Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_661.271095109547610.0
YBR059C (AKL1)110850417140.0
Sklu_1752.285838015200.0
CAGL0H10208g102749015000.0
KLLA0F18612g81442314810.0
Kwal_27.1094593538014660.0
CAGL0K11990g99140713851e-174
AGR027C96138013391e-168
Kwal_27.115427913188145e-94
Scas_601.66613187881e-91
Scas_671.167233187912e-91
ADL217W7503147914e-91
Sklu_2226.77953207927e-91
YNL020C (ARK1)6383257677e-89
CAGL0G02607g6883187644e-88
YIL095W (PRK1)8103177716e-88
KLLA0E08371g7773187653e-87
CAGL0J03432g6223137131e-81
KLLA0C06138g7082922502e-21
Scas_644.157262922296e-19
Sklu_2361.38842992298e-19
YPL150W9013092281e-18
ACL006W7082922233e-18
CAGL0M02299g8932972224e-18
Sklu_2419.96952902215e-18
KLLA0F11319g8432922209e-18
Kwal_26.87518483062209e-18
Scas_700.288961972172e-17
CAGL0J11638g7462902153e-17
CAGL0L11550g10722392163e-17
Kwal_56.224766972902135e-17
YMR001C (CDC5)7052892125e-17
Kwal_55.215458652472127e-17
Kwal_56.242743463462031e-16
Sklu_1962.23643632023e-16
Scas_580.610152322064e-16
YHR102W (KIC1)10802452056e-16
KLLA0E21780g10162292047e-16
AFL101C3672381988e-16
Kwal_33.131125052972001e-15
ACR133C8511962021e-15
Sklu_2419.105662241964e-15
ACL104C9472351959e-15
ABL034W14252891932e-14
YDR477W (SNF1)6333061902e-14
YPL236C3643531835e-14
Scas_458.13673521819e-14
YNR047W8933021841e-13
AEL230W6083181831e-13
CAGL0C03509g8953561842e-13
KLLA0A03806g6023061822e-13
KLLA0C00979g4833091802e-13
Kwal_47.182335982961803e-13
Kwal_23.632515422601814e-13
Scas_707.369152911805e-13
Scas_660.286233081795e-13
AFR696C11422341797e-13
Scas_629.169182991788e-13
CAGL0M08910g6122961778e-13
Kwal_26.778812672641781e-12
AGR058W10712151771e-12
Sklu_2323.34002361741e-12
KLLA0C01650g11122321771e-12
Kwal_56.237178582251761e-12
CAGL0B01925g9442331743e-12
AFR335C10331921743e-12
KLLA0E17127g8521901733e-12
KLLA0C18568g7743031724e-12
Kwal_56.240913811961684e-12
Kwal_23.64588682991715e-12
Kwal_56.226939841921725e-12
AER264C14833381725e-12
Scas_616.1014611811716e-12
KLLA0F13552g12673351717e-12
YDR523C (SPS1)4901951688e-12
YKL101W (HSL1)15181961708e-12
CAGL0E05720g3582461659e-12
CAGL0M11396g11923121691e-11
CAGL0K05709g11032341663e-11
YLR096W (KIN2)11472251663e-11
YDR507C (GIN4)11422631653e-11
YDL159W (STE7)5152891624e-11
ACR196C5301981624e-11
YCR073C (SSK22)13312571644e-11
KLLA0B02332g3612861605e-11
YOL100W (PKH2)10812301635e-11
KLLA0C12485g9251941635e-11
AFR724C4402881615e-11
KLLA0F19536g11042041635e-11
CAGL0F03311g10451921635e-11
YDR122W (KIN1)10642041636e-11
YJL187C (SWE1)8192641617e-11
CAGL0G04609g9651981627e-11
Scas_502.211161941618e-11
Scas_564.712102031619e-11
CAGL0I07513g10761961619e-11
YCL024W (KCC4)10372321611e-10
ADR167W8733521601e-10
Scas_493.211172351601e-10
CAGL0K08514g14892331601e-10
Scas_685.245151961572e-10
Sklu_2073.311823231582e-10
Scas_598.67902401582e-10
Scas_693.1710492241572e-10
Kwal_23.566816892191582e-10
Scas_627.73492301533e-10
Sklu_2437.1610711911563e-10
YGL179C (TOS3)5602721553e-10
KLLA0C08525g15512921563e-10
Scas_675.25271891544e-10
Kwal_26.735514462811564e-10
YAR019C (CDC15)9742501554e-10
Scas_584.1110741981554e-10
YHL007C (STE20)9392301555e-10
YCR091W (KIN82)7202521545e-10
CAGL0M10153g8671761546e-10
YOR233W (KIN4)8001761546e-10
AFR377C7262511536e-10
CAGL0J03872g6611791537e-10
Scas_720.1038042981537e-10
YDR490C (PKH1)7661581537e-10
ADR300C8901911529e-10
CAGL0K02673g9151961521e-09
YBR274W (CHK1)5271821501e-09
Sklu_2366.54662391501e-09
AEL205W7932031511e-09
Sklu_2066.26392581502e-09
Scas_544.64892071492e-09
Kwal_55.201898121871502e-09
YER129W (PAK1)11422231502e-09
Kwal_23.52908192041492e-09
YHR082C (KSP1)10291561492e-09
CAGL0D02244g4871991482e-09
ACR117W5242481482e-09
Kwal_47.1726311272741492e-09
Scas_548.613821711492e-09
Sklu_2086.42431241422e-09
Scas_720.9416832611493e-09
Scas_668.228932391483e-09
KLLA0B03586g7343031483e-09
CAGL0H06259g13361641483e-09
YNL298W (CLA4)8422481483e-09
YPL209C (IPL1)3671981453e-09
YOR267C (HRK1)7591711474e-09
Kwal_26.78619551761474e-09
KLLA0F14190g13383381484e-09
AEL149C7272301474e-09
CAGL0C05005g10762471474e-09
Scas_703.57492921464e-09
YPL141C8651991465e-09
KLLA0A07403g8792381466e-09
KLLA0E15378g7242561456e-09
CAGL0K02167g11622411466e-09
CAGL0G09020g3611501426e-09
Scas_640.14*7282281456e-09
YNR031C (SSK2)15793101457e-09
KLLA0C03828g7933131457e-09
Kwal_33.140815802551447e-09
CAGL0M02519g7562021448e-09
AAR009W4532621428e-09
YDL028C (MPS1)7643161449e-09
YOL045W (PSK2)11011661449e-09
Scas_633.297893131439e-09
Kwal_26.715412131241441e-08
ACL053C11812371441e-08
ADL389W7112941431e-08
Kwal_33.141678383131431e-08
Sklu_2436.147842851421e-08
CAGL0K01617g7743161421e-08
CAGL0F09075g7462971421e-08
Kwal_26.87098291801421e-08
ACR281C12591811422e-08
AFL217C6912471412e-08
Kwal_55.203267501811412e-08
KLLA0B13112g7301871412e-08
ABR014W9711771412e-08
Kwal_27.100047351521412e-08
CAGL0L03520g14472631412e-08
KLLA0C16577g5041861392e-08
CAGL0C02893g6491711402e-08
YAL017W (PSK1)13561221412e-08
YJL095W (BCK1)14782971412e-08
KLLA0B07579g7222281402e-08
CAGL0H00979g399951383e-08
YPL140C (MKK2)5061651393e-08
ADR253W3802231373e-08
CAGL0I03498g4512231383e-08
Scas_713.216413221393e-08
Kwal_0.964272581383e-08
KLLA0C04191g7971971393e-08
KLLA0B13607g9891761393e-08
Scas_336.14862941374e-08
YHR205W (SCH9)8242921384e-08
Kwal_47.183076211921384e-08
Kwal_47.167617442941384e-08
Scas_643.2010822761394e-08
KLLA0C04213g3942881364e-08
KLLA0B11902g4952581374e-08
Kwal_23.55765042331374e-08
CAGL0F00913g12061711384e-08
Kwal_33.136817152311375e-08
Kwal_47.178683652021355e-08
KLLA0F07623g12291771385e-08
YDL025C6201471375e-08
Sklu_1477.25762941365e-08
Sklu_1603.24881831366e-08
CAGL0H01639g5212801366e-08
Kwal_33.141925771491366e-08
YPR054W (SMK1)3882321356e-08
Scas_700.348641981376e-08
AEL284C4791881366e-08
Scas_673.20*7582511366e-08
Kwal_56.245844351981357e-08
KLLA0F01276g5191841357e-08
CAGL0M03729g8612031367e-08
Kwal_26.89416611671367e-08
CAGL0B02739g6762801368e-08
Scas_711.2515152621368e-08
AER232C5692361358e-08
Sklu_1722.28092271368e-08
Scas_477.57031811358e-08
Sklu_1995.27291811359e-08
Scas_653.256661691341e-07
ADR379C4922111331e-07
CAGL0I05390g4541511331e-07
Kwal_26.87034442221331e-07
KLLA0A02717g4322011321e-07
Kwal_33.138317002331331e-07
Sklu_2429.54322731321e-07
KLLA0D07348g9091691332e-07
KLLA0E07414g3651801312e-07
Scas_692.247181711322e-07
AFL143C3612331302e-07
ABL011C7012001322e-07
CAGL0L06820g3661931302e-07
CAGL0G05720g7382241322e-07
Kwal_27.119192091901252e-07
ACR119W9311811313e-07
KLLA0D07304g4652131303e-07
Kwal_26.83475921591303e-07
Sklu_2277.86161671303e-07
Sklu_2186.45212331303e-07
Scas_634.57902351313e-07
Scas_640.165052091293e-07
AER222C4232531284e-07
YDR466W (PKH3)8981411294e-07
CAGL0J04290g3572371274e-07
CAGL0M08404g4622581285e-07
KLLA0D09328g10463031305e-07
YDR283C (GCN2)16592091305e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_661.27
         (1095 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_661.27                                                          1838   0.0  
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...   664   0.0  
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         590   0.0  
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   582   0.0  
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   575   0.0  
Kwal_27.10945                                                         569   0.0  
CAGL0K11990g complement(1155395..1158370) some similarities with...   538   e-174
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   520   e-168
Kwal_27.11542                                                         318   5e-94
Scas_601.6                                                            308   1e-91
Scas_671.16                                                           309   2e-91
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   309   4e-91
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          309   7e-91
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   300   7e-89
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   298   4e-88
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   301   6e-88
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   299   3e-87
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   279   1e-81
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   100   2e-21
Scas_644.15                                                            93   6e-19
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            93   8e-19
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    92   1e-18
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    91   3e-18
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    90   4e-18
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          90   5e-18
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    89   9e-18
Kwal_26.8751                                                           89   9e-18
Scas_700.28                                                            88   2e-17
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    87   3e-17
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    88   3e-17
Kwal_56.22476                                                          87   5e-17
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    86   5e-17
Kwal_55.21545                                                          86   7e-17
Kwal_56.24274                                                          83   1e-16
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          82   3e-16
Scas_580.6                                                             84   4e-16
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    84   6e-16
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    83   7e-16
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    81   8e-16
Kwal_33.13112                                                          82   1e-15
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    82   1e-15
Sklu_2419.10 , Contig c2419 14439-16135                                80   4e-15
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    80   9e-15
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    79   2e-14
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    78   2e-14
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    75   5e-14
Scas_458.1                                                             74   9e-14
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    75   1e-13
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    75   1e-13
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    75   2e-13
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    75   2e-13
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    74   2e-13
Kwal_47.18233                                                          74   3e-13
Kwal_23.6325                                                           74   4e-13
Scas_707.36                                                            74   5e-13
Scas_660.28                                                            74   5e-13
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    74   7e-13
Scas_629.16                                                            73   8e-13
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    73   8e-13
Kwal_26.7788                                                           73   1e-12
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    73   1e-12
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            72   1e-12
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    73   1e-12
Kwal_56.23717                                                          72   1e-12
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    72   3e-12
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    72   3e-12
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    71   3e-12
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    71   4e-12
Kwal_56.24091                                                          69   4e-12
Kwal_23.6458                                                           70   5e-12
Kwal_56.22693                                                          71   5e-12
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    71   5e-12
Scas_616.10                                                            70   6e-12
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    70   7e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    69   8e-12
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    70   8e-12
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    68   9e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    70   1e-11
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    69   3e-11
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    69   3e-11
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    68   3e-11
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    67   4e-11
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    67   4e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    68   4e-11
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    66   5e-11
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    67   5e-11
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    67   5e-11
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    67   5e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    67   5e-11
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    67   5e-11
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    67   6e-11
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    67   7e-11
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    67   7e-11
Scas_502.2                                                             67   8e-11
Scas_564.7                                                             67   9e-11
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    67   9e-11
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    67   1e-10
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    66   1e-10
Scas_493.2                                                             66   1e-10
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    66   1e-10
Scas_685.24                                                            65   2e-10
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            65   2e-10
Scas_598.6                                                             65   2e-10
Scas_693.17                                                            65   2e-10
Kwal_23.5668                                                           65   2e-10
Scas_627.7                                                             64   3e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      65   3e-10
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    64   3e-10
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    65   3e-10
Scas_675.2                                                             64   4e-10
Kwal_26.7355                                                           65   4e-10
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    64   4e-10
Scas_584.11                                                            64   4e-10
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    64   5e-10
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    64   5e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    64   6e-10
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    64   6e-10
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    64   6e-10
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    64   7e-10
Scas_720.103                                                           64   7e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    64   7e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    63   9e-10
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    63   1e-09
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    62   1e-09
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       62   1e-09
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    63   1e-09
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            62   2e-09
Scas_544.6                                                             62   2e-09
Kwal_55.20189                                                          62   2e-09
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    62   2e-09
Kwal_23.5290                                                           62   2e-09
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    62   2e-09
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    62   2e-09
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    62   2e-09
Kwal_47.17263                                                          62   2e-09
Scas_548.6                                                             62   2e-09
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                59   2e-09
Scas_720.94                                                            62   3e-09
Scas_668.22                                                            62   3e-09
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    62   3e-09
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    62   3e-09
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    62   3e-09
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    60   3e-09
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    61   4e-09
Kwal_26.7861                                                           61   4e-09
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    62   4e-09
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    61   4e-09
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    61   4e-09
Scas_703.5                                                             61   4e-09
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    61   5e-09
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    61   6e-09
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    60   6e-09
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    61   6e-09
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    59   6e-09
Scas_640.14*                                                           60   6e-09
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    60   7e-09
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    60   7e-09
Kwal_33.14081                                                          60   7e-09
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    60   8e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    59   8e-09
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    60   9e-09
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    60   9e-09
Scas_633.29                                                            60   9e-09
Kwal_26.7154                                                           60   1e-08
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    60   1e-08
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    60   1e-08
Kwal_33.14167                                                          60   1e-08
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         59   1e-08
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    59   1e-08
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    59   1e-08
Kwal_26.8709                                                           59   1e-08
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    59   2e-08
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    59   2e-08
Kwal_55.20326                                                          59   2e-08
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    59   2e-08
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    59   2e-08
Kwal_27.10004                                                          59   2e-08
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    59   2e-08
KLLA0C16577g complement(1451181..1452695) some similarities with...    58   2e-08
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    59   2e-08
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    59   2e-08
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    59   2e-08
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    59   2e-08
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    58   3e-08
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    58   3e-08
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    57   3e-08
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    58   3e-08
Scas_713.21                                                            58   3e-08
Kwal_0.96                                                              58   3e-08
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    58   3e-08
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    58   3e-08
Scas_336.1                                                             57   4e-08
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    58   4e-08
Kwal_47.18307                                                          58   4e-08
Kwal_47.16761                                                          58   4e-08
Scas_643.20                                                            58   4e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    57   4e-08
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    57   4e-08
Kwal_23.5576                                                           57   4e-08
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    58   4e-08
Kwal_33.13681                                                          57   5e-08
Kwal_47.17868                                                          57   5e-08
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    58   5e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    57   5e-08
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          57   5e-08
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         57   6e-08
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    57   6e-08
Kwal_33.14192                                                          57   6e-08
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    57   6e-08
Scas_700.34                                                            57   6e-08
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    57   6e-08
Scas_673.20*                                                           57   6e-08
Kwal_56.24584                                                          57   7e-08
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    57   7e-08
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    57   7e-08
Kwal_26.8941                                                           57   7e-08
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    57   8e-08
Scas_711.25                                                            57   8e-08
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    57   8e-08
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         57   8e-08
Scas_477.5                                                             57   8e-08
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            57   9e-08
Scas_653.25                                                            56   1e-07
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    56   1e-07
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    56   1e-07
Kwal_26.8703                                                           56   1e-07
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    55   1e-07
Kwal_33.13831                                                          56   1e-07
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        55   1e-07
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    56   2e-07
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    55   2e-07
Scas_692.24                                                            55   2e-07
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    55   2e-07
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    55   2e-07
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    55   2e-07
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    55   2e-07
Kwal_27.11919                                                          53   2e-07
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    55   3e-07
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    55   3e-07
Kwal_26.8347                                                           55   3e-07
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        55   3e-07
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         55   3e-07
Scas_634.5                                                             55   3e-07
Scas_640.16                                                            54   3e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    54   4e-07
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    54   4e-07
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    54   4e-07
CAGL0M08404g complement(836791..838179) some similarities with s...    54   5e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    55   5e-07
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    55   5e-07
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         54   5e-07
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    54   5e-07
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    54   5e-07
KLLA0C03938g complement(358851..360632) some similarities with s...    54   5e-07
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    54   5e-07
Scas_602.11                                                            54   5e-07
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    54   5e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    54   5e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    54   5e-07
Scas_667.18                                                            54   6e-07
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    54   6e-07
Scas_683.12                                                            53   6e-07
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    54   7e-07
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    53   7e-07
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    54   7e-07
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             53   7e-07
Kwal_27.9763                                                           54   7e-07
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            54   7e-07
Scas_689.25*                                                           53   8e-07
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    54   8e-07
Scas_718.90                                                            53   9e-07
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    53   9e-07
Scas_688.14                                                            53   9e-07
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    53   1e-06
Kwal_33.14434                                                          53   1e-06
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    53   1e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    53   1e-06
KLLA0B06501g complement(576636..579089) some similarities with s...    53   1e-06
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    53   1e-06
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    52   1e-06
Kwal_27.12559                                                          52   1e-06
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    52   1e-06
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    52   1e-06
Kwal_14.1273                                                           52   2e-06
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    52   2e-06
Scas_623.11                                                            52   2e-06
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    52   2e-06
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    52   2e-06
Scas_698.37                                                            52   2e-06
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    52   2e-06
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    52   2e-06
Scas_651.18                                                            52   2e-06
Scas_619.5*                                                            52   2e-06
Scas_678.24                                                            52   2e-06
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    52   2e-06
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    51   2e-06
Scas_660.20                                                            52   2e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    52   3e-06
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    52   3e-06
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    52   3e-06
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    51   3e-06
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    51   3e-06
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    51   3e-06
KLLA0B07205g complement(624606..625973) some similarities with s...    51   3e-06
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    51   3e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    51   4e-06
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    51   4e-06
Scas_654.12                                                            51   4e-06
Kwal_27.9773                                                           50   5e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    50   5e-06
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    50   5e-06
Kwal_56.24059                                                          50   5e-06
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    51   5e-06
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    50   6e-06
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    50   6e-06
Scas_700.35                                                            50   6e-06
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    50   6e-06
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    50   6e-06
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 50   6e-06
Kwal_33.13846                                                          50   7e-06
Scas_710.28                                                            50   7e-06
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    50   7e-06
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    50   7e-06
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    50   7e-06
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    50   8e-06
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    50   8e-06
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    50   8e-06
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    50   8e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    50   9e-06
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    50   9e-06
Kwal_55.22001                                                          49   9e-06
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           50   9e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    50   9e-06
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    50   1e-05
Scas_717.69                                                            50   1e-05
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    49   1e-05
Scas_715.34                                                            50   1e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    49   1e-05
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    50   1e-05
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    49   1e-05
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    49   1e-05
Scas_721.124                                                           50   1e-05
Kwal_26.7635                                                           50   1e-05
Scas_721.46                                                            49   1e-05
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    49   1e-05
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    49   1e-05
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    49   1e-05
Kwal_33.14554                                                          49   2e-05
Kwal_27.10581                                                          49   2e-05
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       49   2e-05
Scas_713.38                                                            49   2e-05
Kwal_56.23841                                                          49   2e-05
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    49   2e-05
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    49   2e-05
Scas_635.1                                                             49   2e-05
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    49   2e-05
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    49   2e-05
Kwal_14.2497                                                           49   2e-05
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         49   2e-05
Scas_610.7                                                             49   2e-05
Kwal_14.1416                                                           49   2e-05
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    49   2e-05
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          49   2e-05
Scas_201.1*                                                            48   2e-05
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    49   2e-05
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    49   2e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    49   2e-05
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    48   2e-05
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             49   2e-05
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    49   2e-05
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    49   2e-05
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    49   2e-05
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    48   3e-05
Kwal_17.2687                                                           48   3e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    48   3e-05
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    48   3e-05
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    49   3e-05
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    48   3e-05
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    48   3e-05
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    48   4e-05
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    48   4e-05
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            48   4e-05
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    48   4e-05
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    48   4e-05
Kwal_56.22788                                                          48   5e-05
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    47   5e-05
Scas_655.2                                                             48   6e-05
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      47   6e-05
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    47   6e-05
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    47   6e-05
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    47   6e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    47   6e-05
Kwal_14.1159                                                           48   6e-05
Scas_690.13                                                            47   6e-05
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         47   6e-05
Scas_618.8                                                             47   6e-05
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    47   7e-05
Scas_649.30                                                            47   7e-05
Kwal_55.21900                                                          47   7e-05
Kwal_27.11830                                                          47   8e-05
Scas_582.1                                                             47   8e-05
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    47   8e-05
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         47   8e-05
Kwal_23.3590                                                           47   8e-05
Kwal_26.7682                                                           47   8e-05
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    47   9e-05
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    47   9e-05
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    47   9e-05
Scas_721.61                                                            47   1e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    47   1e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    47   1e-04
Scas_683.6                                                             46   1e-04
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    47   1e-04
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    47   1e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    46   1e-04
CAGL0K01661g complement(146952..148400) some similarities with t...    46   1e-04
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    46   1e-04
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    46   1e-04
Scas_593.14d                                                           46   1e-04
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    46   1e-04
Kwal_26.7552                                                           46   1e-04
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    45   1e-04
Kwal_27.11777                                                          46   1e-04
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    46   1e-04
Scas_704.50                                                            45   2e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    45   2e-04
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    45   2e-04
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    46   2e-04
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    45   2e-04
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    46   2e-04
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    46   2e-04
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    45   2e-04
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    45   2e-04
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    46   2e-04
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    46   2e-04
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    45   2e-04
Scas_680.20                                                            45   2e-04
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    45   2e-04
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    45   2e-04
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    45   3e-04
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    45   3e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    44   3e-04
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         45   3e-04
Scas_568.13                                                            45   3e-04
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    44   4e-04
Scas_628.9                                                             45   4e-04
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    45   4e-04
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    45   4e-04
Scas_705.23                                                            44   5e-04
Scas_648.17                                                            44   5e-04
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    44   6e-04
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    44   6e-04
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    44   6e-04
Scas_651.19                                                            44   7e-04
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    44   8e-04
Kwal_33.13222                                                          41   8e-04
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    43   8e-04
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    44   9e-04
YPL042C (SSN3) [5397] chr16 complement(473035..474702) Cyclin-de...    44   0.001
Scas_22.1                                                              42   0.001
KLLA0D12100g complement(1031728..1033161) some similarities with...    43   0.001
Kwal_47.17252                                                          44   0.001
Sklu_1484.2 YDL108W, Contig c1484 2977-3825 reverse complement         42   0.001
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    43   0.001
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             43   0.001
Scas_707.3                                                             44   0.001
Scas_713.7                                                             43   0.001
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    43   0.001
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    43   0.001
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    42   0.002
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    42   0.002
Scas_568.9*                                                            42   0.002
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    42   0.002
Scas_716.33                                                            42   0.002
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    42   0.002
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    42   0.002
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    43   0.002
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         42   0.002
Scas_707.34                                                            43   0.002
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    42   0.002
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    43   0.002
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    42   0.002
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          42   0.002
Scas_716.73                                                            42   0.002
Scas_689.24                                                            42   0.002
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    42   0.002
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    42   0.002
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    42   0.003
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    42   0.003
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    42   0.003
KLLA0A06820g complement(615686..618004) some similarities with s...    42   0.003
Kwal_26.7276                                                           42   0.003
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    42   0.003
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    41   0.004
Scas_721.110                                                           42   0.004
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    41   0.004
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    42   0.004
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    41   0.004
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    41   0.004
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    41   0.005

