W+ I 
Sbjct: 256 DLISRFLFPVVMFFIMTRDFQNMRMIV-LSVKMEH-KMQFLSTIINEQES-GANGWDEIA 312

Query: 181 FHMNEYLYQNGYFRNPFCLYDSSKCYNWFL 210
             MN YL++   + N    YD   C  WF 
Sbjct: 313 KKMNRYLFEKKVWNNEEFFYDGLDC-EWFF 341

>YJR161C (COS5) [3051] chr10 complement(742763..743914) Member of
           the COS family of subtelomerically-encoded proteins
           [1152 bp, 383 aa]
          Length = 383

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 57/135 (42%), Gaps = 6/135 (4%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + +VLP+D+F S  T+  Y+++ S+A      I  +L    ++     N           
Sbjct: 23  QKIVLPQDLFRSSFTWFCYEIYKSLA----FPIWMLLWLPLSVWWKLSNNCIYPLIVSLL 78

Query: 131 XXXXXGSFSFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                  F  VI  +   +SL    I+     EV +  P+ +   W ++  ++N YLY+N
Sbjct: 79  VLFLGPIFVLVICGLSRKRSLSKQLIQ--FCKEVTENTPSSDPHDWEVVAANLNSYLYEN 136

Query: 191 GYFRNPFCLYDSSKC 205
             +   +  +++  C
Sbjct: 137 KAWNTRYFFFNAMGC 151

>YHL043W (ECM34) [2245] chr8 (14899..15411) Protein possibly
           involved in cell wall structure or biosynthesis [513 bp,
           170 aa]
          Length = 170

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 63/158 (39%), Gaps = 22/158 (13%)

Query: 55  GKKMPNEEVHTPLNME----EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITG 110
           G+K  +E+    L  +     +  LP+++F S  T+  Y++ N  A    L++   LI G
Sbjct: 3   GRKSEDEKNEAALACDVFESSNAKLPKNVFRSSFTWYCYEVINRSAFHIWLLLCLTLIVG 62

Query: 111 ----SAISIHK---KNEDXXXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIKM----- 158
               S I   +    N D                 + VI+ I +  S      KM     
Sbjct: 63  WKVFSGIGGRRPSDSNMDGPQTKHKRNPGFLRRHSTIVILVISLAVSFSWEAFKMYRERT 122

Query: 159 ------KLYSEVLKYKPNINLKSWNIITFHMNEYLYQN 190
                 +   E++K  P+ +++SW+ +    N Y+Y+N
Sbjct: 123 FGKQITQFAKEIIKSAPSTDMESWDRVAADFNSYMYEN 160

>Kwal_26.9047
          Length = 119

 Score = 36.2 bits (82), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 157 KMKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWF 209
           ++K    +   KP+  ++ WNI+   MN+Y+Y+   + N    Y+   C N F
Sbjct: 26  RLKFLKTISLVKPHAQIEGWNIVAKRMNKYMYEEKGWHNREFFYNGEDCLNAF 78

>YIR044C (YIR044C) [2706] chr9 complement(437991..438176) Protein of
           unknown function [186 bp, 61 aa]
          Length = 61

 Score = 34.7 bits (78), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVR-WVLV 102
           +  VLP+D+F +++T+  Y+++ S+A R W+L+
Sbjct: 23  QKTVLPQDVFRNELTWFCYEIYKSLAFRIWMLL 55

>KLLA0C19063g complement(1692492..1693121) no similarity,
           hypothetical start
          Length = 209

 Score = 37.0 bits (84), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 167 YKPN-INLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGT 217
           +KP+ I++K W+I+   +N++LY+ G + N    YD  +C   F+ L    T
Sbjct: 127 FKPSYIDMKQWDIVARVVNKHLYEAGSWPNNRFFYDGKRCQAMFIALVKKPT 178

>KLLA0A11957g 1041208..1041834 no similarity, hypothetical start
          Length = 208

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 11/72 (15%)

Query: 175 SWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPEPTD 234
           SW  I   MN YL+Q G + +  C+YD  +CY  F+  T            NDS  +P  
Sbjct: 129 SWEQIGRIMNSYLFQRGLWWSNSCIYDGQQCYVLFINYTK---------CCNDSNIQP-- 177

Query: 235 LIDAANDETAPN 246
            I+    + A N
Sbjct: 178 FIEQTQAKVAEN 189

>Sklu_2402.3 , Contig c2402 12663-13277
          Length = 204

 Score = 35.8 bits (81), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%)

Query: 158 MKLYSEVLKYKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNN 215
           ++   EV K KP I+++ W+I+  +MN+++     +   +  YD   C+  F  L  N
Sbjct: 97  IRFSEEVTKVKPGIDMEIWDIVASNMNKFMQSEKLWSILYSFYDGGDCFQQFRRLILN 154

>YKL219W (COS9) [3056] chr11 (14485..15708) Member of the COS family
           of subtelomerically-encoded proteins [1224 bp, 407 aa]
          Length = 407

