Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_661.2862162132230.0
YDR037W (KRS1)59159328070.0
CAGL0K12012g59159027870.0
Sklu_2357.258858927540.0
AGR037C58959127470.0
Kwal_27.1054159159127320.0
KLLA0F18392g58858626990.0
CAGL0J10230g5434956724e-80
Scas_633.285924756432e-75
KLLA0F04796g5174956364e-75
Kwal_23.47175275096164e-72
YNL073W (MSK1)5764995829e-67
AER362W5254805596e-64
YLL018C (DPS1)5574842078e-17
Sklu_2189.35585132032e-16
Scas_347.35525162014e-16
CAGL0D06556g5534922014e-16
ADL039C5564871971e-15
KLLA0D03839g5554941853e-14
Kwal_27.122356502551604e-11
YHR019C (DED81)5544711551e-10
Sklu_2265.35605201514e-10
KLLA0A08426g5544751497e-10
Kwal_14.23034752681452e-09
YPL104W (MSD1)6581351337e-08
Sklu_1963.16551431302e-07
Scas_700.66582161265e-07
KLLA0E24486g6452651222e-06
AGR206C6511181202e-06
Scas_607.145555051193e-06
KLLA0A11484g4743531183e-06
AEL020W5523371141e-05
CAGL0H05907g6591111104e-05
CAGL0A02112g5484741051e-04
Kwal_0.3754283281042e-04
CAGL0K07656g49767800.15
AFR516W49967770.30
Scas_707.1449967770.31
KLLA0F25234g49967770.35
Kwal_47.1799849967750.50
YBR053C35856750.52
KLLA0C18612g2140113760.55
YCR024C492427740.69
YFL022C (FRS2)50367740.72
Scas_710.22112043731.1
Sklu_2216.214074671.9
KLLA0F24200g65263702.4
CAGL0L08030g46739693.1
YNL077W (APJ1)52847683.5
AFL127C152184693.5
Scas_628.2448732683.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_661.28
         (621 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_661.28                                                          1246   0.0  
YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1085   0.0  
CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1078   0.0  
Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1065   0.0  
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1062   0.0  
Kwal_27.10541                                                        1056   0.0  
KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1044   0.0  
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   263   4e-80
Scas_633.28                                                           252   2e-75
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   249   4e-75
Kwal_23.4717                                                          241   4e-72
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   228   9e-67
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   219   6e-64
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    84   8e-17
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         83   2e-16
Scas_347.3                                                             82   4e-16
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    82   4e-16
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    80   1e-15
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    76   3e-14
Kwal_27.12235                                                          66   4e-11
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    64   1e-10
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            63   4e-10
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    62   7e-10
Kwal_14.2303                                                           60   2e-09
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    56   7e-08
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         55   2e-07
Scas_700.6                                                             53   5e-07
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    52   2e-06
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    51   2e-06
Scas_607.14                                                            50   3e-06
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    50   3e-06
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    49   1e-05
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    47   4e-05
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    45   1e-04
Kwal_0.375                                                             45   2e-04
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    35   0.15 
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    34   0.30 
Scas_707.14                                                            34   0.31 
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    34   0.35 
Kwal_47.17998                                                          33   0.50 
YBR053C (YBR053C) [243] chr2 complement(339635..340711) Member o...    33   0.52 
KLLA0C18612g 1646511..1652933 similar to sp|P25655 Saccharomyces...    34   0.55 
YCR024C (YCR024C) [558] chr3 complement(160739..162217) Asparagi...    33   0.69 
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    33   0.72 
Scas_710.22                                                            33   1.1  
Sklu_2216.2 YBR088C, Contig c2216 2801-3223                            30   1.9  
KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces...    32   2.4  
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    31   3.1  
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    31   3.5  
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    31   3.5  
Scas_628.24                                                            31   3.9  

>Scas_661.28
          Length = 621

 Score = 1246 bits (3223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/621 (96%), Positives = 600/621 (96%)

Query: 1   MKFYKRYHGNDYFLIWIIYYKLIQQSKQPIMSQEEAVQKVAENVANLHLDEATGEMVSKS 60
           MKFYKRYHGNDYFLIWIIYYKLIQQSKQPIMSQEEAVQKVAENVANLHLDEATGEMVSKS
Sbjct: 1   MKFYKRYHGNDYFLIWIIYYKLIQQSKQPIMSQEEAVQKVAENVANLHLDEATGEMVSKS 60

Query: 61  ELKKRIKQRQVXXXXXXXXXXXXXXXXXXXXXNTDLFADLDPSQYFEARSRQIQELRKTQ 120
           ELKKRIKQRQV                     NTDLFADLDPSQYFEARSRQIQELRKTQ
Sbjct: 61  ELKKRIKQRQVEAKKAAKKAAAQPKPESKKKKNTDLFADLDPSQYFEARSRQIQELRKTQ 120

Query: 121 SPNPYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGD 180
           SPNPYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGD
Sbjct: 121 SPNPYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGD 180

Query: 181 GVEVQLMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIEL 240
           GVEVQLMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIEL
Sbjct: 181 GVEVQLMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIEL 240

Query: 241 LTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIE 300
           LTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIE
Sbjct: 241 LTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIE 300

Query: 301 VETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNE 360
           VETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNE
Sbjct: 301 VETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNE 360

Query: 361 GIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEME 420
           GIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEME
Sbjct: 361 GIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEME 420

Query: 421 LNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARML 480
           LNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARML
Sbjct: 421 LNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARML 480

Query: 481 DKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDP 540
           DKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDP
Sbjct: 481 DKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDP 540

Query: 541 FDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR 600
           FDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR
Sbjct: 541 FDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR 600

Query: 601 EVLLFPTLKPDVLREEVEEKN 621
           EVLLFPTLKPDVLREEVEEKN
Sbjct: 601 EVLLFPTLKPDVLREEVEEKN 621

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/593 (87%), Positives = 546/593 (92%), Gaps = 4/593 (0%)

Query: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 90
           MSQ++ V+  AE VANLHLDEATGEMVSKSELKKRIKQRQV                   
Sbjct: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKK 60

Query: 91  XXNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150
              TDLFADLDPSQYFE RSRQIQELRKT  PNPYPHKF VSISNPEFL KYA+L++GET
Sbjct: 61  --KTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGET 118

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           LP EKV+IAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDY +   YEKDHDLLKRGD
Sbjct: 119 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGD 178

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270
           IVGVEGYVGRTQPKKGGEGE+SVFVSR++LLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 179 IVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238

Query: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330
           MNKDAR RFI RS+IIR+IRRFLDQR+FIEVETPMMNVIAGGATAKPF+THHNDLDMDMY
Sbjct: 239 MNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMY 298

Query: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           MRIAPELFLK+LVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 299 MRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358

Query: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
           LMFSEMVKEITGSYIIKYHPDP +P KE+ELNF+RPWKR+NMIEELEK FNV FP+GDQL
Sbjct: 359 LMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQL 418

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
           HTAETGEFLKK+L DNK+ECPPPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 419 HTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN
Sbjct: 479 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 538

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEV--EEKN 621
           ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEV  EE+N
Sbjct: 539 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVKKEEEN 591

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/590 (86%), Positives = 540/590 (91%), Gaps = 1/590 (0%)

Query: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 90
           MSQEEA +   E VANLHLDE TGEMVSKSELKKR+K RQV                   
Sbjct: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKK 60

Query: 91  XXNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150
             N DL ADLDPSQYFEARSRQI ELRKT SPNPYPHKF+VSISNPEFL KYA+L+RGET
Sbjct: 61  KKN-DLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGET 119

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           LPNE V+IAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY +   YE DHDL+KRGD
Sbjct: 120 LPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGD 179

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270
           IVGVEGYVGRTQPKKGGEGEISVFV RIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 180 IVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 239

Query: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330
           MNKD+R RFI RS+II++IR+FLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDMDM+
Sbjct: 240 MNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMF 299

Query: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 300 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 359

Query: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
           L+FSEMVKEI GSY+IKYHPDPNNPEKEMELNF RPWKR+NMIEELEKRFNVTFPAGDQL
Sbjct: 360 LLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQL 419

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
           HT ETGEFL+KVL DN +ECPPP+TNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 420 HTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 479

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCN
Sbjct: 480 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCN 539

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVEEK 620
           ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLR+EV+++
Sbjct: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLRDEVKKE 589

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/589 (86%), Positives = 536/589 (91%), Gaps = 2/589 (0%)

Query: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 90
           MSQEEA +   E+VANLHLDE TGE VSKSELKKRIKQRQ+                   
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 91  XXNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150
               D FADLDPSQYFEARSRQIQELRK+  PNPYPHKF VSIS P+FLKKY  L+RGET
Sbjct: 61  --KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGET 118

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           LPNEKV+IAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY++E  YE+DH LLKRGD
Sbjct: 119 LPNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270
           IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238

Query: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330
           MNKDAR RFI RS+II FIR+FLD+R FIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 239 MNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 298

Query: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           MRIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 299 MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358

Query: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
           L+FSEMVKEITGSY+IKYHP+P NPE EMELNF RPWKR+NMIEELEKRFNV FPAGDQL
Sbjct: 359 LLFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQL 418

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
           HTAETGEFLK +L +NKMEC PPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 419 HTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDE QL+DETFCN
Sbjct: 479 SRDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCN 538

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVEE 619
           ALEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL+EE+++
Sbjct: 539 ALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEEIKK 587

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/591 (85%), Positives = 541/591 (91%), Gaps = 2/591 (0%)

Query: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 90
           MS+E AVQ+VAENVANLHLDE TGEMVSKSELKKRIKQRQV                   
Sbjct: 1   MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKK 60

Query: 91  XXNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150
                  ADLDPS+YFEARSRQIQELRKTQ PNPYPHKF V+I  P FL KYA+LQRGET
Sbjct: 61  KVEN--MADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGET 118