>Scas_661.27
          Length = 1095

 Score = 1838 bits (4761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1095 (84%), Positives = 922/1095 (84%)

Query: 1    MSTTSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNE 60
            MSTTSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNE
Sbjct: 1    MSTTSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNE 60

Query: 61   FENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH 120
            FENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH
Sbjct: 61   FENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH 120

Query: 121  NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180
            NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH
Sbjct: 121  NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180

Query: 181  RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL 240
            RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL
Sbjct: 181  RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL 240

Query: 241  YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIM 300
            YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIM
Sbjct: 241  YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIM 300

Query: 301  LAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXXXX 360
            LAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSV        
Sbjct: 301  LAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQ 360

Query: 361  EKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSAEIPESNFAKQEQQ 420
            EKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSAEIPESNFAKQEQQ
Sbjct: 361  EKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSAEIPESNFAKQEQQ 420

Query: 421  YEPRNIPTAGDYLNENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPGKP 480
            YEPRNIPTAGDYLNENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPGKP
Sbjct: 421  YEPRNIPTAGDYLNENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPGKP 480

Query: 481  IENTEQYFPTVGELDYYLDNELKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
            IENTEQYFPTVGELDYYLDNELK                                     
Sbjct: 481  IENTEQYFPTVGELDYYLDNELKQQQQQQQVHQPQQIPVQNQNQQQQQQQQPKQLPNMIQ 540

Query: 541  XXXXXXXXXXXXLNTDRYHLNTTGMVQRQKSLGSVSTDGRSVGSNSHVTNAENLPTEYTA 600
                        LNTDRYHLNTTGMVQRQKSLGSVSTDGRSVGSNSHVTNAENLPTEYTA
Sbjct: 541  QQNIPEQQQQQQLNTDRYHLNTTGMVQRQKSLGSVSTDGRSVGSNSHVTNAENLPTEYTA 600

Query: 601  KSDLPGMAKQHKSNNPFPKMTHAFQSANENVGTYFVDNNGSRQQVQQTEANMYTNLNTEX 660
            KSDLPGMAKQHKSNNPFPKMTHAFQSANENVGTYFVDNNGSRQQVQQTEANMYTNLNTE 
Sbjct: 601  KSDLPGMAKQHKSNNPFPKMTHAFQSANENVGTYFVDNNGSRQQVQQTEANMYTNLNTEQ 660

Query: 661  XXXXXXXXXXXXXGEPTNXXXXXXXXXXXXXXXXXXXXRINVGVSSSKNPMNFQNIPSTY 720
                         GEPTN                    RINVGVSSSKNPMNFQNIPSTY
Sbjct: 661  PRQPAQQPYYQKPGEPTNQQAQQQQQQQQFQQPQQINQRINVGVSSSKNPMNFQNIPSTY 720

Query: 721  SNGQLXXXXXXXXXXXXXXXXXXXXXXXXRTNQGFIMXXXXXXXXXXXXXXQTKSGTTLP 780
            SNGQL                        RTNQGFIM              QTKSGTTLP
Sbjct: 721  SNGQLSQNQQPISLVQQQQQQQTLPSLKQRTNQGFIMVDTDDIPPVVPPHPQTKSGTTLP 780

Query: 781  PRPQSQNPPKVPPHPSKEKEEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLS 840
            PRPQSQNPPKVPPHPSKEKEEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLS
Sbjct: 781  PRPQSQNPPKVPPHPSKEKEEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLS 840

Query: 841  LNNPKRQVTLNLSDMSNAEVMESFSTGGVESSVASTESINLDLEDMKHKKGGQEDDNLAE 900
            LNNPKRQVTLNLSDMSNAEVMESFSTGGVESSVASTESINLDLEDMKHKKGGQEDDNLAE
Sbjct: 841  LNNPKRQVTLNLSDMSNAEVMESFSTGGVESSVASTESINLDLEDMKHKKGGQEDDNLAE 900

Query: 901  MVARRSIEERETPLNVPKRENLKQKDENRLENITGRRSLDLRYQEINFSPDLRKDKXXXX 960
            MVARRSIEERETPLNVPKRENLKQKDENRLENITGRRSLDLRYQEINFSPDLRKDK    
Sbjct: 901  MVARRSIEERETPLNVPKRENLKQKDENRLENITGRRSLDLRYQEINFSPDLRKDKSNSS 960

Query: 961  XXXXXXXXXREDESVNEDDSELTLTENEKXXXXXXXXXXXXXFDSSSNLNSKGANRSSSR 1020
                     REDESVNEDDSELTLTENEK             FDSSSNLNSKGANRSSSR
Sbjct: 961  TSVHHISSIREDESVNEDDSELTLTENEKRQRQQPRHHQHTHFDSSSNLNSKGANRSSSR 1020

Query: 1021 GNIRGKQDLESYKHXXXXXXXXXXXXXXXXXXEMKKSFAKARQSLDLERVRREALLNSDN 1080
            GNIRGKQDLESYKH                  EMKKSFAKARQSLDLERVRREALLNSDN
Sbjct: 1021 GNIRGKQDLESYKHSTKNNSNSSIPISTTNTNEMKKSFAKARQSLDLERVRREALLNSDN 1080

Query: 1081 GKRRSIFSMFRGDKK 1095
            GKRRSIFSMFRGDKK
Sbjct: 1081 GKRRSIFSMFRGDKK 1095

>YBR059C (AKL1) [250] chr2 complement(356821..360147)
           Serine/threonine protein kinase of unknown function
           [3327 bp, 1108 aa]
          Length = 1108

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/504 (64%), Positives = 387/504 (76%), Gaps = 15/504 (2%)

Query: 1   MSTTSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNE 60
           MS T+G     +    P  ERYTPG  V VG HKVE++ Y+AEGGFAQIY VKF+E+LNE
Sbjct: 1   MSITNGTSRSVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNE 60

Query: 61  FENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH 120
           F+N    P L++GDVACLKRVLVQDENGLNEMRNEVEVMK+L+GAPNIVQY+DSNASRR 
Sbjct: 61  FDNTASVP-LKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRR 119

Query: 121 NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180
           +G  GFEVLLLMELCPNKSLLDYMNQRL+TKLTE EI+KIMYDV  ++SQMHYLP  L+H
Sbjct: 120 DGVQGFEVLLLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIH 179

Query: 181 RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL 240
           RDIKIENVLVDA+NNFKL DFGSTST FP+VTTHQDIA+LTQNIYVHTTPQYRSPEMIDL
Sbjct: 180 RDIKIENVLVDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL 239

Query: 241 YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIM 300
           YRCLPI+EKSDIWALG+FLYKLLFFTTPFE+TGQFAILHSKYEFP N YSSKLINLIIIM
Sbjct: 240 YRCLPINEKSDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIM 299

Query: 301 LAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXXXX 360
           LAENPNLRPNIYQVL+++C I  ++VPIED+YAEG Y+F KYT FQNK+Q+V        
Sbjct: 300 LAENPNLRPNIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQ 359

Query: 361 EKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSA--EIPESNFAKQE 418
           +KK   N KL  ++ NLLND+F++SF+I+SK+P          G++A   IP  N  ++ 
Sbjct: 360 QKKIMQNNKLSDSEENLLNDMFLSSFEISSKLPMNAS-----DGHAAVSRIPSQNVGQEL 414

Query: 419 QQYEPRNIPTAGDYLNENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPG 478
           ++ +          L+E++ S T+++A S  T+N       I +P   E K     K+PG
Sbjct: 415 EEEKESQSDQRKSTLSEDKSSRTTSNANSSGTANNPQEINTIQSPG-IEDKSIFENKTPG 473

Query: 479 KPIENTEQYFPTVGELDYYLDNEL 502
                 E Y+P+V ELD YLD EL
Sbjct: 474 ------ELYYPSVSELDTYLDKEL 491

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/342 (26%), Positives = 142/342 (41%), Gaps = 59/342 (17%)

Query: 793  PHPSKEKEEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLSLNNPKRQVTLNL 852
            P  S  K E LLI+LSP ++  G++  + T+  +           ++  +N  R   LNL
Sbjct: 786  PMHSSSKNEALLIELSPLKEDAGKQSFQDTNEPQTGGIEDAGGSGTIKGSNNNRNGVLNL 845

Query: 853  S----DMSNAEV-----------------------------MESFSTGGVESSVASTESI 879
            S    D+S  +                                ++ST  +  S+ S+ESI
Sbjct: 846  SLNEMDLSRDDTGAAVSSFSSSSSSASIQQAKLSGRKGSSKRNNYSTDELGDSMVSSESI 905

Query: 880  NLDLEDMKHKKGGQEDDNLAEMVARRSIEERETPLNVPKRENLKQKDENRLENITGRRSL 939
            ++DL+D +  K  +       +   R  +++    +  K    K KD + +     R+SL
Sbjct: 906  DIDLDDARRGKTAER----RPLHNERGHKDQARSSDASKSNQFKSKDFSSVSTRQPRQSL 961

Query: 940  DLRYQEINF-SPDLRKDKXXXXXXXXXXXXXREDESVNEDDSELTLTENEKXXXXXXXXX 998
            DL +QE+N  SP L ++                  S +   +   +TEN++         
Sbjct: 962  DLNFQEVNLSSPTLTQEHRNKNDSPAPNSHHSYRVSPH---ASTAITENKR--------- 1009