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/140 (18%), Positives = 57/140 (40%), Gaps = 12/140 (8%)

Query: 71  EHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXXXXXXX 130
           + VVLP+D+F    T++ Y+ F     R  L++  ++     +S  K             
Sbjct: 47  QKVVLPQDLFMDNFTWMFYEFFKCFTFRTWLLLLLLMWLPGFLSQIKSINRIFPFKLCIL 106

Query: 131 XXXXXGSF-----SFVIVRIVIDQSLDDAHIKMKLYSEVLKYKPNINLKSWNIITFHMNE 185
                G F     SF    ++ +Q         +   E++++ P  +   W  +  ++N 
Sbjct: 107 VSCLVGIFLPNIYSFSHKSVLTNQL-------TQFSKEIVEHAPGTDTHDWETVAANLNS 159

Query: 186 YLYQNGYFRNPFCLYDSSKC 205
           Y Y+N  +   +  +++++C
Sbjct: 160 YFYENKAWNTEYFFFNAAEC 179

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 66/164 (40%), Gaps = 18/164 (10%)

Query: 49  TSIKNMGKKMPNEEVHTPLNMEEHVVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILI 108
           T      K    E+V +P N+E HV LP+  +  + T+++ ++FN     W+     + +
Sbjct: 220 TEFDKKWKLFNTEKVWSPDNLE-HVQLPKKTYRYKFTWVLKRIFN----LWLFPAFILFL 274

Query: 109 TGSAISIHKKNEDXXXXXXXXXXXXXXGSFSFVIVRIVIDQSLDDAHI--KMKLYSEVLK 166
               +S  K +                G    ++VR+  +      H+  KM+  S ++ 
Sbjct: 275 ACIYVSWDKGH---------LFRILCCGGGFLLMVRVFQNMRPFSMHMEDKMQFLSTIIN 325

Query: 167 YKPNINLKSWNIITFHMNEYLYQNGYFRNPFCLYDSSKCYNWFL 210
            + +     W+ I   MN YL++   + +    +D   C  WF 
Sbjct: 326 EQES-GANGWDEIAKKMNRYLFEKKVWTSEEFFFDGIDC-EWFF 367

>YNR075W (COS10) [4658] chr14 (779913..781037) Member of the COS
           family of subtelomerically-encoded proteins [1125 bp,
           374 aa]
          Length = 374

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 30/147 (20%), Positives = 54/147 (36%), Gaps = 23/147 (15%)

Query: 68  NMEEH--VVLPRDIFHSQITYLIYQLFNSMAVRWVLVINAILITGSAISIHKKNEDXXXX 125
            +E H    LP DIF +++T+L  ++ NS    W L    + +     S           
Sbjct: 12  GLETHSSFCLPEDIFRNRLTWLCSEIRNSGFWIWSLSWLPLAVWWGMASTW--------- 62

Query: 126 XXXXXXXXXXGSFSFVIVRIVIDQSLDDAHIK-------MKLYSEVLKYKPNINLKSWNI 178
                      S   ++  I I   +   + K        +L  E++K  P      W+ 
Sbjct: 63  -----FYPLLTSVVLILALIAILPVVQIQYSKYTLSNQLTQLSKEIIKSAPGAYSADWDA 117

Query: 179 ITFHMNEYLYQNGYFRNPFCLYDSSKC 205
           +  H N YLY+N  ++     ++ + C
Sbjct: 118 VAIHFNSYLYENKAWKTAHFFFNGTDC 144

>Sklu_2266.5 YOR311C, Contig c2266 9409-10266
          Length = 285

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 21/81 (25%)

Query: 48  KTSIKNMGKKM---PNEEVHTPLN-------------MEEHVVLPRDIFHSQITYLIYQL 91
           KTS+ N+G  +    + +VH PL              + +H V PR +FHS I ++   L
Sbjct: 27  KTSVGNVGISVEDGSDSDVHLPLTGIHLKSHEWFGEFITKHEV-PRKVFHSSIGFITLYL 85

Query: 92  FNSMA----VRWVLVINAILI 108
           + + A    V+W L+   +++
Sbjct: 86  YTTGADYSKVKWPLICGFVIL 106

>YAR029W (YAR029W) [79] chr1 (186317..186541) Protein of unknown
           function [225 bp, 74 aa]
          Length = 74

 Score = 27.7 bits (60), Expect = 3.0,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 23/49 (46%)

Query: 183 MNEYLYQNGYFRNPFCLYDSSKCYNWFLELTNNGTIDGSGTASNDSMPE 231
           MN+YL+ +  +  P+  Y    C+  FL      T +   + + +++ E
Sbjct: 1   MNKYLFDHKIWSTPYYFYCEEDCHRLFLSFIEGRTFEKPTSNAEENVQE 49

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,597,249
Number of extensions: 416484
Number of successful extensions: 1760
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1735
Number of HSP's successfully gapped: 68
Length of query: 300
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 199
Effective length of database: 13,099,691
Effective search space: 2606838509
Effective search space used: 2606838509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)