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           LP E+V+IAGRIHAKRESGSKL+FYVLH DGVEVQ+MSQLQDY++E  YE+DH LLKRGD
Sbjct: 119 LPEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270
           IVGVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLHMLPADHFGFKDQETRYRKRYLDLI
Sbjct: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238

Query: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330
           MNKDARGRFI RS+II +IR+FLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDM MY
Sbjct: 239 MNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMY 298

Query: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           MRIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 299 MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358

Query: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
           L+FSEMVKEITG Y IK+HPDPN+P KE ++NF RPWKR+NMIEELEKRFNVTFPAGDQL
Sbjct: 359 LLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQL 418

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
           HTAETGEFLKK+L+DNKM+CPPPLTNARMLDKLVGELED CI+PTFIFGHPQMMSPLAK+
Sbjct: 419 HTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKH 478

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQL+DETFCN
Sbjct: 479 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCN 538

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVEEKN 621
           ALEYGLPPTGGWGCG+DRLAMFLTDSNTIREVLLFPTLKPDVL+E+++++N
Sbjct: 539 ALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLKPDVLKEDLKKEN 589

>Kwal_27.10541
          Length = 591

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/591 (84%), Positives = 536/591 (90%), Gaps = 1/591 (0%)

Query: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 90
           MSQEEAV+   + +ANLHLDEATGEMVSKSELKKR KQRQV                   
Sbjct: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKK 60

Query: 91  XXNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150
             N D FADLDPSQYFEARSRQIQEL+KTQSPNPYPHKF VSI   EFL+KYA+LQRGET
Sbjct: 61  KAN-DAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGET 119

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           LP EKV+IAGR+HAKRESGSKLKFYVLHGDGVEVQLMSQLQDY +E+ YE DHDL+KRGD
Sbjct: 120 LPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGD 179

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270
           I+GVEGYVGRTQPKKGGEGEISVFVSRI+LLTPCLH+LPADHFGFKDQETRYRKRYLDLI
Sbjct: 180 IIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLI 239

Query: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330
           MNKDAR RFI RS+II +IR+FLD+R FIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 240 MNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 299

Query: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           MRIAPELFLKELVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE
Sbjct: 300 MRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTE 359

Query: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
           ++FSEMVKEITGSY+IKYHPDP +P KE+ELNF RPWKR+NMIEELEKR NV FPAGD+L
Sbjct: 360 VLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDEL 419

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
           HTAETGEFLK+VL +N +ECPPPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAK 
Sbjct: 420 HTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKK 479

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN
Sbjct: 480 SRDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 539

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREEVEEKN 621
           ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPD  ++  EEK 
Sbjct: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDTQKDAEEEKT 590

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/586 (85%), Positives = 526/586 (89%)

Query: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 90
           MSQ   V    E VAN+HLDE TGEMVSKSELKKRIKQRQV                   
Sbjct: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKK 60

Query: 91  XXNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150
             NTD FADLDPSQYFEARSRQI ELRKT SPNPYPHKF+VS++ PEFL KYA L+RGET
Sbjct: 61  KANTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           LP EKV+IAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY+ E+ YE DH L+KRGD
Sbjct: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270
           IVGVEGYVGRT PKKGGEGEISVFVSRI+LLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240

Query: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330
           MNKDAR RFI RS+II ++R+FLD R FIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY
Sbjct: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300

Query: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360

Query: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
           +M SEMVKEITGSY+IKYHPDPN+  KE+ELNFTRPWKR+NMIEELE RF+VTFPAGDQL
Sbjct: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
           HTAETGEFLKKVL DNKM+C PPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQLVDETFCN
Sbjct: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLREE 616
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLKP+V++EE
Sbjct: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLKPEVVKEE 586

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  263 bits (672), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 177/495 (35%), Positives = 275/495 (55%), Gaps = 35/495 (7%)

Query: 138 FLKKYAYLQRGE-TLPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVE-VQLMSQLQDYNN 195
           FLKKY      +    N+K+++ GRI + R SG K+ F  L  DG+  +QL+   ++  N
Sbjct: 67  FLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAFIDLV-DGIHGIQLILNCREIGN 125

Query: 196 EADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHM-LPADHFG 254
            A +E +   L++GD V   G     +  K     IS+  + +  +     M LP     
Sbjct: 126 SATFESELSFLRKGDYVMTTGL---PRLSKSRMKNISLRCTDLPKILSVAQMPLPPKLI- 181

Query: 255 FKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGAT 314
             D       + +D  +N     R   RS I++ IR FL++R+FIEVETP+++  + GA 
Sbjct: 182 --DTVKSNSNKVVDYQINGFQNIRI--RSSILKSIRNFLEERDFIEVETPILSSKSNGAV 237

Query: 315 AKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCE 374
           AKPF++   D D  + +R+APEL+LK L++ G ++V+EIG+ FRNEGID +HNPEFTT E
Sbjct: 238 AKPFMSSSKDFD-KLMLRVAPELWLKRLIISGCNKVFEIGKSFRNEGIDGSHNPEFTTLE 296

Query: 375 FYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELN---FTRPW--KR 429
           FYQ+Y  + DL+ + E +F +++ ++T +  IK +     PE  +EL     +  W  KR
Sbjct: 297 FYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYL----PESLLELEDILKSNNWKFKR 352

Query: 430 MNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMEC---PPPLTNARMLDKLVGE 486
           +  +  L K   V      Q+   ++ + L+ +    K +        +++++L++L  E
Sbjct: 353 VEFLPTLSKELGVDL---SQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSSSQILNRLCSE 409

Query: 487 L--EDVC--INPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDPFD 542
           L  E  C   +PT I+ HP ++SPLAK + D     +RFE+F+  +E  NAY E N P  
Sbjct: 410 LIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYSNAYEEENCPQV 469

Query: 543 QRARFEEQARQK-DQGD-DEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR 600
           Q  +FE+QAR K D GD D    +D+ + NA+++G+PP GG+G GIDRL M +T    I 
Sbjct: 470 QLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDRLCMLITGCQRIE 529

Query: 601 EVLLFPTLKPDVLRE 615
           +VL F TL  DV R+
Sbjct: 530 QVLPFGTLD-DVNRQ 543

>Scas_633.28
          Length = 592

 Score =  252 bits (643), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 173/475 (36%), Positives = 265/475 (55%), Gaps = 42/475 (8%)

Query: 156 VAIAGRIHAKRESGSKLKFYVLHGD--GVEVQLMSQLQDYNNEADYEKDHD---LLKRGD 210
           + + GRI   R SG K+ F  L      V++Q++  L     E   E+  +   LLK+GD
Sbjct: 126 LQLNGRIKNIRYSGKKIAFIDLFDSRYNVKIQVILNLNKLKQETSEERFQEVVQLLKKGD 185

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIE-LLTPCLHMLPADHFGFKDQETRYRKRYLDL 269
            +   G  G ++ +      +S+  +++  LL+   + LP+     KD+    + R LD 
Sbjct: 186 YIKAFGIPGFSESRSHT---LSLKGTKLPVLLSAAQYPLPSQ---LKDELKARKNRVLDY 239

Query: 270 IMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDM 329
            +N       + RS IIR +R FLD++EFIEVETP+++  + GA A+PF+T    L+ ++
Sbjct: 240 QVN--GVSSLLLRSNIIRLLRSFLDKQEFIEVETPILSSKSNGANARPFITKSGSLNENL 297

Query: 330 YMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMT 389
            +RIAPEL+LK L++ G+DRVYEIG+ FRNEG+D THNPEFT  EFY+ Y  + DL++ +
Sbjct: 298 ELRIAPELWLKRLIISGLDRVYEIGKVFRNEGVDSTHNPEFTLLEFYERYLSMTDLIEKS 357

Query: 390 ELMFSEMVK--EITGSYIIKYHPDP--NNPEKEMELNFTRPWK--RMNMIEELEKRFNVT 443
           E +F  ++   E+  S   +YH  P  +N  + +E      WK  R+  +  L +  N+ 
Sbjct: 358 EDLFKHILVNLELKKS---EYHFSPAFDNLYRTLE---QANWKFRRIEFLPTLSQELNID 411

Query: 444 FPAGDQLHTAETGEFLKKVLADNKMEC-----PPPLTNARMLDKLVG-ELED-VC--INP 494
           F   D L+ AE  + L+ + A ++ E      P  L++ ++L+KL    LE   C  I+P
Sbjct: 412 FSLID-LNDAE--KLLESLPAHSRKELFENVPPGELSSQQILNKLCSFYLESRYCDTIHP 468

Query: 495 TFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQ- 553
           T IF HP+++SPLAK       + +RFE+F+  KE  NAY E N P  Q   F+ Q    
Sbjct: 469 TIIFHHPRIISPLAKAHPSNQQITKRFEMFINGKEYINAYEEENCPQLQEKNFQLQQFSK 528

Query: 554 ---KDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLF 605
              K++ +DE    DE F NA++ G+PP GG+G G+DRL M L +   I +VL F
Sbjct: 529 ETIKNKENDELISPDEGFINAMKSGMPPVGGFGLGVDRLCMLLMNKGRIEDVLPF 583

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  249 bits (636), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 172/495 (34%), Positives = 267/495 (53%), Gaps = 33/495 (6%)

Query: 130 KVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQ 189
           K +I    F+K+Y  L+  +        + G+I   R SG K+ F  L  D   +Q++  
Sbjct: 47  KPTIDVSRFIKEYDGLKVDDRSTTH--TLRGKITNMRFSGKKIGFINLLNDEKSLQVIVN 104

Query: 190 LQDY-NNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFV-SRIELLTPCLHM 247
           L +   +  +++      K GD + V G+ G +Q     +G +S+ V S +++L+P    
Sbjct: 105 LSNLPMSVGEFQAHMRKFKIGDHIQVTGFPGVSQK----QGTLSLKVNSELKMLSPAQIP 160

Query: 248 LPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMN 307
           +P       D   R   + LD ++N      +I R  + + IR +L ++EFIEVETP+++
Sbjct: 161 IPPKLL---DSSKRNSNKTLDYLVN-GTEAIYI-RHLVTKRIREWLYKQEFIEVETPIIS 215