Query: 999  XXXXFDSSSNLNSKGANRSSSRGNIRGKQDLESYKHXXXXXXXXXXXXXXXXXXEMKKSF 1058
                 + S+  N K     + R   + + DLE Y+H                  EM+KSF
Sbjct: 1010 HSTGHELSTRSNGK---HETHRTGSKQRHDLERYRHSKDKDSNSSITISTSTPSEMRKSF 1066

Query: 1059 AKARQSLDLERVRREAL------LNSDNGKRRSIFSMFRGDK 1094
            A+ARQSLDLERVRREA+          NGKRRS FS+FR +K
Sbjct: 1067 ARARQSLDLERVRREAMASSASSSGGSNGKRRSFFSVFRSEK 1108

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 44/74 (59%), Gaps = 7/74 (9%)

Query: 560 LNTTGMVQRQKSLGSVSTDGRSVGSNSH----VTNAENLPTEYTAKSDLPGMAKQHKSNN 615
           LNT  + QRQKS  S S+ GRS+ S S+    + + E L  E TA  +     KQHKSNN
Sbjct: 507 LNTQSLPQRQKSTSSYSSGGRSMKSTSYGAATIGSDEALANEKTAGIN---KMKQHKSNN 563

Query: 616 PFPKMTHAFQSANE 629
           PFPKM  A+ S NE
Sbjct: 564 PFPKMNVAYHSTNE 577

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/380 (71%), Positives = 317/380 (83%), Gaps = 11/380 (2%)

Query: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76
           P  E+  PGT + VG+HKVEI+KY+AEGGFA IY VKF+EF NE E       L+ GD+A
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETP--SSSLKEGDLA 84

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
           CLKRVLV DENGLNE+RNEVEVMKQL+ + NIVQYYDSNASRR +G PG+EVLLLMELCP
Sbjct: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCP 144

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
           NKSLLDYMNQRLATKL+EKE+LKIMYDVT AV+QMH+LPTPL+HRDIKIENVLVD++NNF
Sbjct: 145 NKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF 204

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           KLCDFGSTS+ FP++TTHQDIA+LT NIYVHTTPQYR+PEMIDLYRCLPIDEKSDIWALG
Sbjct: 205 KLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264

Query: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316
           IFLYKLLF+TTPFELTGQFAILHSKY+ P NNYSSKLINLIIIMLAENPNLRPNIYQV++
Sbjct: 265 IFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIY 324

Query: 317 NICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXXXXEKKFKTNGKLPQADIN 376
            +C+I  + VP ED+Y  GPYDF+KY+ +Q K+Q+          +K          D++
Sbjct: 325 QVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQK---------QDVD 375

Query: 377 LLNDLFVTSFDIASKVPFEL 396
            LNDLF+  F+IA K P ++
Sbjct: 376 TLNDLFINCFEIAPKQPMDM 395

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 1/41 (2%)

Query: 1053 EMKKSFAKARQSLDLERVRREALLNSD-NGKRRSIFSMFRG 1092
            EM+KS ++AR+SLDLE V+RE+   SD   KR+S F +F+ 
Sbjct: 818  EMRKSLSRARKSLDLEGVKRESAGGSDTTSKRKSFFGVFKS 858

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 48/149 (32%)

Query: 800 EEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLSLNNPKRQVTLNLSDMSNAE 859
           +E+LLIDLSP      +K   S SP                   PK  +T++  D+S  +
Sbjct: 686 QEELLIDLSP-----EKKETSSVSP-------------------PKLNITIDQVDLSYRD 721

Query: 860 VMESFSTGGVESSVASTESINLDLEDMKHKKGGQEDDNLAEMVARRSIEERETPLNVPKR 919
             ++      + S+AS+ESI +DL+  +     +   + + + A             P +
Sbjct: 722 EDKTDEASVADESIASSESIAMDLKKKEKDTKPKYSSDASFVTA-------------PPQ 768

Query: 920 ENLKQKDENRLENITGRRSLDLRYQEINF 948
            +              RRSLDL++QEINF
Sbjct: 769 SSR-----------PSRRSLDLKFQEINF 786

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 16/22 (72%), Gaps = 2/22 (9%)

Query: 599 TAKSDLPGMAKQHKSNNPFPKM 620
           TAKS      KQHKSNNPFPKM
Sbjct: 504 TAKST--ASIKQHKSNNPFPKM 523

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/490 (59%), Positives = 365/490 (74%), Gaps = 13/490 (2%)

Query: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76
           PN E+Y  G  ++VGAH+VEI+ Y+AEGGFAQIY VKF+E+LNEFE+   K  + +GD+A
Sbjct: 15  PNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIA 74

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
           CLKRV+V DE GLNEMRNEVEVMK+L+ +PNIVQY+DSNASRR +G PGFEVLLLMELCP
Sbjct: 75  CLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCP 134

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
           NKSLLDYMNQRL TKL+E EILKIMYDV+  +S MHYL  PL+HRDIKIENVLVDA NNF
Sbjct: 135 NKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           KLCD GSTS   P + ++QDIA++TQNIYVHTTPQYR+PEMIDLYR LPI+EKSDIWALG
Sbjct: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALG 254

Query: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316
           IFLYKLLF+TTPFE+TGQ AILHSKY+FP N YSSK+INLIIIMLAENPNLRPNI+QV++
Sbjct: 255 IFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVY 314

Query: 317 NICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXXXXEKKFKTNGKLPQADIN 376
           +ICSI  + VPIED+Y  GPY+F+ YT FQ+KVQ++         K   +  KL + D  
Sbjct: 315 HICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNKVVSSKSKLSKEDGL 374

Query: 377 LLNDLFVTSFDIASKVP---FELKVPTPLPGYSAEIPESNFAKQEQQYEPRNIPTAGDYL 433
           +L++L++ +F++  K+P      K PT       EI  ++ + Q+Q  +  N   +   +
Sbjct: 375 VLDELYIKTFEMIPKIPNPRLSEKQPT------LEIGLNSPSIQDQHLDVNNKRRS---M 425

Query: 434 NENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPGKPIENTEQYFPTVGE 493
           +E+  S  ++D +S+ +  T+  + +  T S    KE   E  P    E+ E YFP+V E
Sbjct: 426 HESINSRQASDNISQKSVRTSSNTIE-KTFSQTSNKEFSKETDPESHDESGEPYFPSVNE 484

Query: 494 LDYYLDNELK 503
           L+ YLD E K
Sbjct: 485 LNTYLDKEFK 494

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 139/310 (44%), Gaps = 49/310 (15%)

Query: 795  PSKEKEEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLSLNNPKRQVTLNLSD 854
            P + + EQLLID+SPPRD+     + ++SP +   +    A + L L        LN  D
Sbjct: 754  PQEVQNEQLLIDISPPRDI-----KRTSSPQKELSNVKTHAPQVLDLQ-------LNEMD 801

Query: 855  MSNAEVMESFSTGGVESSVASTESINLDLED---MKHKKGGQEDDNLAEMVARRSIEERE 911
            +S A + +S +   V+SS+ S+ES++LD+ +   M +  G Q    LA+           
Sbjct: 802  ISEASIADSSNGNDVDSSLLSSESVDLDVTNRLKMHYPFGNQRQTKLAQK---------- 851

Query: 912  TPLNVPKRENLKQKDENRLENITGRRSLDLRYQEINFSPDLRKDKXXXXXXXXX--XXXX 969
                 P +  +K  D+   +   GRRSLDL  QE++F+ +  K+                
Sbjct: 852  -----PIQSKVKDTDK---QQKNGRRSLDLSVQEVHFNSEAGKNNLLHNKNTHRPGIKGS 903

Query: 970  REDESVNEDDSEL----TLTENEKXXXXXXXXXXXXXFDSSSNLNSKGANRSSSRGNIRG 1025
              +ESV +    L    TL  ++               D     + +  + S SR    G
Sbjct: 904  MSEESVEDTIKSLPPSNTLPRSQSSKVISQSTNARTSLDRQRQRHIEPRD-SKSRSRSHG 962

Query: 1026 KQDLESYKHXXXXXXXXXXXXXXXXXXEMKKSFAKARQSLDLERVRREALLNSDN----G 1081
               LE Y                    EMK+SFAKARQSLDLER RR+A+  S++    G
Sbjct: 963  ---LEEY--TSSNGSNSSINISTSNKFEMKRSFAKARQSLDLERARRDAMSRSNSGHETG 1017

Query: 1082 KRRSIFSMFR 1091
            KR+S+FSMF+
Sbjct: 1018 KRKSLFSMFK 1027

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/423 (64%), Positives = 327/423 (77%), Gaps = 9/423 (2%)

Query: 3   TTSGPVSVNNTTVK----PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFL 58
           T S P SV +T       PN+   +P TQV VG H+ EI++++AEGGFA IY VKF+E  
Sbjct: 6   TISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELT 65

Query: 59  NEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASR 118
           NE +       L+ GD+ACLKRV+V DENGLNE+RNEVE MKQL+G+PNIVQYYDSNASR
Sbjct: 66  NEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASR 125

Query: 119 RHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPL 178
             +G PGFE+LLLMELCP KSLLDYMN +LATKLTE EILKIMYDV+ A++QMHYLPTPL
Sbjct: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185

Query: 179 LHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI 238
           +HRDIKIENVLVD  +NFKLCDFGSTS  FP+V+THQDIAVLT NIYVHTTPQYRSPEMI
Sbjct: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI 245

Query: 239 DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLII 298
           DLYRCLPI+EKSDIWALGIFLYKLLF+TTPFELTGQFAILHSKYE P+N YSSKLINLII
Sbjct: 246 DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLII 305

Query: 299 IMLAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXX 358
           IMLAENP+LRPNIYQV+H++CSI    VP  D+Y  GPYDF KY+ +  K+Q +      
Sbjct: 306 IMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMF- 364

Query: 359 XXEKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSAEIPESNFAKQE 418
               +   N K+   D++ LNDLF+ +F+IA K P +  + +     + E  E++ AK +
Sbjct: 365 ----ELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQEAPEDLETDIAKMD 420

Query: 419 QQY 421
           + Y
Sbjct: 421 ECY 423

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 48/110 (43%), Gaps = 24/110 (21%)

Query: 844 PKRQVTLNLSDMSNAEVMESFSTGGVESSVASTESINLDLEDMKHKKGGQEDDNLAEMVA 903
           P+  +T +  D+S   +     T  +E S+ S ESI+LDL+  K K+   +         
Sbjct: 672 PRLDLTFDQLDLSKNSLTRQSDTE-LEESIISDESISLDLKQPKLKEPVTQ----PRQTT 726

Query: 904 RRSIEERE--TPLNVPKRENLKQKDENRLENITGRRSLDLRYQEINFSPD 951
               E +E   P  VPKR                 RSLDL+YQEIN S D
Sbjct: 727 SPGSESKEFLKPAKVPKR-----------------RSLDLKYQEINLSND 759

>Kwal_27.10945
          Length = 935

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/380 (70%), Positives = 308/380 (81%), Gaps = 10/380 (2%)

Query: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76
           P  E+   G+QV VG H+VEI+KY+AEGGFA IY V+FIE+ NE E      KL++GD+A
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTI-KLEVGDLA 124

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
           CLKRVLV DENGLNEMRNEV VMKQL G PNIVQYYDS+ASR  +G  GFEV LLMELCP
Sbjct: 125 CLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCP 184

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
           N SLLDYMNQRLATKL+E+EILKIM+DVT A++QMHYLP PL+HRD+KIENVLVDA +NF
Sbjct: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           KLCDFGSTST FP+  THQ+IAVLT NIYVHTTPQYRSPEMIDLYRCLPI+EKSDIWALG
Sbjct: 245 KLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 304

Query: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316
           IFLYKLLF+TTPFELTGQFAILHSKYEFP NNYSSKLINLIIIMLAENPNLRPNIYQV+ 
Sbjct: 305 IFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 317 NICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXXXXEKKFKTNGKLPQADIN 376
           N+CSI  +K P+ED+Y  G Y FEKY+ +Q K+Q V        E K           I+
Sbjct: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQMYLAYENK---------QQID 415

Query: 377 LLNDLFVTSFDIASKVPFEL 396
            LND+F+  F++A K P ++
Sbjct: 416 TLNDMFINCFEVAPKQPVDI 435

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 2/42 (4%)

Query: 1053 EMKKSFAKARQSLDLERVRREALLNSDN--GKRRSIFSMFRG 1092
            E KKSF++AR+SLDLER +R+   N +N   KR+S F  F+G
Sbjct: 894  EPKKSFSRARKSLDLERTKRDTPSNGENTSSKRKSFFGKFKG 935

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 72/164 (43%), Gaps = 61/164 (37%)

Query: 800 EEQLLIDLSPPRDLPGRKPRESTSPLRLEDDTSRMARRSLSLNNPKRQVTLNLSDMSNAE 859
           EE+LL+D SPP     R+P++    L L  D                  +++LS +S  E
Sbjct: 769 EEELLVDFSPPLK---REPQK----LDLTYD------------------SVDLSTLSKGE 803

Query: 860 VMESFSTGGVESSVASTESINLDL---EDMKHKKGGQEDDNLAEMVARRSIEERETPLNV 916
             +   T   E S+AS+ES+++DL   E +  K  GQ  D+    V       + +P   
Sbjct: 804 YKD--ETDISEQSMASSESVSVDLRQNERLSAKTRGQNVDDSVSAV-------KPSP--- 851

Query: 917 PKRENLKQKDENRLENITGRRSLDLRYQEINF----SPDLRKDK 956
                             GRRSLDL++QE++F    SPD++  K
Sbjct: 852 -----------------RGRRSLDLKFQEMDFSNSPSPDIKLQK 878

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  538 bits (1385), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/407 (63%), Positives = 314/407 (77%), Gaps = 20/407 (4%)

Query: 7   PVSVNNTTVKPNN----------ERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIE 56
           PV V  T VKP +          E++  G  V VG+H+VE++ Y+AEGGFAQIY VKF+E
Sbjct: 71  PVQVPQTQVKPQSIPPVAQPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVE 130

Query: 57  FLNEFE---NNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYD 113
           + NEFE   +  M   L+ G  ACLKRVLVQDE GLN+MR+EVEVMK+LQGAPNIVQY+D
Sbjct: 131 YTNEFERKNDESMNQPLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFD 190

Query: 114 SNASRRH----NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVS 169
           SNASR      N   GFEVLLLMELCPNKSLLDYMNQRLATKLTE+EI KIMYD+T AV+
Sbjct: 191 SNASRLRDYSGNITQGFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVA 250

Query: 170 QMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTT 229
           QMHYLP PL+HRDIKIENVLVDA NNFKLCDFGSTST FP  T+ QDIA+L+Q++Y+HTT
Sbjct: 251 QMHYLPVPLIHRDIKIENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTT 310

Query: 230 PQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNY 289
           PQYRSPEMIDL++ +PI+EKSDIWALG+FLYKLLFFTTPFE TGQFA+LHSK+EFP N+Y
Sbjct: 311 PQYRSPEMIDLFKYIPINEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSY 370

Query: 290 SSKLINLIIIMLAENPNLRPNIYQVLHNICSISGMKVP---IEDQYAEGPYDFEKYTHFQ 346
           SSKLINLII+MLAENP+LRPNIYQVL+ +  ++  +VP   + D+Y +GPY+FEKYT FQ
Sbjct: 371 SSKLINLIIVMLAENPSLRPNIYQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQ 430

Query: 347 NKVQSVXXXXXXXXEKKFKTNGKLPQADINLLNDLFVTSFDIASKVP 393
            + Q V         K    N  +  AD  L + +++++F I  ++P
Sbjct: 431 KESQQVQLQLSTLQAKINDPNSTMQPADWELYDRMYMSAFTIVPQLP 477

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 1061 ARQSLDLERVRREALLNSDNGKRRSIFSMFRGDK 1094
            AR+SLDL+R R+     SD  K+RS+F+MF+  K
Sbjct: 959  ARKSLDLDRARQLHNYQSDK-KKRSLFNMFKEKK 991

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  520 bits (1339), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/380 (64%), Positives = 296/380 (77%), Gaps = 13/380 (3%)

Query: 20  ERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLK 79
           E    G+ V VG H+VE+I+Y+AEGGFA IY V F+ + NE +  R    LQ GD  CLK
Sbjct: 27  EMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELD--RQDRILQPGDTVCLK 84

Query: 80  RVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKS 139
           RV V DENGLNE+RNEVEVMK+L+   NIVQYYDSNASR  +G PG+EVLLLMELCPN S
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 140 LLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLC 199
           LLDYMNQRLATKL+E E+LKIMYD+T  +S MHY  TPL+HRDIKIENVLVDA NNFKLC
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 200 DFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 259
           DFGSTS   P V +HQ+IA+L  NIYVHTTPQYRSPEMIDLYRCLPI+EKSDIWALGIFL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 260 YKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHNIC 319
           YKLLF+TTPFELTGQFAILHSKYE P+N++SSKLINL+IIMLAENP LRPN+YQV+++IC
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 320 SISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVXXXXXXXXEKKFKTNGKLPQADI---N 376
           S+   +V I+D Y +GPY+F+ Y  +Q K+Q +        +     + +L Q  I   +
Sbjct: 325 SMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRL--------QYDMLMSHQLAQRGIINTD 376

Query: 377 LLNDLFVTSFDIASKVPFEL 396
            +NDLF+++F+ A K P  +
Sbjct: 377 KVNDLFISTFECAPKQPMVM 396

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 26/37 (70%), Gaps = 3/37 (8%)

Query: 1058 FAKARQSLDLERVRREAL---LNSDNGKRRSIFSMFR 1091
            F + R+S+DL+  ++E+     NS +GKRRSIF +F+
Sbjct: 924  FHRGRKSVDLDVSKKESKEEPTNSGSGKRRSIFGVFK 960

>Kwal_27.11542
          Length = 791

 Score =  318 bits (814), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 209/318 (65%), Gaps = 11/318 (3%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +P++  YT GT + VG+H+  IIKY+  GGFA IY+ +    ++  + N       +G+V
Sbjct: 3   QPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAE----ISPADPN------SIGNV 52

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           ACLKRVLV D+  LN +R EV+ MK L+G  ++V Y DS+A++       +EV LLME C
Sbjct: 53  ACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYC 112

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
               L+D+MN RL  +LTE E+LKIM D+T  ++ MH L  PL+HRDIKIENVL+     
Sbjct: 113 SAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKT 172

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           FK+CDFGS           Q+ + +  +I  +TT QYRSPEMIDLYR  PI+EKSDIWAL
Sbjct: 173 FKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWAL 232

Query: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314
           G+FLYKL ++TTPFE  G  AILHS+++FP    YS +L NLI +ML+ENPN RPNI QV
Sbjct: 233 GVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQV 292

Query: 315 LHNICSISGMKVPIEDQY 332
           L  +  I  +  P+ + Y
Sbjct: 293 LEEVSRIQNVPCPLRNFY 310

>Scas_601.6
          Length = 661

 Score =  308 bits (788), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 209/318 (65%), Gaps = 11/318 (3%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +P    Y PGT + VG+HKV+++KY+  GGFAQIY V+ I   ++F N          +V
Sbjct: 3   QPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ-ISPPDKFTNT---------NV 52

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           ACLKRV+V D+  LN +R EV+ MK L+   ++V Y DS+A++ +     +EV LLME C
Sbjct: 53  ACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYC 112

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
               L+D+MN RL  +L E EIL IM  VT  ++ MH L  PLLHRDIKIENVL+ ++  
Sbjct: 113 DMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGE 172

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           +K+CDFGS        +  Q+++ +  +I  +TT QYR+PEMIDLYR LPIDEKSDIWAL
Sbjct: 173 YKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWAL 232

Query: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314
           G+FLYKL ++TTPFE  G+ AILH+ ++FP    YS +L  LI  ML E P+ RPN YQV
Sbjct: 233 GVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQV 292

Query: 315 LHNICSISGMKVPIEDQY 332
           L  + S+  ++ PI + Y
Sbjct: 293 LEEVSSMQNVQCPIPNFY 310

>Scas_671.16
          Length = 723

 Score =  309 bits (791), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 207/318 (65%), Gaps = 11/318 (3%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +PN   Y PGT + VG+H  +IIKY+  GGFAQIY  + I  +N + N++          
Sbjct: 3   QPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQ---------T 52

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           ACLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A+R       +EV LLME C
Sbjct: 53  ACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYC 112

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
               L+D+MN RL  +LTEKEIL I+      VS MH L   L+HRDIKIENVL+ A+  
Sbjct: 113 KGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGE 172

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           FK+CDFGS  +        Q++A +  ++  +TT QYR+PEM+DLYR LPI+EKSDIWAL
Sbjct: 173 FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWAL 232

Query: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQV 314
           G+FLYKL ++TTPFE  G+ AILHS+Y++P    Y+ KL NLI   L E+P+ RPNI Q+
Sbjct: 233 GVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQL 292

Query: 315 LHNICSISGMKVPIEDQY 332
           L  I  I G+  PI + Y
Sbjct: 293 LEEISRIQGIPCPINNFY 310

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  309 bits (791), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 205/314 (65%), Gaps = 16/314 (5%)

Query: 24  PGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLV 83
           PG  + VG+H+V+II+Y+  GGFAQIY+ +            + P    G +ACLKRV V
Sbjct: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEV-----------LSPGPIQGSLACLKRVHV 59

Query: 84  QDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASR--RHNGFPGFEVLLLMELCPNKSLL 141
            D+  LN +R EV+ MK L+G  ++V Y DS+A++  RH+G   +EV LLME C    L+
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDG--TYEVYLLMEYCLRGGLI 117

Query: 142 DYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
           D+MN RL T+L+E E+LKIM  V   +  MH L  PL+HRDIKIENVL+    +FK+CDF
Sbjct: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177

Query: 202 GSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYK 261
           GS S          +   +  +I  +TT QYR+PEMIDLYR LP+DEKSDIWALG+FLYK
Sbjct: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237

Query: 262 LLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQVLHNICS 320
           + +FTTPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI QVL  +  
Sbjct: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297

Query: 321 ISGMKVPIEDQYAE 334
           I G+  P+ + Y E
Sbjct: 298 IQGVPCPLPNFYLE 311

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  309 bits (792), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 200/320 (62%), Gaps = 12/320 (3%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +P  E Y  GT + VG+HK  IIKY+  GGFA IY+ +              P      +
Sbjct: 3   QPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI-----------SPPDPNSSSI 51

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           ACLKRVLV D+  LN +R EV+ MK L+    +V Y DS+A++       +EV LLME C
Sbjct: 52  ACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYC 111

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
               L+D+MN RL  +L E E+LKIM  V+  V+ MH L  PL+HRDIKIENVL+    N
Sbjct: 112 ARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGN 171

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           FK+CDFGS           Q++  +  +I  +TT QYRSPEMIDLYR LP+DEKSDIWAL
Sbjct: 172 FKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWAL 231

Query: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314
           G+FLYKL ++TTPFE  G+ AILHSK++FP    YS +L NLI  +L ENP  RPNI Q+
Sbjct: 232 GVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQL 291

Query: 315 LHNICSISGMKVPIEDQYAE 334
           L  +  I G+  P+++ Y E
Sbjct: 292 LAEVSRIQGVPCPVKNFYLE 311

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  300 bits (767), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 207/325 (63%), Gaps = 16/325 (4%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +P    Y  GTQ+ VG+H+VEIIKY+  GGFAQ+Y+   I   +   N+          V
Sbjct: 3   QPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA-LINPPDPHSNS---------SV 52

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRR--HNGFPGFEVLLLME 133
           ACLKRV+V D+  LN +R EV+ M+ L+    +V Y DS+A++   HNG   +EV +LME
Sbjct: 53  ACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG--SYEVFVLME 110

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193
            C    L+D+MN RL  +L E EIL+IM  VT  V+ MH L  PL+HRDIKIENVL+ A 
Sbjct: 111 YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253
           N +KLCDFGS           Q+++ + Q+I  +TT QYRSPEMID +R LPIDEKSDIW
Sbjct: 171 NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIW 230

Query: 254 ALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIY 312
           ALGIFLYKL ++TTPFE  G  AIL  K+EFP   NYS +L  LI  +L ++P  RPN+Y
Sbjct: 231 ALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVY 290

Query: 313 QVLHNICSISGMKVPIED-QYAEGP 336
           Q+L  I  +  +  PI D Q  + P
Sbjct: 291 QLLKRISIMQNVPCPINDIQVVQAP 315

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  298 bits (764), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 203/318 (63%), Gaps = 11/318 (3%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +P  +R   GTQ+ VG H V+I+KY+  GGFAQIYAV+ +  +  F  +         +V
Sbjct: 3   QPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILS-MGLFNGS---------NV 52

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           ACLKRV V D+  LN +R EV+ MK L    ++V Y DS+A+R       +EV LLME C
Sbjct: 53  ACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYC 112

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
               L+D+MN RL  +LTE EIL IM   T  ++ MH L  PLLHRDIKIENVL+     
Sbjct: 113 EGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGI 172

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           +K+CDFGS S         Q++  +  +I  +TT QYR PEM+DLYR LPIDEK+DIWAL
Sbjct: 173 YKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWAL 232

Query: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQV 314
           G+FLYKL ++TTPFE  G+ AILH++++FP   NYS +L NLI  ML E+P+ RPN+ QV
Sbjct: 233 GVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQV 292

Query: 315 LHNICSISGMKVPIEDQY 332
           L  +  +  +  PI + Y
Sbjct: 293 LEEVSRMQNVPCPIRNFY 310

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  301 bits (771), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 200/317 (63%), Gaps = 12/317 (3%)

Query: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76
           P    Y PGT + VG+H  +IIKY+  GGFAQ+Y  + I   + + N          ++A
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYSN---------ANIA 53

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
           CLKRV+V  + GLN +R EV+ MK L+   ++V Y DS+A+R  NG   +EV +LME C 
Sbjct: 54  CLKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLMEFCE 112

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
              L+D+MN RL  +L E EIL+IM      ++ MH L  PL+HRDIKIENVL+     +
Sbjct: 113 RGGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLY 172

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           K+CDFGS S         Q+   +  +I  +TT QYRSPEMIDLYR LPIDEKSDIWALG
Sbjct: 173 KVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALG 232

Query: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQVL 315
           +FLYK+ ++TTPFE +G+  ILH++Y++P    YS +L NLI +ML E P+ RPNI QVL
Sbjct: 233 VFLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVL 292

Query: 316 HNICSISGMKVPIEDQY 332
             +  +     PI + Y
Sbjct: 293 EEVSRLQNKPCPIRNFY 309

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  299 bits (765), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 202/318 (63%), Gaps = 11/318 (3%)

Query: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75
           +P  E+Y  GT + VG+H+V+++KY+A GGFA +Y+V+         +N          V
Sbjct: 3   QPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDN----------V 52

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           ACLKRV+V D+  LN +R EV+ MK L+G   IV Y DS+A++       +EV LLME C
Sbjct: 53  ACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYC 112

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
               L+D+MN RL  +L E EIL IM  V+  V+ MH L  PL+HRDIKIENVL+   + 
Sbjct: 113 SGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHE 172

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           FKLCDFGS S         ++   +  +I  +TT QYR PEMIDLYR LPIDEKSDIWAL
Sbjct: 173 FKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWAL 232

Query: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314
           G+FLYK  ++TTPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI QV
Sbjct: 233 GVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQV 292

Query: 315 LHNICSISGMKVPIEDQY 332
           +  +  I G+  PI++ Y
Sbjct: 293 VEEVSRIQGIPCPIKNFY 310

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  279 bits (713), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 199/313 (63%), Gaps = 11/313 (3%)

Query: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76
           P+  +Y PGT V VG+H V I+KY+  GG+AQIY+ + +   ++F    M         A
Sbjct: 4   PHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQFLGTNM---------A 53

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
            LKRV+V D++ LN +R EV+ MK+L+    IV Y DS+A++       +EV L+ME C 
Sbjct: 54  VLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCS 113

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
              L+D+MN RL  +LTE EIL I   ++  V+ MH L  PL+HRDIKIENVL+   + +
Sbjct: 114 RGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKY 173

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           KLCDFGS S       T +++A +  +I + TT QYR+PEM+DL +   +++KSDIWALG
Sbjct: 174 KLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALG 233

Query: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVL 315
           +FLYKL ++TTPFE TG+  IL+   EFP   +YS  +  LI+ MLA+NP  RPNI+Q++
Sbjct: 234 VFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQII 293

Query: 316 HNICSISGMKVPI 328
             +  +  +  PI
Sbjct: 294 QTVSKLLNVNCPI 306

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 138/292 (47%), Gaps = 56/292 (19%)

Query: 40  YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVM 99
           ++ EGGFA+ + +K               K ++     + ++ ++ E    ++ +E+++ 
Sbjct: 95  FLGEGGFARCFQMK-------------DDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIH 141

Query: 100 KQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTEK 155
           K ++  PNIVQ+ D            FE    V +L+E+CPN S+++ + QR    LTE 
Sbjct: 142 KSMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSVMELLRQR--KHLTEP 187

Query: 156 EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ 215
           E+   M  +  A+  MH     ++HRD+K+ N+  D + N K+ DFG             
Sbjct: 188 EVRFCMIQIIGAIRYMH--SRRVIHRDLKLGNIFFDKEYNLKIGDFGLA----------- 234

Query: 216 DIAVLT----QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
             AVL     +   +  TP Y +PE++   +      + DIW++G+ LY LLF   PF+ 
Sbjct: 235 --AVLANDKERKYTICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQA 291

Query: 272 ----TGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQVLHNI 318
               T    I    + FP +   SS   NLI  +L  NP  RP++Y++  N+
Sbjct: 292 KEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>Scas_644.15
          Length = 726

 Score = 92.8 bits (229), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 135/292 (46%), Gaps = 56/292 (19%)

Query: 40  YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVM 99
           ++ EGGFA+ + +K                 ++     + ++ ++ E    ++ +E+++ 
Sbjct: 97  FLGEGGFARCFQIK-------------DESGKIFAAKTVAKISIKTEKTKKKLLSEIQIH 143

Query: 100 KQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTEK 155
           K ++  PNIV + D            FE    V +L+E+C N SL+D M +R    LTE 
Sbjct: 144 KSMK-HPNIVHFVDC-----------FEDDTNVYILLEICSNGSLMDLMKKR--KTLTEP 189

Query: 156 EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ 215
           E+      +  AV  MH     ++HRD+K+ N+  D   N K+ DFG             
Sbjct: 190 EVRFFTTQICGAVKYMH--SRRVIHRDLKLGNIFFDKDYNLKVGDFGLA----------- 236

Query: 216 DIAVLTQN----IYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
             AVL  N      V  TP Y +PE++ + +      + DIW++G+ +Y LL    PF+ 
Sbjct: 237 --AVLANNRERKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQA 293

Query: 272 TGQFAIL----HSKYEFPKNNY-SSKLINLIIIMLAENPNLRPNIYQVLHNI 318
                I       +Y +PK+ Y SS+   LI  +L  +P  RP+I +++ ++
Sbjct: 294 KDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 92.8 bits (229), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 140/299 (46%), Gaps = 63/299 (21%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRM---KPKLQMGDVACLKRVLVQ 84
           V +G +K  I+K I EG F ++Y            N+R+   K  L+ G+          
Sbjct: 32  VDIGNYK--IVKLIGEGSFGKVY----------LANHRLTHQKVVLKTGN---------- 69

Query: 85  DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDY- 143
            +N  N +R EV   +Q    P+I + Y+   +         +V + +E CP K L +Y 
Sbjct: 70  -KNDPNVVR-EVFYHRQFD-FPHITKLYEVIVTES-------KVWMALEYCPGKELYEYL 119

Query: 144 -MNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
            M  R++ + + K   +I+  V YA    H L    +HRD+K+EN+L+D +   K+ DFG
Sbjct: 120 LMQHRISLEESGKLFAQIVSAVYYA----HSLQ--CVHRDLKLENILLDKKGRAKITDFG 173

Query: 203 STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL--YRCLPIDEKSDIWALGIFLY 260
            T          ++ A  T    V  T  Y +PE+I+   Y    I    DIW+LG+ LY
Sbjct: 174 FT----------RECATKTMLETVCGTTVYMAPELIERKSYDGFKI----DIWSLGVILY 219

Query: 261 KLLFFTTPF----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
            ++  T PF    E   ++ I++ +  +  +  S    +LI  +L ++P+ RP + QVL
Sbjct: 220 TMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 91/309 (29%), Positives = 137/309 (44%), Gaps = 65/309 (21%)

Query: 21  RYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKR 80
           ++T      VG +K  I+K I EG F ++Y       L+   + ++          CLK 
Sbjct: 29  QFTSDELTEVGNYK--ILKQIGEGSFGKVYLA-----LHRPTHRKV----------CLK- 70

Query: 81  VLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSL 140
               D+N  N +R EV   +Q    P I + Y+   +         +V + +E CP K L
Sbjct: 71  --TSDKNDPNIVR-EVFYHRQFD-FPYITKLYEVIVTES-------KVWMALEYCPGKEL 119

Query: 141 LDYMNQRLATKLTE-KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLC 199
            D++       L E  E+   +    Y    MH      +HRD+K+EN+L+D   N KL 
Sbjct: 120 YDHLLSLRRISLLECGELFAQISGAVYYAHSMH-----CVHRDLKLENILLDKNGNAKLT 174

Query: 200 DFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMID--LYRCLPIDEKSDIWALGI 257
           DFG T       T             V  T  Y +PE+I+   Y    I    DIW+LG+
Sbjct: 175 DFGFTRECMTKTTLET----------VCGTTVYMAPELIERRTYDGFKI----DIWSLGV 220