Query: 308 VIAGGATAKPFVTHHNDLDMD--MYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT 365
             + GA AKPF+TH   +D +    +RIAPEL+LK L +GGM++++EIG+ FRNEGID T
Sbjct: 216 SKSNGANAKPFITHCTAIDKEQPFELRIAPELWLKRLCIGGMNKIFEIGKVFRNEGIDST 275

Query: 366 HNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTR 425
           HNPEFTT EFYQ Y ++  L++M+E +   + + I         P       +++ N  +
Sbjct: 276 HNPEFTTLEFYQCYINMEQLIEMSESLLIYVCQGID-------KPKAQELLDQIKANNGK 328

Query: 426 PWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECP-PPLTNARMLDKLV 484
            +KR+  +  L ++  + F   D        E LK+ L    +      ++  ++LD+L 
Sbjct: 329 -FKRLEFLPTLTQKTGIDFDNMD----LNNAELLKEKLRKANISISESSVSPQQILDELC 383

Query: 485 GE-LEDVC--INPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDPF 541
           G+ +E  C  + PT I+ HP ++SPLAK   +   + +RFE+F+  KE  NAY E N P 
Sbjct: 384 GKYIESQCDTLLPTIIYHHPTVLSPLAKTDSNNVQITKRFEIFINRKEYMNAYEEENCPD 443

Query: 542 DQRARFEEQARQKDQ-GDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIR 600
            Q  +F  Q   K Q  DDE   VD  +  A++YG+PP GG+G GIDRL M L D+  I 
Sbjct: 444 LQLEKFTNQLASKTQFKDDEMMAVDLPYVQAMKYGMPPIGGFGLGIDRLCMLLADTQRIE 503

Query: 601 EVLLFPTLKPDVLRE 615
           EVL F TL  DV R+
Sbjct: 504 EVLSFGTLD-DVNRQ 517

>Kwal_23.4717
          Length = 527

 Score =  241 bits (616), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 174/509 (34%), Positives = 266/509 (52%), Gaps = 54/509 (10%)

Query: 125 YPHKFKVSISN---PEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGDG 181
           YP   K+S +     EF +KY  L   E  P     +  RI + R SG  + F  +    
Sbjct: 42  YPSLSKISPATTTVSEFKQKYQALH--EDQPQSSEVLRARIDSVRISGKNMCFVDVSNAR 99

Query: 182 VEVQLMSQLQDYN------------NEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEG 229
             VQL   + +YN             E  ++   DL + GD +   G+ G +Q     E 
Sbjct: 100 NSVQL---ILNYNVMKTAMPSSALTREQFFQHVQDL-RPGDHIQACGFPGLSQ----RER 151

Query: 230 EISVFVSRI-ELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRF 288
            +S+  +++ E+L P L  +P       D   R   R LD ++N       + R Q+   
Sbjct: 152 TLSLKCTKLTEILAPALLAVPPK---LTDPAKRNTNRVLDYLVN--GHETLVVRHQVNTA 206

Query: 289 IRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMD 348
           IR FL+ R F+EVETP+++  A GA A+PF T     + ++ +R+APEL+LK LVV G++
Sbjct: 207 IREFLNMRGFLEVETPVLSSKANGAAAEPFSTRTKATNAELELRVAPELWLKRLVVAGVN 266

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKY 408
           RVYE+G+ FRNEG+D THNPEFTT EFYQ+YA + +L++++E ++  ++  +   +  + 
Sbjct: 267 RVYELGKVFRNEGVDATHNPEFTTLEFYQSYASMDELIELSEQLYLHVLNRVDNRFAREL 326

Query: 409 HPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAET---GEFLKKVLAD 465
                  + E+  N  + +KR+  +  L +   V F   D LH ++        K +  D
Sbjct: 327 -------KNELLANAGK-FKRVEFLPTLLRETGVDFTQID-LHNSDLISRALIAKNIHMD 377

Query: 466 NKMECPPPLTNARMLDKLVGEL--EDVCIN--PTFIFGHPQMMSPLAKYSRDTPGL-CER 520
              + P      ++LD L G       C +  PT I+ HP +MSPLAK + D   L  +R
Sbjct: 378 TTGKSP-----QQILDMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNPDDNMLTTKR 432

Query: 521 FEVFVATKEICNAYTELNDPFDQRARFE-EQARQKDQGDDEAQLVDETFCNALEYGLPPT 579
           FEVF+  KE  NAY E N P +Q  +FE +++ Q+  GD E+  VD ++  A+++G+PP 
Sbjct: 433 FEVFINGKEYINAYEEENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVEAMKWGMPPI 492

Query: 580 GGWGCGIDRLAMFLTDSNTIREVLLFPTL 608
           GG+G GIDRL M LT +  I  VL F T+
Sbjct: 493 GGFGLGIDRLCMLLTGNKRIERVLSFGTI 521

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  228 bits (582), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 163/499 (32%), Positives = 256/499 (51%), Gaps = 40/499 (8%)

Query: 135 NPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQ--- 191
           N  FL   A L   E  PN  ++I GRI + R SG K+ F  L+     ++  +QLQ   
Sbjct: 81  NERFLGNPATLHH-EDNPNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIV 139

Query: 192 DYN-------NEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPC 244
           +YN       ++A++ +  + LK+GD +   GY G +Q +      +S+  +++ ++   
Sbjct: 140 NYNKIGGSSEDKANFSEYMNFLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIVLSV 196

Query: 245 LHM-LPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVET 303
             + LP+      D+      R +D  +N       + R++II+ +R+FLD R F+EVET
Sbjct: 197 SQLPLPSR---LNDETKIKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVEVET 251

Query: 304 PMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGID 363
           P+++  + GA AKPF+T   D D  + +RIAPEL+LK L++ G+ +VYEIG+ FRNEGID
Sbjct: 252 PILSSKSNGAMAKPFITSSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGID 310

Query: 364 MTHNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELNF 423
            THN EF+T EFY+ Y  + D++  TE +F  ++  +   +     P P     E+ L  
Sbjct: 311 STHNAEFSTLEFYETYMSMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPKT-FSELHLAL 369

Query: 424 T-RPWK--RMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARML 480
           +   WK  ++  +  L K   +       L   +  E LK +  D   +  P   N   L
Sbjct: 370 SENNWKFRKVEFLPTLNKELGIDL-MNSGLDINKPSELLKALPKDIAKKYFPSADNTGQL 428

Query: 481 DKL--VGELEDVCIN--------PTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEI 530
             L  + +L DV +         PT I+  P ++SPLAK       + +RFEVF+  KE 
Sbjct: 429 SSLQILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEY 488

Query: 531 CNAYTELNDPFDQRARFEEQARQKDQGDDEAQ----LVDETFCNALEYGLPPTGGWGCGI 586
            NAY E N P  Q  +F +Q +  +   ++ +    ++D  +   ++YG+PP GG+G GI
Sbjct: 489 INAYEEENCPQLQLQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGI 548

Query: 587 DRLAMFLTDSNTIREVLLF 605
           DRL M   D   I EVL F
Sbjct: 549 DRLCMLFCDKKRIEEVLPF 567

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  219 bits (559), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 161/480 (33%), Positives = 243/480 (50%), Gaps = 45/480 (9%)

Query: 152 PNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEA----DYEKDHDLLK 207
           P     I G+I   R  G  + F  L   G  +QLM        +      ++     L+
Sbjct: 75  PERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNHSLVRAQLVAKRPFQNAIAGLR 134

Query: 208 RGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFG----FKDQETRYR 263
            GD V   G+ G ++ ++     +S+   ++        ML A          D+  R +
Sbjct: 135 LGDHVQPTGFPGLSKTER----TLSLKCRKVP------RMLAAAQIAIPQRLTDRVKRQQ 184

Query: 264 KRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHN 323
            R LD ++N      F  R + +  +R +L++R F+EVETPM++  + GA A PFVTH  
Sbjct: 185 NRTLDYLVNGLKVLEF--RHKALTALRAYLNRRGFLEVETPMLSAKSSGANATPFVTHLR 242

Query: 324 DLD-MDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADV 382
             D   + +RIAPEL+LK L VGG  RVYEIG+ FRNEGID THNPEFTT E YQ YA +
Sbjct: 243 GQDKQALELRIAPELWLKRLCVGGAQRVYEIGKVFRNEGIDATHNPEFTTLELYQCYAPL 302

Query: 383 YDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNV 442
            +L+++ +++  ++   +         P       EM  N    ++R+  +  L +   V
Sbjct: 303 DELLELAQVLLRDICVAVD-------TPVSRQLLAEMAQNGG-AFRRVEFLPTLSRETGV 354

Query: 443 TFPAGDQLHTAETGEFLKKVLADNKMECPPPLTN-ARMLDKLVGE-LED-VC--INPTFI 497
            + A D   +      ++  L+   ++ P  + +  ++L+KL  + +ED  C  + PT I
Sbjct: 355 DWAAVDLADSTA----IRVALSGAGIDVPESIVSPQQILNKLCADYIEDRYCQSLLPTAI 410

Query: 498 FGHPQMMSPLAKYSRDTPGL-CERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQ 556
             HP +MSPLAK    + GL   RFE+FV  +E+ NAY E N P +Q  + + Q R ++Q
Sbjct: 411 LHHPAVMSPLAK----SAGLVANRFELFVCGRELINAYEEENCPQEQLKKMQLQQRHREQ 466

Query: 557 -GDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLKPDVLRE 615
             D E+  +D  +  A++YG+PP GG G GIDRL M L     I EVL F  L  DV R+
Sbjct: 467 FHDQESMQIDHHYIEAMKYGMPPIGGLGLGIDRLCMLLLAKARIEEVLPFGCLD-DVNRQ 525

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 116/484 (23%), Positives = 198/484 (40%), Gaps = 70/484 (14%)