Query: 258 FLYKLLFFTTPF----ELTGQFAILHSKYEFPKNNYSSKLI-----NLIIIMLAENPNLR 308
            LY L+    PF    E   ++ I++   E PK  Y +K+I     +LI  +LA+NP  R
Sbjct: 221 ILYTLITGYLPFDDDDEAKTKWKIVN---EEPK--YDAKVIPDDARDLISRLLAKNPGER 275

Query: 309 PNIYQVLHN 317
           P++ QVL +
Sbjct: 276 PSLSQVLRH 284

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 136/292 (46%), Gaps = 56/292 (19%)

Query: 40  YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVM 99
           ++ EGGFA+ + +K                 ++     + ++ ++ E    ++ +E+++ 
Sbjct: 78  FLGEGGFARCFQMK-------------DDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIH 124

Query: 100 KQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTEK 155
           K ++  PNIVQ+ D            FE    V +L+E+CPN SL+D + QR   +LTE 
Sbjct: 125 KSMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSLMDLLKQR--KQLTEP 170

Query: 156 EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ 215
           E+      +  A+  MH     ++HRD+K+ N+  D   N K+ DFG             
Sbjct: 171 EVRFFTTQIVGAIKYMH--SRRIIHRDLKLGNIFFDKHFNLKIGDFGLA----------- 217

Query: 216 DIAVLT----QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
             AVL     +   +  TP Y +PE++   +      + DIW++G+ +Y LL    PF+ 
Sbjct: 218 --AVLANDRERKYTICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQA 274

Query: 272 ----TGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQVLHNI 318
               T    I    + FPK+   SS+   LI  +L+ +P  RP++ +++  +
Sbjct: 275 KEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 131/297 (44%), Gaps = 63/297 (21%)

Query: 30  VGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGL 89
           VG +K++  K I EG F ++Y       L      + K  L+ GD +        D N  
Sbjct: 39  VGNYKIQ--KQIGEGSFGKVY-------LATHRPTKQKVVLKTGDKS--------DPN-- 79

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA 149
             +  EV   +Q    P I + Y+   +         +V + +E CP K L D++  +  
Sbjct: 80  --VVREVFYHRQFD-YPYITKLYEVIVTET-------KVWMALEYCPGKELYDHLLSK-- 127

Query: 150 TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
           ++L   E  ++   +T AV   H L    +HRD+K+ENVL+D   N KL DFG T     
Sbjct: 128 SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGFTRESMT 185

Query: 210 MVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTTP 268
                   AVL     V  T  Y +PEMI   +  P D  K DIW+LG+ LY LL    P
Sbjct: 186 K-------AVLET---VCGTTVYMAPEMI---QHKPYDGFKVDIWSLGVILYTLLCGCLP 232

Query: 269 FE-----LTGQFAI-----LHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
           F+     LT Q  I     +  +   P+        NLI  +L+++P  RPN   +L
Sbjct: 233 FDEDDDLLTKQKIINDTPVIDERITIPEAQ------NLIEQLLSKDPTERPNTSAIL 283

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 138/290 (47%), Gaps = 58/290 (20%)

Query: 40  YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVM 99
           ++ EGGFA+ + +K                 ++     + ++ ++ E    ++ +E+++ 
Sbjct: 82  FLGEGGFARCFQMK-------------DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIH 128

Query: 100 KQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTEK 155
           K ++  PNIVQ+ D            FE    V +L+E+CPN SL+D + +R    LTE 
Sbjct: 129 KSMK-HPNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEP 174

Query: 156 EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ 215
           E+      +  A+  MH     ++HRD+K+ N+  D+  N K+ DFG             
Sbjct: 175 EVRYFTTQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLA----------- 221

Query: 216 DIAVLT----QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
             AVL     +   V  TP Y +PE++         E  DIW++G+ +Y LL    PF+ 
Sbjct: 222 --AVLANDRERKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ- 277

Query: 272 TGQFAILHSK-----YEFPKNNYSSK-LINLIIIMLAENPNLRPNIYQVL 315
             +  I++ +     Y FP+   +SK ++ LI  +L+ +P  RP++ +++
Sbjct: 278 AKEVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 327

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 138/292 (47%), Gaps = 53/292 (18%)

Query: 30  VGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGL 89
           +G +K+   K+I EG F ++Y       L        K  L+ G+    KR    D N +
Sbjct: 34  IGNYKIS--KFIGEGSFGKVY-------LATHRLTHQKVVLKTGN----KR----DPNVV 76

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYM--NQR 147
            E    V   +Q    P I + Y+   +          V +++E C    L +++   QR
Sbjct: 77  RE----VFYHRQFD-FPYITKLYEVIVTES-------RVWMVLEYCSGHELYEHLLKEQR 124

Query: 148 LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
           L+ + ++K   +I   V YA    H L    +HRD+K+ENVL+D   + KL DFG T   
Sbjct: 125 LSLEESKKLFSQIASAVYYA----HELKC--VHRDLKLENVLLDGNGHAKLTDFGFT--- 175

Query: 208 FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTT 267
                  +++A  +Q   +  T  Y +PE+I+  +C     K DIW+LGI LY ++    
Sbjct: 176 -------REMATRSQLETICGTTVYMAPELIE-RKCYD-GFKVDIWSLGIILYTMINGYM 226

Query: 268 PF----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
           PF    ++  +  I++ + +F +   S   I+LI  ML +NPN R ++ QVL
Sbjct: 227 PFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRKNPNERISLAQVL 278

>Kwal_26.8751
          Length = 848

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 141/306 (46%), Gaps = 58/306 (18%)

Query: 30  VGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGL 89
           VG +K  I+K + EG F ++Y       L        K  L+MG            +N  
Sbjct: 34  VGNYK--ILKIVGEGSFGKVY-------LASHCLTHQKVVLKMGS-----------KNDP 73

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA 149
           N +R EV   +Q   + +I + Y+   +  +       V + +E CP K L +Y+   LA
Sbjct: 74  NVVR-EVFYHRQFDYS-HITKLYEVIVTENY-------VWMALEYCPGKELYEYL---LA 121

Query: 150 TK-LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGST---S 205
            K +  +E  ++   +  AV   H +    +HRD+K+EN+L+D + + KL DFG T   +
Sbjct: 122 KKHIPLEECSELFSQIVGAVYYAHSMK--CVHRDLKLENILLDKKGHAKLTDFGFTRECA 179

Query: 206 TKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFF 265
           TK  + T             +  T  Y +PE+I+  R      K D W+LGI LY ++  
Sbjct: 180 TKGILET-------------ICGTTVYMAPELIE--RKPYEGYKIDTWSLGIILYTMIHG 224

Query: 266 TTPF----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL-HNICS 320
           T PF    E+  ++ I+H    +  +   S    LI  +L ++PN RP++ QVL H    
Sbjct: 225 TMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQ 284

Query: 321 ISGMKV 326
             G+K+
Sbjct: 285 PYGLKI 290

>Scas_700.28
          Length = 896

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 96/197 (48%), Gaps = 28/197 (14%)

Query: 127 EVLLLMELCPNKSLLDYM--NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIK 184
           +V + +E CP K L D +    R+ T     E +++   +   V   H L    +HRD+K
Sbjct: 103 KVWMALEYCPGKELYDRVLSMHRVPTD----ECVQLFAQIVGGVHYAHSLN--CVHRDLK 156

Query: 185 IENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL--YR 242
           +EN+L+D   + KL DFG T       T             +  T  Y +PE+I+   Y 
Sbjct: 157 LENILLDKSGDAKLTDFGFTRECMTKTTLET----------ICGTTVYMAPELIERKSYD 206

Query: 243 CLPIDEKSDIWALGIFLYKLLFFTTPF----ELTGQFAILHSKYEFPKNNYSSKLINLII 298
              I    DIW+LG+ LY ++  + PF    E   ++ I+H   +  +N  ++   +LI+
Sbjct: 207 GFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLIL 262

Query: 299 IMLAENPNLRPNIYQVL 315
            +LA+NPN RP + Q+L
Sbjct: 263 RLLAKNPNDRPTVEQIL 279

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 133/290 (45%), Gaps = 56/290 (19%)

Query: 39  KYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEV 98
           +++ EGGFA+ + +K                 ++     + ++ ++ E    ++ +E+++
Sbjct: 85  QFLGEGGFARCFQIK-------------DDSGKIFAAKTVAKISIKSEKTRKKLLSEIQI 131

Query: 99  MKQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTE 154
            K +    NIVQ+ D            FE    V +L+E+CPN SL++ + +R    +TE
Sbjct: 132 HKSMSHT-NIVQFIDC-----------FEDNVNVYILLEICPNGSLMELIKKR--KTITE 177

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
            E+   M  +   +  MH     ++HRD+K+ N+  D   N K+ DFG            
Sbjct: 178 PEVRFFMTQICGGIQYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLA---------- 225

Query: 215 QDIAVLT----QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
              AVL     +   +  TP Y +PE++ + +      + DIW++G+ LY LL    PF+
Sbjct: 226 ---AVLANDRERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ 281

Query: 271 L----TGQFAILHSKYEFPKNNYSSKLINLII-IMLAENPNLRPNIYQVL 315
                T    I    + +PK+   S+    +I  +L+ NP  RP+I +++
Sbjct: 282 AKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIM 331

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 110/239 (46%), Gaps = 28/239 (11%)

Query: 82  LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLL 141
           L   E+ + +++ E++ +  L+  PNI +YY S          G  + ++ME C   SL 
Sbjct: 49  LDSSEDEVEDVQREIQFLASLKQIPNITRYYGSY-------LRGTSLWIIMEYCAGGSLR 101

Query: 142 DYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
             +      K+ EK I  IM ++  A+  +H     ++HRDIK  NVL+  +   KLCDF
Sbjct: 102 SLLR---PGKIDEKYIGVIMRELLVALKVIHK--DNVIHRDIKAANVLITNEGQVKLCDF 156

Query: 202 GSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYK 261
           G  +         Q +A          TP + +PE+I     +  D K DIW+LGI  Y+
Sbjct: 157 GVAAQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 205

Query: 262 LLFFTTPF----ELTGQFAILHSK-YEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
           +     P+     L     I+ SK     + NY+ +L   I + L E+P  R +  ++L
Sbjct: 206 IATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEELL 264

>Kwal_56.22476
          Length = 697

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 136/290 (46%), Gaps = 58/290 (20%)

Query: 40  YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVM 99
           ++ EGGFA+ + +K                 ++     + ++ ++ E    ++ +E+++ 
Sbjct: 84  FLGEGGFARCFQIK-------------DDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIH 130

Query: 100 KQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTEK 155
           K ++   NIVQ+ D            FE    V +L+E+CPN SL+D + +R    LTE 
Sbjct: 131 KSMRHT-NIVQFVDC-----------FEDDTNVYILLEICPNGSLMDLLKRR--KMLTEP 176

Query: 156 EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ 215
           E+      +  AV  MH     ++HRD+K+ N+  D   N K+ DFG             
Sbjct: 177 EVRFFTTQIVGAVKYMH--SRRVIHRDLKLGNIFFDKHYNLKVGDFGLA----------- 223

Query: 216 DIAVLT----QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
             AVL     +   V  TP Y +PE++   +      + DIW+ G+ +Y LL    PF+ 
Sbjct: 224 --AVLANDRERKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ- 279

Query: 272 TGQFAILHSK-----YEFPKNNY-SSKLINLIIIMLAENPNLRPNIYQVL 315
             +  I++ +     + FPK+ + S + + LI  +L+ +P  RP++ +++
Sbjct: 280 AKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEII 329

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 136/289 (47%), Gaps = 56/289 (19%)

Query: 40  YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVL---VQDENGLNEMRNEV 96
           ++ EGGFA+ + +K                   G++   K V    ++ E    ++ +E+
Sbjct: 87  FLGEGGFARCFQIK----------------DDSGEIFAAKTVAKASIKSEKTRKKLLSEI 130

Query: 97  EVMKQLQGAPNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKL 152
           ++ K +   PNIVQ+ D            FE    V +L+E+CPN SL++ + +R    L
Sbjct: 131 QIHKSM-SHPNIVQFIDC-----------FEDDSNVYILLEICPNGSLMELLKRRKV--L 176

Query: 153 TEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVT 212
           TE E+      +  A+  MH     ++HRD+K+ N+  D+  N K+ DFG  +       
Sbjct: 177 TEPEVRFFTTQICGAIKYMH--SRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAV------ 228

Query: 213 THQDIAVLTQNIY-VHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
               +A  ++  Y +  TP Y +PE++ + +      + DIW+LG+ LY LL    PF+ 
Sbjct: 229 ----LANESERKYTICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQA 283

Query: 272 ----TGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQVL 315
               T    I    + FP++   S +   LI  +L+ +P  RP++ +++
Sbjct: 284 RDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332

>Kwal_55.21545
          Length = 865

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 118/247 (47%), Gaps = 30/247 (12%)

Query: 76  ACLKRVLVQD--ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
            C  +VL  D  ++ + +++ E++ +  L+  PNI  YY S  +         ++ ++ME
Sbjct: 44  VCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHYYGSYLNDT-------KLWVIME 96

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193
            C   SL   +      K+ E+ I  IM ++  A+  MH     ++HRDIK  NVL+   
Sbjct: 97  YCAGGSLRTLLR---PGKIGEQYIGVIMRELLTAL--MHIHKDGVIHRDIKAANVLITND 151

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253
            + KLCDFG  +         Q +A          TP + +PE+I     +  D K DIW
Sbjct: 152 GHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIW 200

Query: 254 ALGIFLYKLLFFTTPF-ELTGQFAI-LHSKYEFPK---NNYSSKLINLIIIMLAENPNLR 308
           +LGI  Y++     P+ E+    A+ L +K + P+     +SS L  +I + L E+P  R
Sbjct: 201 SLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKER 260

Query: 309 PNIYQVL 315
           P+   +L
Sbjct: 261 PSAEDLL 267

>Kwal_56.24274
          Length = 346

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 85/346 (24%), Positives = 143/346 (41%), Gaps = 66/346 (19%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLK--RVLVQD 85
           V++   K  I K + EGG + +Y V+  E                G++  LK  R     
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLVESKE----------------GELFALKKTRCPFGS 62

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
              ++    EV   ++   +P I Q  DS   +  +G     V +L+      SL D +N
Sbjct: 63  IGSISPAMKEVANYQRFS-SPYIAQIVDSQVVQEKDG--SKTVYVLLPYFAKGSLQDLIN 119

Query: 146 QRL--ATKLTEKEILKIMY------------------DVTYAVSQMHYLPTPLL------ 179
           + L   T+++E +IL++                    DV Y++    Y     L      
Sbjct: 120 RHLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLEL 179

Query: 180 -----------HRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT 228
                      HRD+K  N+++  ++   + D GS S     + + Q +    +    + 
Sbjct: 180 DTFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNC 239

Query: 229 TPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQ-------FAILHSK 281
           T  Y +PE++D+     I EK DIW+ G  +Y + F  +PFE   Q       +AI   K
Sbjct: 240 TLSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGK 299

Query: 282 YEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQVLHNICSISGMKV 326
           Y  P+  +YSS LI LI   L+ NP  RP++ +++  +  + G  V
Sbjct: 300 YTVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQGQCV 345

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/363 (25%), Positives = 149/363 (41%), Gaps = 83/363 (22%)

Query: 26  TQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQD 85
           + V +      I + + EGGF+ +Y V+        ENN         D+  LK++    
Sbjct: 19  SSVLINGQHYAIQRLLGEGGFSFVYLVQ------SRENN---------DLFALKKIHCPF 63

Query: 86  EN--GLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDY 143
            N   ++E   EV   K+ + +P I     S   +  +G     V +L+   P  SLLD 
Sbjct: 64  GNIESVSEAMREVNSYKKFR-SPYITHCVSSQVLQEQDGSK--TVFILLPYFPTGSLLDK 120

Query: 144 MNQRL--ATKLTEKEI----------LKIMY----------DVTYAVSQMHYLPTPLL-- 179
           +N  L   T ++E+EI          L+ M+          D T   + + Y  T  +  
Sbjct: 121 INTHLLDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTY 180

Query: 180 -------------------------------HRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
                                          H+DIK  N++  +     +CD GS S   
Sbjct: 181 NEDLRLLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAH 240

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
             +++   +    +    H T  +RSPE++++     IDEK DIW+LG  LY + F  +P
Sbjct: 241 VDISSRSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISP 300

Query: 269 FE----LTGQ---FAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNICS 320
           FE    L+G    +AI   K+  P N NYS +LI +I   +  +   RP+I ++L  +  
Sbjct: 301 FEREEQLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQD 360

Query: 321 ISG 323
           + G
Sbjct: 361 LQG 363

>Scas_580.6
          Length = 1015

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 110/232 (47%), Gaps = 28/232 (12%)

Query: 82  LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLL 141
           L  DE+ + +++ EV+ +  L+  PNI +YY S             + ++ME C   SL 
Sbjct: 70  LDSDEDEVEDVQREVQFLSSLKQIPNITRYYGSY-------LKDTSLWIIMEYCAGGSLR 122

Query: 142 DYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
             +      K+ EK I  IM ++  A+  +H     ++HRDIK  NVL+  + + KLCDF
Sbjct: 123 SLLR---PGKIDEKYIGVIMRELLVALKYIHK--DNVIHRDIKAANVLITNEGSVKLCDF 177

Query: 202 GSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYK 261
           G  +         Q +A          TP + +PE+I     +  D K DIW+LGI  Y+
Sbjct: 178 GVAAQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 226

Query: 262 LLFFTTPF-ELTGQFAI-LHSKYEFPK---NNYSSKLINLIIIMLAENPNLR 308
           +     P+ E+    A+ L +K + P+    +Y+  L   I + L E+P  R
Sbjct: 227 IATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 111/245 (45%), Gaps = 29/245 (11%)

Query: 70  LQMGDVACLKRV-LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEV 128
           ++ G V  +K + L  D + + +++ E++ +  L+   NI +YY S             +
Sbjct: 43  VKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSY-------LKDTSL 95

Query: 129 LLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENV 188
            ++ME C   SL   +      K+ EK I  IM ++  A+  +H     ++HRDIK  NV
Sbjct: 96  WIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHK--DNVIHRDIKAANV 150

Query: 189 LVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE 248
           L+  + N KLCDFG  +         Q +A          TP + +PE+I     +  D 
Sbjct: 151 LITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDT 199

Query: 249 KSDIWALGIFLYKLLFFTTPF----ELTGQFAILHSK-YEFPKNNYSSKLINLIIIMLAE 303
           K DIW+LGI  Y++     P+     L     I+ SK       +YS+ L   I + L E
Sbjct: 200 KVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDE 259

Query: 304 NPNLR 308
           +P  R
Sbjct: 260 DPKER 264

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 104/229 (45%), Gaps = 28/229 (12%)

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           E+ + ++R E++ +  L+  PNI  YY S            ++ ++ME C   SL   + 
Sbjct: 53  EDEVEDIRKEIQFLSSLKQTPNITHYYGSY-------LIDTKLWVIMEYCAGGSLRTLLR 105

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
             +   + EK I  IM ++  A+  +H     ++HRDIK  N+L+    + KLCDFG  +
Sbjct: 106 PGI---IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFGVAA 160

Query: 206 TKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFF 265
                +   Q +A          TP + +PE+I     +  D K DIW+LGI  Y++   
Sbjct: 161 QLSQSMLKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATG 209

Query: 266 TTPFELTGQFAILH--SKYEFPK---NNYSSKLINLIIIMLAENPNLRP 309
             P+        +   +K + P+     YS  L   I + L E+P  RP
Sbjct: 210 NPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 104/238 (43%), Gaps = 43/238 (18%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLN---EM 92
           EI K + +G F ++Y V+ IE                G V  LK +  +D    N   + 
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIE---------------SGFVCALKAMEKKDIIQYNIEKQF 154

Query: 93  RNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKL 152
           R EVE+   L+  PN+ Q Y      +        V LLME   N  L  ++  R  +  
Sbjct: 155 RREVEIQSSLR-HPNLTQLYGYFHDEK-------RVYLLMEYLVNGELYKHLKGR--SHF 204

Query: 153 TEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVT 212
            +      +Y +  A+  MH     +LHRDIK EN+++   N  KL DFG  S   P  +
Sbjct: 205 NDVVASYYVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG-WSVITPKGS 261

Query: 213 THQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
             + +           T  Y SPE+I   R    +EK D+WALG+  Y+LL  + PFE
Sbjct: 262 KRKTLC---------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFE 307

>Kwal_33.13112
          Length = 505

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 133/297 (44%), Gaps = 42/297 (14%)

Query: 24  PGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV-L 82
           P T V   +   +I + + +G F  +Y              R   K + G++  +K + L
Sbjct: 25  PDTAVEKPSQLYDIKECVGKGSFGDVY--------------RAIDK-ETGEMVAVKIINL 69

Query: 83  VQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLD 142
            + ++ ++ +  E+  + +L+ AP +  YY +             + ++ME C   S  D
Sbjct: 70  EETQDDIDVLAQEIYFLSELR-APFVTTYYKTYVE-------DVSMWIVMEFCGGGSCAD 121

Query: 143 YMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
            +      +L E ++  I+ +V Y +  +H      +HRD+K  N+L+  +   KL DFG
Sbjct: 122 LLKHLPEHRLPENKVAYIIREVLYGLEYLH--SQRKIHRDVKAANILLTDEGEVKLGDFG 179

Query: 203 STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
            +          Q +A L +N +V  TP + +PE+I   R    DEK+DIW+LGI   +L
Sbjct: 180 VSG---------QIMATLKRNTFV-GTPYWMAPEIIA--RDNGYDEKADIWSLGITAMEL 227

Query: 263 LFFTTPFELTGQFAILHS----KYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
           L    P+       +L +    K    +  ++S   + I + L ++P LRP    +L
Sbjct: 228 LTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 92/196 (46%), Gaps = 24/196 (12%)

Query: 128 VLLLMELCPNKSLLDYM--NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKI 185
           V + +E CP   L DY+   QR+    T +   +I+  V YA    H L    +HRD+K+
Sbjct: 103 VWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYA----HSLQ--CVHRDLKL 156

Query: 186 ENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLP 245
           EN+L+D      L DFG T          ++ A  TQ   V  T  Y +PE+I   R   
Sbjct: 157 ENILLDKNGYAMLTDFGFT----------RECATKTQLETVCGTTVYMAPELIK--REAY 204

Query: 246 IDEKSDIWALGIFLYKLLFFTTPFE----LTGQFAILHSKYEFPKNNYSSKLINLIIIML 301
              K D W+LGI LY +L    PF+    +     I+H +        S +  +LI+ +L
Sbjct: 205 DGYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 302 AENPNLRPNIYQVLHN 317
            +N   RPN+ +VL +
Sbjct: 265 DKNAAQRPNLNEVLQH 280

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 109/224 (48%), Gaps = 44/224 (19%)

Query: 106 PNIVQYYDSNASRRHNGFPGFE----VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIM 161
           PNIVQ+ D            FE    V +L+E+CPN SL+D + +R    LTE E+    
Sbjct: 4   PNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFT 50

Query: 162 YDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLT 221
             +  A+  MH     ++HRD+K+ N+  D+  N K+ DFG               AVL 
Sbjct: 51  TQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLA 95

Query: 222 ----QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAI 277
               +   V  TP Y +PE++         E  DIW++G+ +Y LL    PF+   +  I
Sbjct: 96  NDRERKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNI 153

Query: 278 LHSK-----YEFPKNNYSSK-LINLIIIMLAENPNLRPNIYQVL 315
           ++ +     Y FP+   +SK ++ LI  +L+ +P  RP++ +++
Sbjct: 154 IYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIM 197

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 113/235 (48%), Gaps = 28/235 (11%)

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           E+ + +++ E++ +  L+  PNI +YY S            ++ ++ME C   SL   + 
Sbjct: 62  EDEVEDVQKEIQFLASLKQVPNITRYYGSY-------LYDTKLWVIMEYCAGGSLRTLLR 114

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
                K+ EK +  I+  +  A+  +H     ++HRDIK  NVL+  + + KLCDFG  +
Sbjct: 115 ---PGKIDEKYLGVIVRKLLIALVYIHK--DNVIHRDIKAANVLITNEGHVKLCDFGVAA 169

Query: 206 TKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFF 265
                    Q  A   +   +  TP + +PE+I     +  + K+DIW+LGI  Y++   
Sbjct: 170 ---------QLTAANHKRQTMAGTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATG 218

Query: 266 TTPF-ELTGQFAI-LHSKYEFPK---NNYSSKLINLIIIMLAENPNLRPNIYQVL 315
             P+ ++    A+ L +K + P+    NYS  L   I + L E+P  RP    +L
Sbjct: 219 NPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLL 273

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 128/289 (44%), Gaps = 53/289 (18%)

Query: 65  RMKPKLQMGDVACLK----RVLVQDENGLNEMRNEVE---VMKQLQGAPNIVQYYDSNAS 117
           R+   +Q G +A +K    R +  ++  +  +   +E   ++ +L   PNI+  Y+   +
Sbjct: 76  RLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKLITHPNIMALYEVWEN 135

Query: 118 RRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTP 177
           +        E+ L++E      L DY+  R   KL E+E +     +   VS  H     
Sbjct: 136 KS-------ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN-- 184

Query: 178 LLHRDIKIENVLVDAQN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYR 233
           + HRD+K EN+L+D +N   K+ DFG               A+ T N  + T   +P Y 
Sbjct: 185 ICHRDLKPENLLLDKKNKTVKIADFGMA-------------ALETTNRLLETSCGSPHYA 231

Query: 234 SPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAIL----HSKYEFPKN 287
           SPE++    Y   P    SD+W+ GI L+ LL    PF       +L    H +Y+ P +
Sbjct: 232 SPEIVMGQKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP-S 286

Query: 288 NYSSKLINLIIIMLAENPNLRPNIYQVLHNICSI-------SGMKVPIE 329
           N S +  +LI  +L  +P  R  + ++L +   +        G+  P+E
Sbjct: 287 NVSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLE 335

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 145/306 (47%), Gaps = 56/306 (18%)

Query: 24  PGTQVAVGAH--KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV 81
           P + +A GAH    +I+K + EG F ++        L        K  L++ +    K+V
Sbjct: 42  PKSSLADGAHIGNYQIVKTLGEGSFGKVK-------LAYHTTTGQKVALKIIN----KKV 90

Query: 82  LVQ-DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSL 140
           L + D  G   +  E+  ++ L+  P+I++ YD   S+        E+++++E   N+ L
Sbjct: 91  LAKSDMQG--RIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-L 139

Query: 141 LDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCD 200
            DY+ QR   K++E+E  +    +  AV   H     ++HRD+K EN+L+D   N K+ D
Sbjct: 140 FDYIVQR--DKMSEQEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIAD 195

Query: 201 FGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMID--LYRCLPIDEKSDIWAL 255
           FG ++             ++T   ++ T   +P Y +PE+I   LY    +    D+W+ 
Sbjct: 196 FGLSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSC 238

Query: 256 GIFLYKLLFFTTPFE---LTGQFA-ILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNI 311
           G+ LY +L    PF+   +   F  I +  Y  PK   S     LI  ML  NP  R +I
Sbjct: 239 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK-FLSPGAAGLIKRMLIVNPLNRISI 297

Query: 312 YQVLHN 317
           ++++ +
Sbjct: 298 HEIMQD 303

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/353 (23%), Positives = 146/353 (41%), Gaps = 75/353 (21%)

Query: 11  NNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKL 70
           ++ T++ N++RY              I + + EGG + +Y V+  +     +N    P+L
Sbjct: 19  SDATIRVNDKRY-------------RIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPEL 65

Query: 71  QMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLL 130
                  LK+++      ++    E+E  K+ Q +P +++  DS   +  +G     + +
Sbjct: 66  YA-----LKKIICPSVESISNGMREIENYKRFQ-SPYVIKSIDSQVMQEKDGSK--TIYI 117

Query: 131 LMELCPNKSLLDYMNQRL--ATKLTEKEILKIMYDVTYAVSQMH---------------- 172
           ++      SL D +N+RL   T ++E E ++IM  VT  +  +H                
Sbjct: 118 VLPYYSLGSLQDSINRRLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVD 177

Query: 173 -------------YLPTPL---------------LHRDIKIENVLVDAQNNFKLCDFGST 204
                           TPL                HRDI   N+L  +     + D GS 
Sbjct: 178 AVSMTYSDETAMLLEDTPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSC 237

Query: 205 STKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 264
           S     +     ++ L + +  + T  Y  PE+++L     +  K DIW+LG   Y L+F
Sbjct: 238 SQADITIENRHQLSELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMF 297

Query: 265 FTTPFELTGQ-------FAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRP 309
             +PFE   Q       +AI   KY FP+N+ +S  L+++I   +  +P  RP
Sbjct: 298 GISPFEREEQIHGASLTYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Scas_458.1
          Length = 367

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 146/352 (41%), Gaps = 67/352 (19%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLV--QD 85
           +++ A   +I K + +   +  Y V+ ++    FEN         G +  LKR+     D
Sbjct: 23  ISINARDYKIEKLLQDENLSYSYLVRTLDSEPPFEN---------GPLFVLKRIYCPFGD 73

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
              ++   NE+   K+  G  +I+   D    ++++G    +VL         S+ D +N
Sbjct: 74  IESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSKQIDVLF--PFYHYGSVQDDIN 131

Query: 146 QRL-------ATKLTEKEILKIMYDVTYAVSQMH-----------------YLP-TPLLH 180
           + L        T + EK+ +KIM  +   +  +H                 Y    PLL 
Sbjct: 132 RHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLL 191

Query: 181 RDIKIEN--------------------VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVL 220
            D+ +E                     +L+  Q N  + D  S       ++T   +   
Sbjct: 192 NDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRF 251

Query: 221 TQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE----LTG--- 273
            Q I  H T Q+ +PE++ L     I  K DIW+LG  LY ++F  +PFE    L G   
Sbjct: 252 QQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVV 311

Query: 274 QFAILHSKYEFP--KNNYSSKLINLIIIMLAENPNLRPNIYQVLHNICSISG 323
           ++ I   KY  P  K  YS ++I+++   L  +P+ RP++  +L+N+  I G
Sbjct: 312 KYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQG 363

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 130/302 (43%), Gaps = 50/302 (16%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDE- 86
           + VG    E I+ + +G   +++ V+      E + NR         V  LK VL +DE 
Sbjct: 489 IMVGPQSFEKIRLLGQGDVGKVFLVR------EKKTNR---------VYALK-VLSKDEM 532

Query: 87  ---NGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDY 143
              N +  +  E E++      P IV  Y S  S  +       + L ME C        
Sbjct: 533 IKRNKIKRVLTEQEILA-TSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFFRA 584

Query: 144 MNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG- 202
           +  R    + E +      +VT A+  +H L    ++RD+K EN+L+    +  L DF  
Sbjct: 585 LQTRKTKCICEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDL 642

Query: 203 ---STSTKFPMV-----TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKSD 251
              +  +K P+V     +T  D  + +     ++   T +Y +PE+I   R        D
Sbjct: 643 SIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVD 699

Query: 252 IWALGIFLYKLLFFTTPFE---LTGQFA-ILHSKYEFPKNNYSSKLI-NLIIIMLAENPN 306
            W LGI +Y++LF  TPF+       F  IL ++  FP NN  S+   +LI  +L +N +
Sbjct: 700 WWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNES 759

Query: 307 LR 308
            R
Sbjct: 760 KR 761

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 85/318 (26%), Positives = 144/318 (45%), Gaps = 66/318 (20%)

Query: 22  YTPGTQVAVGAH------------KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPK 69
           YT G  +  G H            K ++IK + EG F +   VK    ++  +   +K  
Sbjct: 14  YTGGRNMPHGMHRPGSIPIGQRIGKYQVIKTLGEGSFGK---VKLAHHVSTGQKVALK-- 68

Query: 70  LQMGDVACLKRVLVQ-DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEV 128
                    K+VL + D  G   +  E+  ++ L+  P+I++ YD   S+        E+
Sbjct: 69  ------IINKKVLAKSDMQG--RIEREISYLRLLR-HPHIIKLYDVIKSKD-------EI 112

Query: 129 LLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENV 188
           ++++E   N+ L DY+ QR   K++E E  +    +  AV   H     ++HRD+K EN+
Sbjct: 113 IMVIEYAGNE-LFDYIVQR--DKMSENEARRFFQQIISAVEYCHR--HKIVHRDLKPENL 167

Query: 189 LVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMID--LYRC 243
           L+D   N K+ DFG ++             ++T   ++ T   +P Y +PE+I   LY  
Sbjct: 168 LLDEHLNVKIADFGLSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAG 214

Query: 244 LPIDEKSDIWALGIFLYKLLFFTTPFE---LTGQFA-ILHSKYEFPKNNYSSKLINLIII 299
             +    D+W+ G+ LY +L    PF+   +   F  I +  Y  PK   S    NLI  
Sbjct: 215 PEV----DVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPK-FLSQGAANLIKR 269

Query: 300 MLAENPNLRPNIYQVLHN 317
           ML  NP  R  I++++ +
Sbjct: 270 MLIVNPLNRITIHEIMED 287

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/356 (25%), Positives = 145/356 (40%), Gaps = 67/356 (18%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKP-----KLQMGDVACLKRVL 82
           + VG    E I+ + +G   ++Y VK      E   NR+       K +M     +KR+L
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVK------EKRTNRLYALKIFSKSEMIKRKKIKRIL 543

Query: 83  VQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLD 142
            + E            +      P +V  Y S  S  +       + L ME C       
Sbjct: 544 AEQE------------ILATSNHPFVVTLYHSFQSEDY-------LYLCMEYCMGGEFFR 584

Query: 143 YMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
            +  R +  ++E++      +VT A+  +H L    ++RD+K EN+L+    +  L DF 
Sbjct: 585 ALQTRKSKCISEEDAKFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFD 642