Query: 153 NEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKD----HDLLKR 208
           +++V    R+H  R+ G+ L F  L     +  L+  L   N E    K+       L  
Sbjct: 106 DKEVLFRARVHNTRQQGATLAFLTLRQ---QASLIQGLVKANKEGTISKNMVKWAGSLNL 162

Query: 209 GDIVGVEGYVGRT-QPKKGGEGE-ISVFVSRIELLTPCLHMLP------------ADHFG 254
             IV V G V +  +P K    + + + +++I  ++     LP            A+  G
Sbjct: 163 ESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEAAG 222

Query: 255 FK--DQETRYRKRYLDL--IMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETP-MMNVI 309
               + +TR   R +DL  + N+     F  ++ +    R +L  ++F EV TP ++   
Sbjct: 223 LPVVNLDTRLDYRVIDLRTVTNQ---AIFRIQAGVCELFREYLATKKFTEVHTPKLLGAP 279

Query: 310 AGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNP 368
           + G ++   VT+        Y+  +P+   ++L+V   +RVYEIG  FR E  +   H  
Sbjct: 280 SEGGSSVFEVTYFKG---KAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMT 336

Query: 369 EFTTCE----FYQAYADVYD-LMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELNF 423
           EFT  +    F + Y +V D L ++   +FSE+ K       +        P +E +L  
Sbjct: 337 EFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRK---QYPVEEFKLPK 393

Query: 424 TRPWKRMNMIEELEKRFNVTFPAGD-QLHTAETGEFLKKVLADNKMECPPPLTNARMLDK 482
                R+   E +E         GD +  + E  +FL K++ D         T+  +LDK
Sbjct: 394 DGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRDKYD------TDFYILDK 447

Query: 483 LVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELNDPFD 542
              E     I P +    P             P     ++ F+  +EI +    ++D   
Sbjct: 448 FPLE-----IRPFYTMPDPA-----------NPKYSNSYDFFMRGEEILSGAQRIHD--- 488

Query: 543 QRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREV 602
             A  +E+ +      ++  L D  +C+   YG PP  G G G++R+ MF  D   IR  
Sbjct: 489 -HALLQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRA 545

Query: 603 LLFP 606
            LFP
Sbjct: 546 SLFP 549

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 117/513 (22%), Positives = 207/513 (40%), Gaps = 100/513 (19%)

Query: 139 LKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEAD 198
           +++  +    E    ++V    R+H  R+ G+ L F  L     + +L+  L   N E  
Sbjct: 93  IQRIKFADLSENDDGKEVVFRARVHNSRQQGATLNFLTLRQ---QAELIQALVKSNKEGT 149

Query: 199 YEKD----HDLLKRGDIVGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP--- 249
             K        +    IV V G V + +   K      + + +++I  ++     +P   
Sbjct: 150 VSKQMVKWTSSINLESIVLVHGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILL 209

Query: 250 ---------ADHFGFK--DQETRYRKRYLDL--IMNKDARGRFIKRSQIIRFIRRFLDQR 296
                    A+  G    + +TR   R +DL  + N+     F  +S +    R FL  R
Sbjct: 210 EDASRSEAEAEAAGLPVVNLDTRLDARVIDLRTVTNQ---AIFKIQSGVCELFREFLRNR 266

Query: 297 EFIEVETPMMNVIAGGATAKPF-VTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGR 355
           +F E+ TP +        A  F VT+      + Y+  +P+++ +EL+    +RV+E+G 
Sbjct: 267 DFTEIHTPKLLGSPSEGGANVFEVTYFKG---NSYLAQSPQIYKQELIAADFERVFEVGP 323

Query: 356 QFRNEGIDM-THNPEFTTCEFYQAYADVYD-LMDMTELMFSEMVKEITGSY------IIK 407
            FR E  +   H  EFT  +   A+ + YD ++D+   +F  +  E+   Y      + K
Sbjct: 324 VFRAENSNTHRHMTEFTGLDLEMAFEEHYDEVLDVLSELFVFIFTELKSRYSKEIALVRK 383

Query: 408 YHP--DPNNPE--KEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVL 463
            +P  D   P+  K + L+F      + M+ E          AG Q+   E         
Sbjct: 384 QYPVEDFKLPKDGKMVRLHFK---DGIAMLRE----------AGKQVDDFE--------- 421

Query: 464 ADNKMECPPPLTNARMLDKLVGELED----------VCINPTFIFGHPQMMSPLAKYSRD 513
            D   E      N ++L KLV E  D          + + P +    P+     ++YS  
Sbjct: 422 -DLSTE------NEKLLGKLVREKYDTDFYILDKFPLAVRPFYTMPDPED----SRYSNS 470

Query: 514 TPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALE 573
                  ++ F+  +EI +    ++D        +E+ +  +   ++  L D  +C+A  
Sbjct: 471 -------YDFFMRGEEILSGAQRIHD----SEFLKERMKVHELSPEDPGLKD--YCDAFT 517

Query: 574 YGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
           YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 518 YGCPPHAGGGIGLERVVMFYLDLKNIRRASLFP 550

>Scas_347.3
          Length = 552

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 120/516 (23%), Positives = 206/516 (39%), Gaps = 76/516 (14%)

Query: 118 KTQSPNPYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVL 177
           K   P   PH+ K    NP             T   ++V    R+H  R+ G+ L F   
Sbjct: 78  KGARPVNSPHRIKFESLNPA------------TDDGKEVVFRARVHNTRQQGATLSFLTF 125

Query: 178 HGDGVEVQLMSQLQ-DYNNEADYEKDHDLLKRGDIVGVEGYVGRTQP--KKGGEGEISVF 234
                 +Q + ++Q D +      K    L    IV V+G V R +   K     ++ + 
Sbjct: 126 RQQHDLIQGLVKVQKDGSVSKQMVKWAGSLNLESIVVVKGIVKRVEEPIKSATVQDLEIH 185

Query: 235 VSRIELLTPCLHMLP------------ADHFGFK--DQETRYRKRYLDL--IMNKDARGR 278
           ++ I  ++     LP            A+  G    + +TR   R +DL  + N+     
Sbjct: 186 ITDIHSISETPETLPILLEDASRSEAEAEAAGLPVVNLDTRLDARVIDLRTVTNQ---AI 242

Query: 279 FIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELF 338
           F  +S + +  R +L   +F EV TP +        A  F   +       Y+  +P+  
Sbjct: 243 FKIQSGVCQLFREYLSGLKFTEVHTPKLLGAPSEGGASVFEVSY--FKGKAYLAQSPQFN 300

Query: 339 LKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCE----FYQAYADVYDLM-DMTELM 392
            ++L+V   ++V+EIG  FR E  +   H  EFT  +    F + Y +V D++ D+   +
Sbjct: 301 KQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGLDMEMAFEEHYHEVLDVLSDLFVFI 360

Query: 393 FSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAG--DQL 450
           F+E+ K  +    I        P ++ +L       R+   E ++   +     G  D L
Sbjct: 361 FTELKKRFSKEIEIVRK---QYPVEDFKLPADGKMVRIQYKEGIQMLKDAGKEIGDFDDL 417

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510
            T E  +FL K++ +         T+  +LDK       + I P +    P    P  +Y
Sbjct: 418 ST-ENEKFLGKLVREKYD------TDFYILDKF-----PLAIRPFYTM--PDAEDP--RY 461

Query: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570
           S         ++ F+  +EI +    ++D     A  +E+ +      ++  L D  +C+
Sbjct: 462 SNS-------YDFFMRGEEILSGAQRIHD----HALLQERMKVHGLSSEDPGLKD--YCD 508

Query: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
              YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 509 GFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 544

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 117/492 (23%), Positives = 194/492 (39%), Gaps = 85/492 (17%)

Query: 153 NEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNE--ADYEKDHDLLKRGD 210
           +++V    R+H  R+ G+ L F  L      +Q + +      +   +  K    L    
Sbjct: 101 DKEVLFRARVHNTRQQGATLAFLTLRQQSSLIQALVKADKAGEKISKNMVKWAGSLNLES 160

Query: 211 IVGVEGYVGRT-QPKKGGE-GEISVFVSRIELLTPCLHMLP------------ADHFGFK 256
           IV V G V    +P K     ++ + V++I  ++     LP            A+  G  
Sbjct: 161 IVLVRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGLP 220

Query: 257 --DQETRYRKRYLDLIMNKDARGRFIKRSQ--IIRFIRRFLDQREFIEVETPMMNVIAGG 312
             + +TR   R +DL   +    + I R Q  +    R FL  ++F+EV TP M   A  
Sbjct: 221 VVNLDTRLDNRVIDL---RTVTNQAIFRIQHGVCALFREFLANKKFVEVHTPKMLGAASE 277

Query: 313 ATAKPF-VTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEF 370
             A  F VT+        Y+  +P+   ++L+V   ++V+EIG  FR E  +   H  EF
Sbjct: 278 GGANVFEVTYFKG---KAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEF 334

Query: 371 TTCEFYQAYADVY-DLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKR 429
           T  +   A+ + Y +++D+   +F  +  E+   Y            KE+EL      ++
Sbjct: 335 TGLDMEMAFEEHYHEVLDVLSELFVFLFTELKKRYA-----------KEIEL-----VRK 378

Query: 430 MNMIEELE-----KRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARMLDKLV 484
              +EE +     K   +T+  G Q+        LK+   D          N + L KLV
Sbjct: 379 QYPVEEFKLPKDGKMVRITYKEGIQM--------LKEAGKDIGDFEDLSTENEKFLGKLV 430

Query: 485 GELED----------VCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAY 534
            E  D          + I P +    P+            P     ++ F+  +EI +  
Sbjct: 431 REKYDTDFYILDKFPLEIRPFYTMPDPE-----------DPRYSNSYDFFMRGEEILSGA 479

Query: 535 TELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLT 594
             ++D    +   E   R K  G D      + +C+   YG PP  G G G++R+ MF  
Sbjct: 480 QRIHD---HKMLME---RMKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFL 533