Query: 203 ----STSTKFPMV-----TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKS 250
               +   K P+V     +T  D  + +     ++   T +Y +PE+I   R        
Sbjct: 643 LSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAV 699

Query: 251 DIWALGIFLYKLLFFTTPF--ELTGQ-FA-ILHSKYEFPKNNYSSK----LINLIII--- 299
           D W LGI +Y++LF  TPF  E T + F+ IL     FP NN  S+    LI  ++I   
Sbjct: 700 DWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNE 759

Query: 300 -------MLAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNK 348
                  M A +    P   +V  N   +   + P+     E  YDF K +  +NK
Sbjct: 760 SKRLGSKMGAADIKKHPFFKKV--NWTLLRNQEPPLIPVLTENGYDFTKLSSNKNK 813

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 139/306 (45%), Gaps = 60/306 (19%)

Query: 26  TQVAVGAH--KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV-- 81
           T  A G H  K +IIK + EG F ++               ++   +  G    LK +  
Sbjct: 24  TNHAQGQHIGKYQIIKTLGEGSFGKV---------------KLAYHISTGQKVALKIINK 68

Query: 82  -LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSL 140
            ++   +    +  E+  ++ L+  P+I++ YD   S+        E+++++E   N+ L
Sbjct: 69  KVLAKSDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-L 119

Query: 141 LDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCD 200
            DY+ QR   K+ E+E  +    +  AV   H     ++HRD+K EN+L+D   N K+ D
Sbjct: 120 FDYIVQR--DKMPEQEARRFFQQIISAVDYCHR--HKIVHRDLKPENLLLDEHLNVKIAD 175

Query: 201 FGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMID--LYRCLPIDEKSDIWAL 255
           FG ++             ++T   ++ T   +P Y +PE+I   LY    +    D+W+ 
Sbjct: 176 FGLSN-------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSS 218

Query: 256 GIFLYKLLFFTTPFE---LTGQFA-ILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNI 311
           G+ LY +L    PF+   +   F  I +  Y  P N  S    +LI  ML  NP  R  +
Sbjct: 219 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTIP-NFLSQGAASLIKKMLIVNPVNRITV 277

Query: 312 YQVLHN 317
           ++++ +
Sbjct: 278 HEIMQD 283

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 136/309 (44%), Gaps = 40/309 (12%)

Query: 30  VGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGL 89
           +   + ++++ + +G F  +Y   ++    E  + ++   + +  + C+   L      +
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLA-IKCIN--LEHSNEPI 58

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPG-FEVLLLMELCPNKSLLDYMNQRL 148
           + +  E+  +  L   P I  YY +        F G   + ++ME C N SLL+ +  R 
Sbjct: 59  DLLLKEIYFLSTLH-CPYITHYYGT--------FTGDCNLYIVMEYCSNGSLLNLL--RY 107

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
            ++LTE+    I+  V +A+  +H     L+HRD+K  N+L++     +L D G T    
Sbjct: 108 YSRLTEQTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLGVTGQLK 165

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
              T H    +   N +V  TP + +PE+I   +    D K DIW+LGI   +LL    P
Sbjct: 166 FNSTRHGGKNL---NTFV-GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPP 218

Query: 269 FELTGQFAILHSKYEFPKNNYSSKLINL---------IIIMLAENPNLRPNIYQVLHN-- 317
                    + +    PK N  S L N+         I   L ++PN RP   Q+L +  
Sbjct: 219 M---SHLDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQHKW 275

Query: 318 --ICSISGM 324
              CSI+ +
Sbjct: 276 LKKCSITNI 284

>Kwal_47.18233
          Length = 598

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 135/296 (45%), Gaps = 58/296 (19%)

Query: 34  KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV---LVQDENGLN 90
           K +IIK + EG F ++               ++   +  G    LK +   ++   +   
Sbjct: 30  KYQIIKTLGEGSFGKV---------------KLAYHVTTGQKVALKIINKKVLAKSDMQG 74

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
            +  E+  ++ L+  P+I++ YD   S+        E+++++E   N+ L DY+ QR   
Sbjct: 75  RIEREISYLRLLR-HPHIIKLYDVVKSKD-------EIVMVIEYAGNE-LFDYIVQR--D 123

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
           K++E E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG ++     
Sbjct: 124 KMSENEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIADFGLSN----- 176

Query: 211 VTTHQDIAVLTQNIYVHT---TPQYRSPEMID--LYRCLPIDEKSDIWALGIFLYKLLFF 265
                   ++T   ++ T   +P Y +PE+I   LY    +    D+W+ G+ LY +L  
Sbjct: 177 --------IMTDGNFLRTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCR 224

Query: 266 TTPFE---LTGQFA-ILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
             PF+   +   F  I +  Y  PK   S    NLI  ML  NP  R  I++++ +
Sbjct: 225 RLPFDDESIPVLFKNISNGIYTLPK-FLSPGAANLIKRMLIVNPLNRITIHEIMQD 279

>Kwal_23.6325
          Length = 1542

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 118/260 (45%), Gaps = 27/260 (10%)

Query: 70   LQMGDVACLKRVLVQDENGLNE----MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPG 125
            L  G++  +K + +QD   + +    ++ E+ V++ L   PN+VQYY     R       
Sbjct: 1269 LDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLN-HPNVVQYYGVEVHRD------ 1321

Query: 126  FEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKI 185
             +V L ME C   SL     Q L     E E++  +Y +       +   + ++HRDIK 
Sbjct: 1322 -KVNLFMEYCEGGSL----AQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKP 1376

Query: 186  ENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYR 242
            EN+L+D     K  DFG+  +     T   ++    +   V++   TP Y SPE I   +
Sbjct: 1377 ENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPESITGAK 1436

Query: 243  CLPIDEKSDIWALGIFLYKLLFFTTP-FELTGQFAILHSKY-----EFP-KNNYSSKLIN 295
                    DIW+LG  + +++    P F L  ++AI++        + P K   S + I+
Sbjct: 1437 KGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSPQGID 1495

Query: 296  LIIIMLAENPNLRPNIYQVL 315
             ++  L ++PN R    ++L
Sbjct: 1496 FLLRCLKQDPNKRSTAMELL 1515

>Scas_707.36
          Length = 915

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 128/291 (43%), Gaps = 48/291 (16%)

Query: 22  YTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGD-VACLKR 80
           Y P ++  +  H  EI+K +  G   ++   K I   N+    +M  + +     A  KR
Sbjct: 81  YDPVSKTQILNH-YEIVKELGNGQHGKVKLAKDIR-ANQLVAIKMVNRYEKKTYFAGPKR 138

Query: 81  VLVQDENGLNEMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNK 138
                 N  N+++ E+ +MK+   +    +++  D  +SR+        + L++E C   
Sbjct: 139 ------NDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRK--------IYLVLEYCEKG 184

Query: 139 SLLDY------MNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192
            +L        ++ R   +L+ +   +I  DV   +  +H     ++HRDIK  N+L+D 
Sbjct: 185 PILWCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDK 242

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI-------------- 238
               K+ DFG +      + T+ D   LT+ +    TP + +PE+               
Sbjct: 243 NGVVKISDFGVSLAANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKD 299

Query: 239 DLYRCLPIDEKSDIWALGIFLYKLLF----FTTPFELTGQFAILHSKYEFP 285
           +L+    I  K DIWALGI LY LLF    F + FEL     I++ K  FP
Sbjct: 300 ELFNGSCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP 350

>Scas_660.28
          Length = 623

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 139/308 (45%), Gaps = 60/308 (19%)

Query: 31  GAH--KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV---LVQD 85
           G+H    +I+K + EG F ++               ++   +  G    LK +   ++  
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKV---------------KLAYHMTTGQKVALKIINKKVLAK 84

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
            +    +  E+  ++ L+  P+I++ YD   S+        E++++ME   N+ L DY+ 
Sbjct: 85  SDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVMEYAGNE-LFDYIV 135

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
           QR   K++E E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG ++
Sbjct: 136 QR--DKMSEDEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIADFGLSN 191

Query: 206 TKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMID--LYRCLPIDEKSDIWALGIFLY 260
                        ++T   ++ T   +P Y +PE+I   LY    +    D+W+ G+ LY
Sbjct: 192 -------------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILY 234

Query: 261 KLLFFTTPFE---LTGQFA-ILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316
            +L    PF+   +   F  I +  Y  PK   S     LI  ML  NP  R +I +++ 
Sbjct: 235 VMLCRRLPFDDESIPVLFKNINNGVYTIPK-FLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

Query: 317 NICSISGM 324
           +    +G+
Sbjct: 294 DEWFKAGL 301

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 108/234 (46%), Gaps = 33/234 (14%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN+++ YD   + +       ++ +++E      L + + QR    
Sbjct: 75  IEREIIIMKLL-NHPNVLRLYDVWETAQ-------DLYMVLEYVEKGELFNLLVQR--GP 124

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L E E ++    +   +S  H L   ++HRD+K EN+L+D + N KL DFG       M 
Sbjct: 125 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFG-------MA 175

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTTPF- 269
                  +L  +     +P Y +PE++     LP    +SD+W+ G+ LY LL    PF 
Sbjct: 176 ALESKDKLLETSC---GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 229

Query: 270 ELTGQ-----FAILHSKYEFP-KNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
           E  G        +   KYE P ++  S +  +LI+ +L   P  R    ++L +
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283

>Scas_629.16
          Length = 918

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 124/299 (41%), Gaps = 52/299 (17%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKP-----KLQMGDVACLKRVL 82
           + VG    E IK + +G   ++Y V+      E + NR+       K +M     +KR+L
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVR------EKKTNRLYALKIFSKSEMIKRKKIKRIL 565

Query: 83  VQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLD 142
            + E            +      P +V  Y S  S  +       +   ME C       
Sbjct: 566 AEQE------------ILATSNHPFVVTLYHSFQSEDY-------LYFCMEYCMGGEFFR 606

Query: 143 YMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
            +  R    ++E +      +VT A+  +H L    ++RD+K EN+L+    +  L DF 
Sbjct: 607 ALQTRRTKCISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFD 664

Query: 203 ----STSTKFPMV-----TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKS 250
               +   K P++     +T  D  + +     ++   T +Y +PE+I   R        
Sbjct: 665 LSVQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAV 721

Query: 251 DIWALGIFLYKLLFFTTPFELTGQ---FA-ILHSKYEFPKNN-YSSKLINLIIIMLAEN 304
           D W LGI +Y++LF  TPF+ +     F+ IL +   FP NN  S    +LI  +L +N
Sbjct: 722 DWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKN 780

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 138/296 (46%), Gaps = 62/296 (20%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLK----RVLVQ-DENGLN 90
           +I+K + EG F ++               ++   +  G    LK    +VL + D  G  
Sbjct: 40  QIVKTLGEGSFGKV---------------KLAYHVTTGQKVALKIINKKVLAKSDMQG-- 82

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
            +  E+  ++ L+  P+I++ YD   S+        E+++++E   N+ L DY+ QR   
Sbjct: 83  RIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--N 131

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
           K++E+E  +    +  AV   H     ++HRD+K EN+L+D   N K+ DFG ++     
Sbjct: 132 KMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN----- 184

Query: 211 VTTHQDIAVLTQNIYVHT---TPQYRSPEMID--LYRCLPIDEKSDIWALGIFLYKLLFF 265
                   ++T   ++ T   +P Y +PE+I   LY    +    D+W+ G+ LY +L  
Sbjct: 185 --------IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCR 232

Query: 266 TTPFE---LTGQFA-ILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
             PF+   +   F  I +  Y  PK   S    +LI  ML  NP  R +I++++ +
Sbjct: 233 RLPFDDESIPVLFKNISNGVYTLPK-FLSPGASDLIKRMLIVNPLNRISIHEIMQD 287

>Kwal_26.7788
          Length = 1267

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 118/264 (44%), Gaps = 42/264 (15%)

Query: 65  RMKPKLQMGDVACLKRVLVQDENGLNEMRNEVE---VMKQLQGAPNIVQYYDSNASRRHN 121
           R+   ++ G +A +K V     +    +   +E   ++ +L   PN++  Y+   ++   
Sbjct: 73  RLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMGLYEVWENK--- 129

Query: 122 GFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHR 181
                E+ L++E      L DY+  R   +L EKE +     +    +  H     + HR
Sbjct: 130 ----LELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHR 181

Query: 182 DIKIENVLVDAQNN-FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEM 237
           D+K EN+L+D +N   K+ DFG               A+ T N  + T   +P Y SPE+
Sbjct: 182 DLKPENLLLDKKNKRIKIADFGMA-------------ALQTSNKLLETSCGSPHYASPEI 228

Query: 238 I--DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAIL----HSKYEFPKNNYSS 291
           +    Y   P    SD+W+ GI L+ LL    PF       +L      KY+ P+ + SS
Sbjct: 229 VMGKNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ-SVSS 283

Query: 292 KLINLIIIMLAENPNLRPNIYQVL 315
              +LI  +L  +P+ R +I ++L
Sbjct: 284 GAQDLISRILVVDPDKRISINEIL 307

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 98/215 (45%), Gaps = 36/215 (16%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           +L E      LLDY+ Q     L E+   K    +  A+  +H     ++HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLHL--NNIVHRDLKIENIM 212

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 249
           + +    ++ DFG ++   P    H        ++Y      + +PE++  +       +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDPKKQLH----TFCGSLY------FAAPELLKAHPY--TGPE 260

Query: 250 SDIWALGIFLYKLLFFTTPFELTGQFAILH-----SKYEFPKNNYSSKLINLIIIMLAEN 304
            DIW+ G+ LY L+    PF+     ++LH      K E+P+ + S  +I+L+  ML  +
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQ-HLSIDVISLLSKMLVVD 318

Query: 305 PNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDF 339
           P  R  + QV+H+             Q+ +  YDF
Sbjct: 319 PYKRATLKQVVHH-------------QWMQKGYDF 340

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 109/236 (46%), Gaps = 36/236 (15%)

Query: 87  NGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQ 146
           N   + R EVE+   L+  PN+ Q Y          +    V LLME   N  L  Y + 
Sbjct: 180 NVQKQFRREVEIQASLRH-PNLTQLYGY-------FYDDKRVYLLMEYLVNGEL--YRHL 229

Query: 147 RLATKLTEKEILKIMY--DVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGST 204
           R+     +  IL   Y   +  A++ MH     +LHRDIK EN+L+  QN  KL DFG +
Sbjct: 230 RVNGPFND--ILASYYVNQMADALNYMH--DRNVLHRDIKPENILIGFQNTLKLTDFGWS 285

Query: 205 STKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 264
                + TT      L        T  Y SPE++  YR    DEK D+WALG+  Y+LL 
Sbjct: 286 V----ISTTGAKRKTLC------GTLDYLSPELVK-YR--EYDEKVDVWALGVLAYELLV 332

Query: 265 FTTPF-----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
            T PF     ELT +  I+     FP +  S    +LI  +L  +P+ R ++  VL
Sbjct: 333 GTPPFEEASKELTYK-RIVRRDLRFP-DQMSIDARDLIGRLLENDPSTRISLKDVL 386

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 108/232 (46%), Gaps = 33/232 (14%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN+++ YD   + +       ++ +++E      L + + +R    
Sbjct: 73  IEREIIIMKLL-NHPNVLRLYDVWETSK-------DLYMVLEYVEKGELFNLLVER--GP 122

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L E E ++    +   +S  H L   ++HRD+K EN+L+D + N KL DFG       M 
Sbjct: 123 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFG-------MA 173

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTTPF- 269
                  +L  +     +P Y +PE++     LP    +SD+W+ G+ LY LL    PF 
Sbjct: 174 ALESKDKLLETSC---GSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 227

Query: 270 ELTGQ-----FAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQVL 315
           E  G        +   K+E P ++  SS+  +LI  +L  +P  R    ++L
Sbjct: 228 EEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL 279

>Kwal_56.23717
          Length = 858

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 104/225 (46%), Gaps = 36/225 (16%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           +L E      LLDY+ Q     L E+   K    +  A+  +H     ++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHM--NNIVHRDLKIENIM 65

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 249
           +      K+ DFG ++   P    H        ++Y      + +PE+  L  C     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPKKQLH----TFCGSLY------FAAPEL--LKACPYTGPE 113

Query: 250 SDIWALGIFLYKLLFFTTPFELTGQFAILH-----SKYEFPKNNYSSKLINLIIIMLAEN 304
            D+W+ G+ L+ L+    PF+     ++LH      K E+P+ + S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQ-HLSIEVISLLSKMLVVD 171

Query: 305 PNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKV 349
           P  R ++ QV+++             Q+ +  YDF   ++  ++V
Sbjct: 172 PTKRASLKQVVNH-------------QWMQRGYDFPAPSYIPHRV 203

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 102/233 (43%), Gaps = 28/233 (12%)

Query: 99  MKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEIL 158
           + Q+   PN+ + Y+      H         +  E      LLDY+ Q     L E    
Sbjct: 144 LGQILFHPNVCKLYEMQTLSNH-------YYMFFEFISGGQLLDYIIQH--GSLKENHAR 194