Query: 595 DSNTIREVLLFP 606
           D   IR   LFP
Sbjct: 534 DLKNIRRASLFP 545

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 108/487 (22%), Positives = 190/487 (39%), Gaps = 76/487 (15%)

Query: 153 NEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKD----HDLLKR 208
            ++V +  R+H  R+ G+ L F +L        L+  L   N E    K        L  
Sbjct: 105 GKEVLLRSRVHTVRQQGATLAFLMLRQRS---SLIQALVKANAEGTVSKQMVKWAGSLNL 161

Query: 209 GDIVGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFG 254
             IV V G V + +   K     +  + ++++  ++     LP            A+  G
Sbjct: 162 ESIVLVRGVVRKVEEPVKSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAAG 221

Query: 255 FK--DQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGG 312
               + +TR   R +DL    + +  F  ++ +    R F   R F E+ TP +      
Sbjct: 222 LPVVNLDTRLDARVIDLRTVTN-QAIFRIKAGVCGLFREFFQSRNFTEIHTPKLLASPSE 280

Query: 313 ATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFT 371
             A  F   +     + Y+  +P+ + ++L+    +RV+E+   FR E  +   H  EFT
Sbjct: 281 GGANVFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFT 338

Query: 372 TCE----FYQAYADVYDLM-DMTELMFSEMVKEITG--SYIIKYHPDPNNPEKEMELNFT 424
             +    F + Y +V ++M +M   +F+E+ K      + + K +P            F 
Sbjct: 339 GVDLEMAFEEHYHEVIEVMGEMFMFVFTELKKRFAREIAQVRKQYPVEE---------FK 389

Query: 425 RPWKRMNMIEELEKRFNVTFPAGDQLH-----TAETGEFLKKVLADNKMECPPPLTNARM 479
            P     +I   ++   +   AG ++      + E   FL K++ +         T+  +
Sbjct: 390 FPADGKMVILHYKEGIAMLREAGKEIGDFDDLSTENERFLGKLVREKYD------TDFYI 443

Query: 480 LDKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICNAYTELND 539
           LDK   EL      P +    P             P     ++ F+  +EI +    ++D
Sbjct: 444 LDKFPAEL-----RPFYTMPDPA-----------DPRYSNSYDFFMRGEEIMSGAQRIHD 487

Query: 540 PFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTI 599
           P   R R +    Q +    +A   D  +C+A  YG PP  G G G++R+ MF  D   I
Sbjct: 488 PELLRERMKHHGLQPE----DAGFKD--YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNI 541

Query: 600 REVLLFP 606
           R   LFP
Sbjct: 542 RRATLFP 548

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 116/494 (23%), Positives = 197/494 (39%), Gaps = 94/494 (19%)

Query: 155 KVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDH----DLLKRGD 210
           +V    R+H  R+ G+ L F  L     + +L+  L   N E    K        +    
Sbjct: 106 EVVFRARVHNSRQQGATLAFLTLRQ---QAELIQGLVKANKEGTVSKQMVKWVGSINLES 162

Query: 211 IVGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFGFK 256
           IV V G V + +   K      + V +++I  ++     LP            A+  G  
Sbjct: 163 IVVVHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLP 222

Query: 257 --DQETRYRKRYLDL--IMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETP-MMNVIAG 311
             + +TR   R +DL  + N+     F  +S +    R FL  ++F EV TP ++   + 
Sbjct: 223 VVNLDTRLDSRVIDLRTVTNQ---AIFRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSE 279

Query: 312 GATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEF 370
           G +    VT+        Y+  +P+L+ ++L+    +RV+E+   FR E  +   H  EF
Sbjct: 280 GGSNVFEVTYFKG---KSYLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEF 336

Query: 371 TTCEFYQAYADVYD-----LMDMTELMFSEM----VKEIT---GSYIIKYHPDPNN---- 414
           T  +   A+ + YD     L ++   +FS++     KEI      Y ++    P +    
Sbjct: 337 TGLDLEMAFEEHYDEVVDTLAELFVFIFSQLKTRYAKEIALVRKQYPVEEFKLPKDGKMV 396

Query: 415 --PEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPP 472
             P KE         K ++  E+L               + E  + L K++ D K E   
Sbjct: 397 RIPFKEGIALLREAGKDVDDFEDL---------------STENEKLLGKLVRD-KYE--- 437

Query: 473 PLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVATKEICN 532
             T+  +LDK       + I P +    P    P  +YS         ++ F+  +EI +
Sbjct: 438 --TDFYILDKF-----PLAIRPFYTM--PDAEDP--RYSNS-------YDFFMRGEEILS 479

Query: 533 AYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMF 592
               ++D        +E+    +   ++  L D  +C A  YG PP  G G G++R+ MF
Sbjct: 480 GAQRIHDA----DLLKERMNAHEVHPEDPGLKD--YCEAFTYGCPPHAGGGIGLERVVMF 533

Query: 593 LTDSNTIREVLLFP 606
             D   IR   LFP
Sbjct: 534 YLDLKNIRRASLFP 547

>Kwal_27.12235
          Length = 650

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 115/255 (45%), Gaps = 19/255 (7%)

Query: 156 VAIAGRIHAK-RESGSKLKFYVLHG-DGVEVQLMSQLQDYNNEADYEKDHDLLKRGDIVG 213
           V + G I  K ++ G  L F VL   +G  +QL+   Q     A+ E         D+V 
Sbjct: 50  VILNGWIDKKPKKVGKDLNFGVLRDPEGDLIQLVDS-QSLLKAANVE---------DVVQ 99

Query: 214 VEGYVGRTQPKKGGEG-EISVFVSRIELLTPCLHMLPADHFGFKDQETRY-RKRYLDLIM 271
           +EG +   + K+     E  + +S++  L       P+    FK+Q       RYL L +
Sbjct: 100 IEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFKEQGNYPPEHRYLQLRL 158

Query: 272 NKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDL-DMDMY 330
            K  +    KR +I  +IR+ L+ + F E+ETP++         +  V   N L D   +
Sbjct: 159 PK-YQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAREFLVPARNKLSDKPTF 217

Query: 331 MRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDM 388
             +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT  +   A+A    +MD+
Sbjct: 218 YALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQVDLEMAFASGSQVMDV 277

Query: 389 TELMFSEMVKEITGS 403
            E   +     ++ S
Sbjct: 278 VESTITNTWNSLSSS 292

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSR--DTPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F+   +   
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIFKNILKI-- 571

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 572 ---SEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 112/471 (23%), Positives = 182/471 (38%), Gaps = 70/471 (14%)

Query: 153 NEKVAIAGRIHAKRESGSKLKFYVLH-GDG-VEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
            ++V ++G IH  R S  K+ F VL  G G ++  L   L       D   +  +   G 
Sbjct: 129 GQRVKVSGWIHRLR-SNKKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTLESTVTLYGT 187

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLD-- 268
           IV +    G+T P   G  E++V    +  L P       D F  K  E       LD  
Sbjct: 188 IVKLPE--GKTAP---GGVELNVDYYEVVGLAPG----GEDSFTNKIAEGSDPSLLLDQR 238

Query: 269 -LIMNKDARGRFIK-RSQIIRFIRRFLDQREFIEVETPMM--NVIAGGATAKPFVTHHND 324
            L +  DA    +K R+ +++ +RR  D+    EV  P M    + GG+T    +   N 
Sbjct: 239 HLALRGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----LFKMNY 294

Query: 325 LDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVY 383
              + Y+  + +L+L E  +  +  VY I   FR E      H  E+T  E   A+    
Sbjct: 295 YGEEAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFLTFD 353

Query: 384 DLMDMTELMFSEMVK-----EITGSYIIKYHPDPNNPEKE-MELNFTRPWKRMNMIEELE 437
           DL+   E +  + V+      I G  + + +P+   P+   M L +      +N   +++
Sbjct: 354 DLLQHIETLIVKSVQYVLEDPIAGPLVKQLNPNFKAPKAPFMRLQYKDAITWLNE-HDIK 412

Query: 438 KRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFI 497
                 F  GD +  A          A+ KM                    D    P F+
Sbjct: 413 NEEGEDFKFGDDIAEA----------AERKMT-------------------DTIGVPIFL 443

Query: 498 FGHP-QMMSPLAKYSRDTPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFEEQARQKD 555
              P ++ S   K   D P + E  +V +    EI      ++D  +  A F+ +    D
Sbjct: 444 TRFPVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGFKREGIDTD 503

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
                       F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 504 --------AYYWFIDQRKYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 123/520 (23%), Positives = 200/520 (38%), Gaps = 93/520 (17%)

Query: 110 SRQIQELRKT-QSPNPYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRES 168
           +R+++ ++ T Q     P   KV IS     K Y       T    ++ ++G IH  R S
Sbjct: 103 ARKLEAMKITIQEDTSLPKAEKVKIS-----KSY-------TTIGSRIKVSGWIHRLR-S 149

Query: 169 GSKLKFYVLH-GDGVEVQLMSQLQDYNNEADYEKDH--DLLKRGDIVGVEGYVGRTQPKK 225
              L F VL  G G    +++         D  K +    L     V + G + +    K
Sbjct: 150 NKSLCFVVLRDGTGFLQAVLA--------GDLAKAYQTSTLTLESTVTLYGTISKLPEGK 201

Query: 226 GGEGEISVFVSRIELLTPCLHMLPA--DHFGFKDQETRYRKRYLD---LIMNKDARGRFI 280
              G + + V   E+++    + P+  D F  K QE       LD   L +  +     +
Sbjct: 202 TAPGGVELAVDYYEIVS----LAPSGEDAFTNKVQEGADPSLLLDQRHLALRGETLSAVM 257

Query: 281 K-RSQIIRFIRRFLDQREFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPEL 337
           K R+ ++R IRR  ++ +  EV  P M    + GG+T      +      + Y+  + +L
Sbjct: 258 KVRASLLRAIRRAYEEEQLTEVTPPCMVQTQVEGGSTLFKLDYYGE----EAYLTQSSQL 313

Query: 338 FLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELMFSEM 396
           +L E  +  +  VY I   FR E      H  E+T  E    + D  DL+   E + ++ 
Sbjct: 314 YL-ETCLASLGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDFDDLLSHIERVITKS 372

Query: 397 VK-----EITGSYIIKYHPD---PNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGD 448
           V+      I G  I + +PD   P  P K +E      W + + I+  +      F  GD
Sbjct: 373 VQYVLEDPIAGPLIKQLNPDFQAPQLPFKRLEYKDAIEWLKEHGIKNEDGE---EFKFGD 429

Query: 449 QLHTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHP-QMMSPL 507
            +  A          A+ KM                    D    P  +   P ++ S  
Sbjct: 430 DIAEA----------AERKM-------------------TDTIGVPILLTRFPVEIKSFY 460

Query: 508 AKYSRDTPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDE 566
            K   D P + E  +V + T  EI      ++   +  A F      K +G D A     
Sbjct: 461 MKRCTDDPSVTESVDVLMPTVGEITGGSMRIDSIEELMAGF------KREGIDPAAYY-- 512

Query: 567 TFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
            F +   YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 513 WFIDQRRYGSCPHGGYGLGTERILAWLCDRFTVRDCSLYP 552

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 104/475 (21%), Positives = 185/475 (38%), Gaps = 78/475 (16%)

Query: 153 NEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDL--LKRGD 210
           +++V ++G +H  R + S +   +  G G    +++         D  + + +  L    
Sbjct: 129 DKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQTVLT--------GDLARSYQIVNLTLET 180

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKD--QETRYRKRYLD 268
            + + G +      K   G + +FV   E++ P     P+    F +  QE       LD
Sbjct: 181 TITLYGTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLD 236

Query: 269 ---LIMNKDARGRFIK-RSQIIRFIRRFLDQREFIEVETPMM--NVIAGGATAKPFVTHH 322
              L++  +     +K R+ +++ IRR  D+    EV  P M    + GG+T      + 
Sbjct: 237 QRHLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGSTLFKLDYYG 296

Query: 323 NDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYAD 381
                + ++  + +L+L E  +  +  VY I   FR E      H  E+T  E    + D
Sbjct: 297 E----EAFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLD 351

Query: 382 VYDLMDMTELMFSEMVK-----EITGSYIIKYHPD---PNNPEKEMELNFTRPWKRMNMI 433
             DL+   E + ++ ++      + G  + K +P+   P  P K ME      W + + I
Sbjct: 352 FDDLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGI 411

Query: 434 EELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCIN 493
           +  E +    F  GD +  A          A+ KM                    D    
Sbjct: 412 KNEEDK---EFQFGDDIAEA----------AERKM-------------------TDTIGV 439

Query: 494 PTFIFGHP-QMMSPLAKYSRDTPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQA 551
           P  +   P ++ S   K   D   + E  +V + T  EI      ++D  +  A F    
Sbjct: 440 PILLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF---- 495

Query: 552 RQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
             K +G D A      F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 496 --KREGIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>Kwal_14.2303
          Length = 475

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 111/268 (41%), Gaps = 34/268 (12%)

Query: 156 VAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKD----HDLLKRGDI 211
           V +  R+H  R+ G+ L F  L     +  L+  L   N E    K        +    I
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQ---QANLIQALVKSNAEGTISKQMVKWTGSISPESI 177

Query: 212 VGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLP------------ADHFGFK- 256
           V V G V + +   K      + + +++I  ++     LP            A+  G   
Sbjct: 178 VLVHGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLPV 237

Query: 257 -DQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATA 315
            + +TR   R +DL    + +  F  +S +    R FL QR+F+E+ TP +        A
Sbjct: 238 VNLDTRLDARVIDLRTATN-QAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGGA 296

Query: 316 KPF-VTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTC 373
             F VT+        Y+  +P+ + +EL+    +RV+E+   FR E  +   H  EFT  
Sbjct: 297 NVFEVTYFKG---KSYLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTGL 353

Query: 374 EFYQAYADVYD-----LMDMTELMFSEM 396
           +   A+ + YD     L D+   +F+++
Sbjct: 354 DLEMAFEEHYDEVIDVLSDLFVFIFTQL 381

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 7/135 (5%)

Query: 265 RYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFV----T 320
           RYL L  N   +    KRS I + IR   +  +F EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 321 HHNDLDMDMY-MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 379
             +D     Y +  +P+ + + L+  G+++ Y++ R FR+E +     PEFT  +   A+
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 380 ADVYDLMDMTELMFS 394
           A+  D+M + E   S
Sbjct: 270 ANSEDVMKIIEKTVS 284

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSR--DTPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L  Y +   TP  C    +++ V   E+    T ++DP  Q   FE+  +   
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
              D A  +     NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 ---DNAYELFGHLLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 71/143 (49%), Gaps = 6/143 (4%)

Query: 265 RYLDLIMNKDARGRFIK-RSQIIRFIRRFLDQREFIEVETPMM-NVIAGGATAKPFVTHH 322
           RYL L + K     F++ R +  + IR+ LD   F EVETPM+      GA      T  
Sbjct: 152 RYLQLRLPK--YQNFLRTRYEASKLIRKDLDTYRFTEVETPMLFKSTPEGAREFLVPTRR 209

Query: 323 NDLDMDMYMRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYA 380
           ++     +  +  +P+ + + L+  G+ R ++I R FR+E +     PEFT  +   A+A
Sbjct: 210 SESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARCFRDEDLRSDRQPEFTQVDLEMAFA 269

Query: 381 DVYDLMDMTELMFSEMVKEITGS 403
              ++MD+ E M ++    ++ +
Sbjct: 270 SGNEVMDVVEDMVTKAWSNLSSN 292

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSRDT----PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L  Y + +      L + +++ V+  E+    T ++DP  Q   F+E  +   
Sbjct: 519 HPFTMVKLDDYKKLSNEAISCLGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH- 577

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
               + + +      A E G PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 578 ----QPERLFGHLLTAFEMGTPPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>Scas_700.6
          Length = 658

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 97/216 (44%), Gaps = 14/216 (6%)

Query: 187 MSQLQDYNNEA----DYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGE----ISVFVSRI 238
            SQL+D   +     D       L R D++ V G + + + K     E      + V +I
Sbjct: 76  FSQLRDVKGDTVQLVDSGSQLKALNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEKI 135

Query: 239 ELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFI-KRSQIIRFIRRFLDQRE 297
            +L    +  P+    FK ++  Y   Y  L +       F+ KR QI   +R+ L++ E
Sbjct: 136 SVLNSS-NEKPSQLHEFK-KDGNYPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEEE 193

Query: 298 FIEVETPMM-NVIAGGAT--AKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIG 354
           F+E+ETP++      GA     P  T  N       +  +P+ + + L+  G+ + +++ 
Sbjct: 194 FLEIETPILFKPTPEGAREFLVPTRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQVA 253

Query: 355 RQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
           R FR+E +     PEFT  +   ++++  D+M + E
Sbjct: 254 RCFRDEDLRADRQPEFTQIDMEMSFSNGEDVMALLE 289

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSR--DTPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q   FE   + ++
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILKIEN 581

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
             +    L+      A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 582 AEELFGHLL-----RAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 112/265 (42%), Gaps = 30/265 (11%)

Query: 152 PNEKVAIAGRIHAK-RESGSKLKFYVLHG-DGVEVQLMSQLQDYNNEADYEKDHDLLKRG 209
           PN KV + G I AK ++ G  L F  L   +G ++QL+   Q +  E+  E         
Sbjct: 44  PN-KVVLNGWIDAKPKKVGKNLIFGTLRDPNGEKIQLVDS-QSFLKESQVE--------- 92

Query: 210 DIVGVEGYVGRTQPKKGGEGEISVFVSRIELLT-------PC-LHMLPADHFGFKDQETR 261
           D+V + G +   +  +     I   +  IEL         P  L  L AD   F  +   
Sbjct: 93  DVVQIIGELSEKKQTQQSTVNIEYELKIIELQKLNQANKKPSQLQDLKADDGAFPPE--- 149

Query: 262 YRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTH 321
              RYL L + K  +     R +  + +R  LD   F EVETP++         +  V  
Sbjct: 150 --YRYLQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPT 206

Query: 322 HNDLDMDMYMRI---APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQA 378
              +D +        +P+ + + L+  G++R +++ R FR+E +     PEFT  +   A
Sbjct: 207 RGKIDGEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMA 266

Query: 379 YADVYDLMDMTELMFSEMVKEITGS 403
           ++   D+ ++ E + +    ++  S
Sbjct: 267 FSSGKDVREVVEKVITSTWNKLHAS 291

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSR--DTPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L  Y++    P  C  E +++ V   E+    T ++DP  Q   F E    K+
Sbjct: 511 HPFTMVNLRDYNKLESDPLSCHGEHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKN 570

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
             D    L+     NA + G PP  G+  G DR+   L  S +IR+V+ FP
Sbjct: 571 PEDLFGHLL-----NAFKMGTPPHAGFAIGFDRMCAMLCGSESIRDVIAFP 616

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 276 RGRFIKRSQIIRFIRRFLDQREFIEVETPMM-NVIAGGATAKPFVTHHNDLDMDMYMRI- 333
           + R   R    + +R  L++  F+EVETP++      GA      T H      ++  + 
Sbjct: 162 QARMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALP 221

Query: 334 -APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390
            +P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   A+A+  D+M + E
Sbjct: 222 QSPQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVE 279

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSR--DTPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L  Y +  + P  C  + ++  V   E+    T ++DP  QR  F +  +  +
Sbjct: 513 HPFTMVRLQDYQKLSEKPLSCLGQHYDFVVNGVELGGGSTRVHDPVLQRYIFNQILKINN 572

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
           +      L++     A   G PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 573 EDQVFGHLLE-----AFSMGTPPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>Scas_607.14
          Length = 555

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 111/505 (21%), Positives = 193/505 (38%), Gaps = 94/505 (18%)

Query: 124 PYPHKFKVSISNPEFLKKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLH-GDG- 181
           P   KFK+         K +Y Q G+     +V I+G +H  R S  K+ F VL  G G 
Sbjct: 115 PVAKKFKI---------KGSYGQVGQ-----RVKISGWVHRFR-SNKKVVFLVLRDGTGF 159

Query: 182 VEVQLMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELL 241
           ++  L   L       D   +  +   G I+ V    G+T P     G++ + V   E++
Sbjct: 160 LQCVLTGDLALAKQTLDITLETTVTLYGTIIKVPE--GKTAP-----GDVELVVDYYEVV 212

Query: 242 TPCLHMLPADHFGF-------KDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLD 294
                  P+    F        D      +R+L L   +   G    R+ ++R +RR  +
Sbjct: 213 ----GQAPSGEEAFTNKIAEDSDPSLLLDQRHLAL-RGETLSGVMKVRAALLRAVRRVYE 267

Query: 295 QREFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYE 352
           +   +EV  P M    + GG+T    +   +    + ++  + +L+L E  +  +  V+ 
Sbjct: 268 EEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLYL-ETCLPALGDVFC 322

Query: 353 IGRQFRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELMFSEMVK-----EITGSYII 406
           +   FR E      H  E+T  E   A+    +L++  E +  + V+      + G  + 
Sbjct: 323 VQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLEHIETLIVKSVQYVMEDPVAGPIVN 382

Query: 407 KYHPD---PNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVL 463
           + HP    P  P   +E      W + + I+  +      F  GD +  A          
Sbjct: 383 QLHPHFVPPKGPFMRLEYKDAITWLQEHNIKNEDGE---DFKFGDDIAEA---------- 429

Query: 464 ADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHP-QMMSPLAKYSRDTPGLCERFE 522
           A+ KM                    D    P  +   P ++ S      +D P + E  +
Sbjct: 430 AERKM-------------------TDTLNVPILLTRFPVEIKSFYMPKCKDDPRVTESVD 470

Query: 523 VFVAT-KEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGG 581
           V + T  EI      ++D  +  A F      K +G D        F +  +YG  P GG
Sbjct: 471 VLMPTVGEITGGSMRISDIDELMAGF------KREGIDPKPYY--WFIDQRKYGTCPHGG 522

Query: 582 WGCGIDRLAMFLTDSNTIREVLLFP 606
           +G G +R+  +L +  T+R+  L+P
Sbjct: 523 YGLGTERILAWLCNRFTVRDCSLYP 547

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 79/353 (22%), Positives = 144/353 (40%), Gaps = 47/353 (13%)

Query: 259 ETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPF 318
           E ++R  YL  ++      RF  R ++   + + LD  +F  V  P++  I      + F
Sbjct: 154 EFKHRTTYLSNLL------RF--RHKVESQLTKTLDGLDFTMVRPPILTSIDCEGAGEMF 205

Query: 319 VTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQ 377
               +  D  + + ++ +L L E+++ G+ RVY +   FR E  D   H  EF   E   
Sbjct: 206 NLKQDHWDEIVNLTVSSQLHL-EVLMMGLGRVYCLQPCFRAEKSDTNRHLCEFWMLEVEA 264

Query: 378 AYADVYD-LMDMTELMFSEMVKEITGSY-IIKYHPDPNNPE-KEMELNFTRPWKRMNMIE 434
           ++ D  + LMD+ ELM   +V  ++ +  + KY P   N +         + WKR+   +
Sbjct: 265 SFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPVGCNIDITSRWAKLLQDWKRITYTD 324

Query: 435 ELEKRFNVTFPAGDQL-HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCIN 493
            +E   +    +G +  H    G+ L                + R L    G        
Sbjct: 325 AVEALLS----SGVKFEHDLAWGKDLNS-------------EHERWLCDHFG-------G 360

Query: 494 PTFIFGHPQMMSPLAKYSRDTPGLCERFEV-FVATKEICNAYTELNDPFDQRARFEEQAR 552
           P F+  +P+         R      E F++ F    EI       +D +D     +++  
Sbjct: 361 PVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIGEIVGGSVREDD-YDT---LKQEIE 416

Query: 553 QKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLF 605
           ++D   ++     + + N  + G  P GG+G GI+RL  +L  +  IR+ + F
Sbjct: 417 RRDMASNQL----DWYLNLRKEGTVPHGGFGIGIERLVSYLYGNPNIRDSIPF 465

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 76/337 (22%), Positives = 127/337 (37%), Gaps = 56/337 (16%)

Query: 282 RSQIIRFIRRFLDQREFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFL 339
           R+  +R IRR  +    +EV  P M    + GG+T    +   +    + ++  + +L+L
Sbjct: 252 RAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLYL 307

Query: 340 KELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTELMFSEMVK 398
            E  +  +  V+ I   FR E      H  E+T  E    + D   L+  TE + + +V+
Sbjct: 308 -ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLVR 366

Query: 399 -----EITGSYIIKYHPD---PNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450
                 + G  + + +PD   P  P   +E      W   + I+  E      F  GD +
Sbjct: 367 YVLEDPVAGPLVKQLNPDFVPPQMPFMRLEYKDAITWLNEHGIKNEEGE---EFKFGDDI 423

Query: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHP-QMMSPLAK 509
             A          A+ KM                    D    P F+   P ++ S   K
Sbjct: 424 AEA----------AERKMT-------------------DTIGKPIFLTRFPLELKSFYMK 454

Query: 510 YSRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFC 569
              D P + E F+V + T       +   D  D     E  A  K +G +        F 
Sbjct: 455 RCADDPRVTESFDVLMPTVGEVTGGSMRIDSLD-----ELMAGFKREGVNPEPYY--WFS 507

Query: 570 NALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
           +   YG  P GG+G G +R+  +L +   +R+  L+P
Sbjct: 508 DQRRYGSCPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 9/111 (8%)

Query: 500 HPQMMSPLAKYSRDTPG----LCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKD 555
           HP  M  L  Y + T      L + +++ +   E+    T ++DP  Q+  FE   +  +
Sbjct: 520 HPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFENVLKISN 579

Query: 556 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
                 Q++     +A E G PP  G+  G DR+   L  +++IR+V+ FP
Sbjct: 580 Y-----QILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFP 625

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 62/128 (48%), Gaps = 11/128 (8%)

Query: 282 RSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVT--------HHNDLDMDMYMRI 333
           R ++ + +R+ LDQ  F E+ETP +   A    A+ F+            D  + M+  +
Sbjct: 167 RYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPTRVSAKIKQVDKIVPMFYAL 225

Query: 334 --APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEL 391
             +P+ + + L+  G+ + ++  R +R+E +     PEFT  +   ++A   D+M + E 
Sbjct: 226 TQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQKDVMSVIEK 285

Query: 392 MFSEMVKE 399
             + + K+
Sbjct: 286 CITSVWKK 293

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 108/474 (22%), Positives = 186/474 (39%), Gaps = 72/474 (15%)

Query: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210
           L  ++V I+G IH  R S  K+ F VL  DG    L S L    + A  ++  DL     
Sbjct: 121 LVGQRVKISGWIHRLR-SNKKVMFIVLR-DGYGY-LQSVLT--GDLAIAQQSLDLTIE-S 174

Query: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQ--ETRYRKRYLD 268
            V + G + +    K   G + + V   E++     + P+    F ++  E       LD
Sbjct: 175 TVTLYGTITKVPEGKSAPGGVELLVDYYEVV----GLAPSGDEAFTNKIAEGADPSLLLD 230

Query: 269 ---LIMNKDARGRFIK-RSQIIRFIRRFLDQREFIEVETPMM--NVIAGGATAKPFVTHH 322
              L +  +     +K R+ +++ IRR   +    EV  P M    + GG+T      + 
Sbjct: 231 QRHLALRGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPCMVQTQVEGGSTLFKLDYYG 290

Query: 323 NDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYAD 381
                  Y+  + +L+L E  +  +  VY +   FR E      H  E+T  E   A+  
Sbjct: 291 EQ----AYLTQSSQLYL-ETCLPSLGDVYCVQESFRAEKSHTRRHLSEYTHIEAELAFLT 345

Query: 382 VYDLMDMTELMFSEMVK-----EITGSYIIKYHPD---PNNPEKEMELNFTRPWKRMNMI 433
             +L+D  E +  + V+      I G  + + +PD   P  P   +E      W + + I
Sbjct: 346 FEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKMPFMRLEYKDAIEWLKEHDI 405

Query: 434 EELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCIN 493
           +  +      F  GD +  A          A+ KM     +    +L K   E++     
Sbjct: 406 KNEDGE---EFKFGDDIAEA----------AERKM--TDTIGVPILLTKFPAEIKS---- 446

Query: 494 PTFIFGHPQMMSPLAKYSRDTPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQAR 552
               F  P+         +D   + E  +V + T  EI      +N   +  A F     
Sbjct: 447 ----FYMPR--------CKDDNRVTESVDVLMPTVGEITGGSMRINTEEELLAGF----- 489

Query: 553 QKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
           +++  D +A      F +  +YG  P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 490 KRENIDPKAYY---WFIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLYP 540

>Kwal_0.375
          Length = 428

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/328 (22%), Positives = 137/328 (41%), Gaps = 45/328 (13%)

Query: 129 FKVSISNPEFL---KKYAYLQRGETLPNEKVAIAGRIHAKRESGSKLKFYVLH-GDG-VE 183
             +SI   E L    KY  ++  + + +++V ++G IH +R S S L F VL  G G ++
Sbjct: 103 LNISIKQDESLPDATKYKIIKSYDAI-DQRVKVSGWIHRQRSSKS-LVFIVLRDGTGYLQ 160

Query: 184 VQLMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTP 243
             L   L   +  +    +  +   G +  +    G+T P     G + + V   E+++ 
Sbjct: 161 AVLTGDLARAHQTSTLTLESSITLYGKVCKLPE--GKTAP-----GGVELLVDYYEIIS- 212

Query: 244 CLHMLPA--DHFGFKDQETRYRKRYLD---LIMNKDARGRFIK-RSQIIRFIRRFLDQRE 297
              + P+  D F  K  E       LD   L +  +     +K R+ ++R +RRF DQ  
Sbjct: 213 ---LAPSGDDAFTNKIAEGADPSLLLDQRHLALRGETLSAVMKVRAALLRSVRRFYDQEG 269

Query: 298 FIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGR 355
             EV  P M    + GG+T      +      + Y+  + +L+L E  +  +  VY I  
Sbjct: 270 LTEVTPPCMVQTQVEGGSTLFKLGYYGE----EAYLTQSSQLYL-ETCLASLGDVYSIQE 324

Query: 356 QFRNEGIDM-THNPEFTTCEFYQAYADVYDLMDMTELMFSEMVKE-----ITGSYIIKYH 409
            FR E      H  E+T  E    +    +++   E + +++V+      + G  + + +
Sbjct: 325 SFRAEKSHTRRHLSEYTHIEAELCFLSFDEMLVHIEKLITQVVQSVLDDPVAGPLVQQLN 384

Query: 410 PDPNNPEKEMELNFTRPWKRMNMIEELE 437
           P    P        T P+ R++  + +E
Sbjct: 385 PGFKAP--------TMPFMRLDYKDAIE 404

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 406
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM--GVTG---L 399

Query: 407 KYHPDPN 413
           K+ P  N
Sbjct: 400 KFKPTYN 406

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 406
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 407 KYHPDPN 413
           ++ P  N
Sbjct: 402 RFKPTYN 408

>Scas_707.14
          Length = 499

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 406
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM--GVTG---L 401

Query: 407 KYHPDPN 413
           ++ P  N
Sbjct: 402 RFKPTYN 408

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 406
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 407 KYHPDPN 413
           ++ P  N
Sbjct: 402 RFKPTYN 408

>Kwal_47.17998
          Length = 499

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 406
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F +M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGFFEKM--GVTG---L 401

Query: 407 KYHPDPN 413
           ++ P  N
Sbjct: 402 RFKPTYN 408

>YBR053C (YBR053C) [243] chr2 complement(339635..340711) Member of
           the senescence marker protein-30 (SMP-30) family, has
           low similarity to uncharacterized C. albicans Orf6.677p
           [1077 bp, 358 aa]
          Length = 358

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 231 ISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQII 286
           + +   +IEL+  CL +  A H+   DQ+T Y    L+  + K   G  +KR ++I
Sbjct: 182 VDLLAHKIELVWNCLLIPNAIHWDESDQKTMYVTDSLNFTIWKCPGGDLLKRDELI 237

>KLLA0C18612g 1646511..1652933 similar to sp|P25655 Saccharomyces
            cerevisiae YCR093w CDC39 nuclear protein singleton, start
            by similarity
          Length = 2140

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 54/113 (47%), Gaps = 15/113 (13%)

Query: 186  LMSQLQDYNNEADYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCL 245
            L+SQ++DY+ + ++   +D   +  IV +  ++ R+  K     ++S+ VS+       +
Sbjct: 1430 LVSQIKDYSEDVEFNLQNDSTIKNTIVEILSFISRSNQK----DQLSLKVSQ-----AVV 1480

Query: 246  HMLPADHFGFKDQETRYRKRYLDLIMNKDARGRFIKRSQIIRFIRRFLDQREF 298
            + L      F   E++  +  L L++ K      + R  ++ ++   LD R+F
Sbjct: 1481 NSL------FGSNESKLCRDVLSLLLEKLCSLSIVARKDVVWWLVYALDPRKF 1527

>YCR024C (YCR024C) [558] chr3 complement(160739..162217)
           Asparaginyl-tRNA synthetase, mitochondrial [1479 bp, 492
           aa]
          Length = 492

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 84/427 (19%), Positives = 157/427 (36%), Gaps = 50/427 (11%)

Query: 205 LLKRGDIVGVEGYVGRTQP--KKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRY 262
           +LK G  + +     ++ P  K+  E +I   V  I+L+ P     P      K Q  RY
Sbjct: 80  ILKTGQTLSISNATWQSTPNRKQPFELQIKNPVKSIKLVGPVSENYPLQK---KYQTLRY 136

Query: 263 RKRYLDLIMNKDARGRFIKRSQIIRF-IRRFLDQREFIEVETPMMNVIAGGATAKPFVTH 321
            +    L          ++    + F    +  +  F +V  P++         + F   
Sbjct: 137 LRSLPTLKYRTAYLSAILRLRSFVEFQFMLYFQKNHFTKVSPPILTSNDCEGAGELFQVS 196

Query: 322 HND-------LDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTC 373
            N             Y+ ++ +L L E++   + R + +   FR E  D   H  EF   
Sbjct: 197 TNTSPTASSYFGKPTYLTVSTQLHL-EILALSLSRCWTLSPCFRAEKSDTPRHLSEFWML 255

Query: 374 EFYQAYAD-VYDLMDMTELMFSEMVK-------EITGSYIIKYHPDPNNPEKEMELN--- 422
           E    + + V +L    E     ++K       E+     I      NN   E+ +N   
Sbjct: 256 EVEMCFVNSVNELTSFVETTIKHIIKACIDNQQELLPKQFIS--SQENNASSELSINQET 313

Query: 423 --FTRPWKRMNMIEELEKRFNVTFPAGDQLHTAETGEFLKKVLADNKMECPPPLTNARML 480
                 W+  ++I E  K  N+T+    ++      E +     + K   P    + + L
Sbjct: 314 QQIKTRWE--DLINE--KWHNITYTNAIEILKKRHNE-VSHFKYEPKWGQPLQTEHEKFL 368

Query: 481 DKLVGELEDVCINPTFIFGHPQMMSPLAKYSRDTPG-LCERFEVFV-ATKEICNAYTELN 538
               GE      +P F+  +P++  P       TP      F++ V    EI       +
Sbjct: 369 ---AGEYFK---SPVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGMGEIIGGSLRED 422

Query: 539 DPFDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNT 598
           D +D+  R E +AR  ++  +      + + +  + G  P GG+G G +R   +L  ++ 
Sbjct: 423 D-YDKLCR-EMKARGMNRSGEL-----DWYVSLRKEGSAPHGGFGLGFERFISYLYGNHN 475

Query: 599 IREVLLF 605
           I++ + F
Sbjct: 476 IKDAIPF 482

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 7/67 (10%)

Query: 349 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTELMFSEMVKEITGSYII 406
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E  F  M   +TG   +
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFERM--GVTG---L 405

Query: 407 KYHPDPN 413
           ++ P  N
Sbjct: 406 RFKPTYN 412

>Scas_710.22
          Length = 1120

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 111 RQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGETLPN 153
           R +Q LR   +    PH  K++  +P+F+  YA+     TLPN
Sbjct: 25  RSVQRLRYAST---IPHHLKLNAKSPDFIHDYAHTSLQTTLPN 64

>Sklu_2216.2 YBR088C, Contig c2216 2801-3223
          Length = 140

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 360 EGIDMTHNPEFTTCEFYQAYADVYDLMDMTELMFS-EMVKEI------TGSYIIKYHPDP 412
           EG+D        + EF +   D+  L D   ++ + + VK +      +GS I+K H D 
Sbjct: 11  EGMDYDTVITMPSVEFAKVVRDLNQLSDSLNILVTKDTVKFVAEGDIGSGSVIVKPHTDM 70

Query: 413 NNPEKEMELNFTRP 426
            NPE+ +++   +P
Sbjct: 71  ENPEESVKVELDKP 84

>KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces
           cerevisiae YNL125c ESBP6, hypothetical start
          Length = 652

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 541 FDQRARFEEQARQKD----QGDDEAQLVDETFCN--ALEYGLPPTGGWG---CGIDRLAM 591
           FDQ +  E + R +      GDDE Q +++ F N       LPP GG+G   C    L M
Sbjct: 148 FDQTSDSEGEYRSEVPVELAGDDEGQTLNKVFTNKETNTLDLPPEGGYGWVCCLCVTLVM 207

Query: 592 FLT 594
           F T
Sbjct: 208 FST 210

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 568 FCNALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
           + N  + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 420 YVNLRKQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 377 QAYADVYDLMDMTELMFSEMVKEITGSYIIKYHPDPNNPEKEMELNF 423
           Q    +YD +++T    +  +K+   +  +KYHPD NN  +E +  F
Sbjct: 2   QQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKF 48

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..198039)
            [4566 bp, 1521 aa]
          Length = 1521

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 15/84 (17%)

Query: 156  VAIAGRIHAKRE-----------SGSKLKFYVLHGDGVEVQLMSQ---LQDYNNEADYEK 201
             A++ R H +RE           S  KLKFY+   +G   +L S+   L+D   E D +K
Sbjct: 1388 CALSFRRHLRRELFDNSNVRWGVSVHKLKFYLRKLEGARCELTSELATLRDVVKEHDLQK 1447

Query: 202  DHDLLKRGDIVGVEGYVGRTQPKK 225
             H  L+  + V V GY   T  K+
Sbjct: 1448 LHK-LRNANCVPVTGYEKLTARKQ 1470

>Scas_628.24
          Length = 487

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 575 GLPPTGGWGCGIDRLAMFLTDSNTIREVLLFP 606
           G  P GG+G G++RL  +L  ++ I++ + FP
Sbjct: 447 GSVPHGGFGLGLERLISYLFGNHNIKDAIPFP 478

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,624,231
Number of extensions: 913660
Number of successful extensions: 2591
Number of sequences better than 10.0: 54
Number of HSP's gapped: 2607
Number of HSP's successfully gapped: 67
Length of query: 621
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 513
Effective length of database: 12,857,365
Effective search space: 6595828245
Effective search space used: 6595828245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)