Query: 159 KIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIA 218
           K+   +  A+  +H     ++HRD+KIEN+++      KL DFG ++    M    + + 
Sbjct: 195 KVSRGILSALQYLH--ANNIVHRDLKIENIMLSKTGEIKLIDFGLSN----MYDPRKSLQ 248

Query: 219 VLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAIL 278
               ++Y      + +PE++  +  L    + D+W+ G+ LY L+    PF+     A L
Sbjct: 249 TFCGSLY------FAAPELLKAHPYL--GPEVDVWSFGVVLYVLVCGKVPFDDENSSA-L 299

Query: 279 HSKYEFPKNNY----SSKLINLIIIMLAENPNLRPNIYQVLHNICSISGMKVP 327
           H K +  K  Y    S  +I+L+  +L  +P  R  + QV+++   + G   P
Sbjct: 300 HEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLKGYDFP 352

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 93/192 (48%), Gaps = 15/192 (7%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +  L+E  PN   L  M +R  T L+E+        +  A+  +H     ++HRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM-KRFGT-LSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI-DLYRCLPI 246
           +L+D     KL DFG T+        ++   + T++     T +Y SPE++ D Y    +
Sbjct: 332 ILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY----V 386

Query: 247 DEKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINLIIIMLA 302
           D + DIWA G  L++++    PF+ T ++     ++  +Y F    +   L +LI  +L 
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTA-GFPMILRDLIKQLLV 445

Query: 303 ENPNLRPNIYQV 314
           + P  R  I Q+
Sbjct: 446 KKPEQRLTILQI 457

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 83/190 (43%), Gaps = 40/190 (21%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           EV++  ++    NI + YD            F+  ++ME C    L + +   +  + T 
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKT- 163

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
           K +  I+  +  AV  +H     + HRDIK EN+L+    N KL D+G  +T        
Sbjct: 164 KNVTNIINQILDAVEYVH--SRGIYHRDIKPENILIAGNWNIKLTDWGLATT-------- 213

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMI----------DLYRCLPIDEKSDIWALGIFLYKLLF 264
            D   + +N+    + +Y +PE+           D Y C     K DIWA+GI +  ++F
Sbjct: 214 -DKTSMERNV---GSERYMAPELFESNLDREERTDAYDC----AKVDIWAIGIVMLNIVF 265

Query: 265 FTTPFELTGQ 274
              PF +  Q
Sbjct: 266 HKNPFTVANQ 275

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 130/303 (42%), Gaps = 52/303 (17%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKP-----KLQMGDVACLKRVL 82
           + VG    E I+ + +G   ++Y V+      E + NR+       K +M     +KR+L
Sbjct: 372 ILVGPQSFEKIRLLGQGDVGRVYLVR------EKQTNRLYALKIFSKPEMIKRKKIKRIL 425

Query: 83  VQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLD 142
            + E            +      P IV  Y S  +  +       + L ME C       
Sbjct: 426 TEQE------------ILATSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFR 466

Query: 143 YMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
            +  R    ++E +      +VT A+  +H +    ++RD+K EN+L+    +  L DF 
Sbjct: 467 ALQTRKTKCISEDDARFYSSEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLSDFD 524

Query: 203 ----STSTKFPMV---TTHQ--DIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKS 250
               +  TK P V    +H   D  + +     ++   T +Y +PE+I   R        
Sbjct: 525 LSVQAKDTKNPQVKGNASHSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAV 581

Query: 251 DIWALGIFLYKLLFFTTPFEL--TGQ-FA-ILHSKYEFPKNNYSSKLI-NLIIIMLAENP 305
           D W LGI +Y++LF  TPF+   T Q F+ IL ++   P NN +S+   +LI  +L +N 
Sbjct: 582 DWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLIKNE 641

Query: 306 NLR 308
           N R
Sbjct: 642 NKR 644

>Kwal_56.24091
          Length = 381

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 88/196 (44%), Gaps = 25/196 (12%)

Query: 75  VACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMEL 134
           +  +K+  +   N   + R EVE+   L+  PN+ + Y      +        V LLME 
Sbjct: 151 LKAMKKSEIVQYNVQKQFRREVEIQSSLK-HPNLTRLYGYFHDEK-------RVYLLMEY 202

Query: 135 CPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN 194
             N  L  Y + R      +      ++ +  A++ MH     +LHRDIK EN+L+  QN
Sbjct: 203 LVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENILLGFQN 258

Query: 195 NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWA 254
             KL DFG + +              ++   +  T  Y SPE+I   +    D K D+WA
Sbjct: 259 TLKLTDFGWSVSNVGN----------SKRKTLCGTMDYLSPELI---KSREYDNKVDVWA 305

Query: 255 LGIFLYKLLFFTTPFE 270
           LG+  Y+LL  + PFE
Sbjct: 306 LGVLTYELLVGSPPFE 321

>Kwal_23.6458
          Length = 868

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 123/299 (41%), Gaps = 57/299 (19%)

Query: 27  QVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKP-----KLQMGDVACLKRV 81
           +V VG    E IK + +G   ++Y VK      E + NR+       K +M     +KR+
Sbjct: 456 EVIVGPQSFEKIKLLGQGDVGKVYLVK------EKKTNRLYALKIFSKEEMIKRKKIKRI 509

Query: 82  LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLL 141
           L + E            +      P IV  Y S  S  +       + L ME C      
Sbjct: 510 LAEQE------------ILATSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFF 550

Query: 142 DYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
             +  R    + E +      +V  A+  +H +    ++RD+K EN+L+    +  L DF
Sbjct: 551 RALQTRKTKCIDEDDARFYSSEVVAAIEYLHLMG--FIYRDLKPENILLHKSGHIMLSDF 608

Query: 202 G----STSTKFPMVTTHQDIAVLTQNI---------YVHTTPQYRSPEMIDLYRCLPIDE 248
                +  TK P+V      ++L   I         +V T  +Y +PE+I   R      
Sbjct: 609 DLSVQAKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTE-EYIAPEVI---RGNGHTA 664

Query: 249 KSDIWALGIFLYKLLFFTTPFE---LTGQFA-ILHSKYEFPKNNYSSK----LINLIII 299
             D W LGI +Y++LF  TP++       F+ +L ++  FP NN  S+    LI  ++I
Sbjct: 665 AVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKNEVSFPNNNEVSRNCKDLIRKLLI 723

>Kwal_56.22693
          Length = 984

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 94/192 (48%), Gaps = 15/192 (7%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +  L+E  PN   L  + +     L+++  +     +  A+  +H+    ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIKK--FGSLSQECAVYYSAQILDAIDYLHH--KGIVHRDIKPEN 287

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI-DLYRCLPI 246
           +L+D     KL DFG T+       T Q   +L ++     T +Y SPE++ D Y    +
Sbjct: 288 ILLDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----V 342

Query: 247 DEKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINLIIIMLA 302
           D K DIWA G  L++++    PF+ T ++     ++  +Y F    +   + +LI  +L 
Sbjct: 343 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAF-TAGFPLVIRDLIKKILV 401

Query: 303 ENPNLRPNIYQV 314
           ++P  R +  Q+
Sbjct: 402 KSPEQRLDASQI 413

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 135/338 (39%), Gaps = 43/338 (12%)

Query: 10   VNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPK 69
            V + T K N    T  + ++  + K +   +I  G F  +Y+                  
Sbjct: 1166 VLDATDKDNQYLLTLASSLSNVSIKWQKRSFIGGGSFGSVYSA---------------VN 1210

Query: 70   LQMGDVACLKRVLVQDENGLNE----MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPG 125
            L  GD+  +K +   D   + +    +R+E+ V++ L   PN+VQYY     R       
Sbjct: 1211 LDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLN-HPNVVQYYGVEVHRDR----- 1264

Query: 126  FEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKI 185
              V + ME C   SL       LA    E E++  +Y +       +   + + HRDIK 
Sbjct: 1265 --VNIFMEYCEGGSLASL----LAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKP 1318

Query: 186  ENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMID--LYRC 243
            EN+L+D     K  DFG+        +   ++    +   +  TP Y SPE I    Y  
Sbjct: 1319 ENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTGYGK 1378

Query: 244  LPIDEKSDIWALGIFLYKLLFFTTPFE-LTGQFAILHSKYE-----FP-KNNYSSKLINL 296
               D   DIW+LG  + +++    P+  L  Q+AI++         FP KN  S   I  
Sbjct: 1379 FGSD---DIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKF 1435

Query: 297  IIIMLAENPNLRPNIYQVLHNICSISGMKVPIEDQYAE 334
            +   L ++PN R    ++L +   I    +   D   E
Sbjct: 1436 LSRCLIQDPNQRSTAVELLMDPWIIEIRTIAFGDDTVE 1473

>Scas_616.10
          Length = 1461

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 83/181 (45%), Gaps = 29/181 (16%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN++  Y+   ++        E+ L++E      L DY+  +   K
Sbjct: 183 IEREIVIMK-LISHPNVMALYEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 232

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN-NFKLCDFGSTSTKFPM 210
           L+EKE +     +   VS  H     + HRD+K EN+L+D +N + K+ DFG  + + P 
Sbjct: 233 LSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFGMAALELPN 290

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
                             +P Y SPE++    Y   P    SD+W+ GI L+ LL    P
Sbjct: 291 KLLQTSCG----------SPHYASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLP 336

Query: 269 F 269
           F
Sbjct: 337 F 337

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 70.5 bits (171), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 88/335 (26%), Positives = 142/335 (42%), Gaps = 73/335 (21%)

Query: 1   MSTTSGPVSVNNTTVKPNNERYTPG------TQVAVGAHKVEIIKYIAEGGFAQIYAV-- 52
           +ST S   +VNNT       R T G      T     + +V + K +  G  + I  V  
Sbjct: 47  ISTASSNANVNNTKTSKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPK 106

Query: 53  KFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYY 112
           KF++      +N++K +L  G                  +  E+ +MK L   PN++  Y
Sbjct: 107 KFVK------SNQIK-QLPYG------------------IEREIIIMK-LISHPNVMGLY 140

Query: 113 DSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMH 172
           +   ++        E+ L++E      L DY+  +   KL E E +     +  AV+  H
Sbjct: 141 EVWENKS-------ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCH 191

Query: 173 YLPTPLLHRDIKIENVLVDAQN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTT-- 229
                + HRD+K EN+L+D +  + K+ DFG               A+ T +  + T+  
Sbjct: 192 GFN--ICHRDLKPENLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCG 236

Query: 230 -PQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAIL----HSKY 282
            P Y SPE++    Y   P    SD+W+ GI L+ LL    PF       +L      KY
Sbjct: 237 SPHYASPEIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKY 292

Query: 283 EFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
           + P+   S +  +LI  +L  +PN R  I Q+L +
Sbjct: 293 QMPQ-WLSVEAKDLISRILVVDPNRRITIDQILQH 326

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 96/195 (49%), Gaps = 23/195 (11%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           + ++ME C   S  D + +     L E+++  I+++VT  +  +H      +HRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAAN 146

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPID 247
           +L++ +   KL DFG        V+ H   + L ++ +V  TP + +PE++    C  +D
Sbjct: 147 ILLNEEGMVKLGDFG--------VSGHIR-STLKRDTFV-GTPYWMAPEVV----CCEVD 192

Query: 248 ---EKSDIWALGIFLYKLLFFTTPFELTGQFAILHS--KYEFPK--NNYSSKLINLIIIM 300
              EK+DIW+LGI  Y+LL    P        ++ +  K + PK    +S    + +   
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGC 252

Query: 301 LAENPNLRPNIYQVL 315
           L + P  RP+ Y +L
Sbjct: 253 LVKTPADRPSAYNLL 267

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 88/196 (44%), Gaps = 26/196 (13%)

Query: 127 EVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIE 186
           E+ L++E      L DY+  +   KL E+E +     +   VS  H     + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 187 NVLVDAQN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRC 243
           N+L+D +N   K+ DFG  + + P                   +P Y SPE++    Y  
Sbjct: 244 NLLLDKKNRRIKIADFGMAALELPNKLLKTSCG----------SPHYASPEIVMGRPYHG 293

Query: 244 LPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAIL----HSKYEFPKNNYSSKLINLIII 299
            P    SD+W+ GI L+ LL    PF       +L      KY+ P +N SS+  +LI  
Sbjct: 294 GP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMP-SNLSSEARDLISK 348

Query: 300 MLAENPNLRPNIYQVL 315
           +L  +P  R    ++L
Sbjct: 349 ILVIDPEKRITTQEIL 364

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 103/246 (41%), Gaps = 59/246 (23%)

Query: 36  EIIKYIAEGGFAQIYAVK-----FIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLN 90
           E+ + + +G F ++Y V+     FI  L   E N +   LQ               N L 
Sbjct: 101 EVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEI---LQF--------------NLLK 143

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYM------ 144
           +++ EV++   +   PNI++ Y      +        V LLME   N  L   +      
Sbjct: 144 QLKREVDIQLGMD-HPNIIKLYAHFHDEK-------RVYLLMEHSINGELYKSLKNNGPF 195

Query: 145 NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGST 204
           N  LA+          +Y +  A+  MH     ++HRD+K ENVL+   N  KL DFG  
Sbjct: 196 NDVLASHY--------IYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG-W 244

Query: 205 STKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLF 264
           S   P  +  + +           T  Y SPEMI        DE+ D+WALG+  Y+L+ 
Sbjct: 245 SILNPEGSKRKTLC---------GTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVV 292

Query: 265 FTTPFE 270
              PFE
Sbjct: 293 GVPPFE 298

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/312 (21%), Positives = 138/312 (44%), Gaps = 46/312 (14%)

Query: 30  VGAHKVEIIKYIAEGGFAQIYAVKFI-----EFLNEFENNRMKPKLQMGDVA----CLKR 80
           VGA  +  +K        ++ A+K +      FL++ +N+   P +   ++      L++
Sbjct: 114 VGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNS--PPPVNNQEIMERQKKLEK 171

Query: 81  VLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSL 140
            + +D+  + E       + Q+   P+I + ++      H         +L E      L
Sbjct: 172 EISRDKRAIREAS-----LGQIFYHPHICRLFEMCTMSNH-------FYMLFEYVAGGQL 219

Query: 141 LDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCD 200
           LDY+ Q     L E    K    V  A+  +H     ++HRD+KIEN+++      K+ D
Sbjct: 220 LDYIIQH--GSLREHHARKFARGVASALQYLHA--NNIVHRDLKIENIMISNSGEIKIID 275

Query: 201 FGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLY 260
           FG ++    +  T + +     ++Y      + +PE++  +       + D+W+ G+ LY
Sbjct: 276 FGLSN----VYDTRKQLHTFCGSLY------FAAPELLKAHPY--TGPEVDVWSFGVVLY 323

Query: 261 KLLFFTTPFELTGQFAILH-----SKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
            L+    PF+     ++LH      K E+P+ + S ++++L+  ML  +P+ R ++ QV+
Sbjct: 324 VLVCGKVPFDDENS-SVLHEKIKRGKVEYPQ-HLSIEVMSLLSKMLVVDPSRRASLKQVV 381

Query: 316 HNICSISGMKVP 327
            +     G   P
Sbjct: 382 EHPWMTKGYDTP 393

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 110/234 (47%), Gaps = 33/234 (14%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN+++ +D   +         ++ L++E      L + + +R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWET-------NSDLYLVLEYAEKGELFNMLVER--GP 125

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L E E ++    +   +S  H L   ++HRD+K EN+L+D + N K+ DFG       M 
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPENLLLDNKLNIKIADFG-------MA 176

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTTPF- 269
               +  +L  +     +P Y +PE+I     LP +   SD+W+ G+ L+ LL    PF 
Sbjct: 177 ALESEDKLLETSC---GSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLPFD 230

Query: 270 ELTGQ-----FAILHSKYEFPKNNYSSKLI-NLIIIMLAENPNLRPNIYQVLHN 317
           E  G        +   ++E P ++  +K   +L+  +L  +P+ R  I ++L +
Sbjct: 231 EEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 100/225 (44%), Gaps = 36/225 (16%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           +L E      LLDY+ Q     L E    K    +  A+  +H     ++HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQH--GSLKEHHARKFARGIASALQYLHA--NNIVHRDLKIENIM 255

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLP-IDE 248
           + +    K+ DFG ++    +    + +     ++Y      + +PE++   +  P    
Sbjct: 256 ISSSGEIKIIDFGLSN----IFDYRKQLHTFCGSLY------FAAPELL---KAQPYTGP 302

Query: 249 KSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKL----INLIIIMLAEN 304
           + DIW+ GI LY L+    PF+     +ILH K +  K +Y S L    I+L+  M+  +
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVD 361

Query: 305 PNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKV 349
           P  R  +  V             +E  +    YDF+  ++  N+V
Sbjct: 362 PLRRATLKNV-------------VEHPWMNRGYDFKAPSYVPNRV 393

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 116/263 (44%), Gaps = 52/263 (19%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN+++ YD   +         ++ L++E      L + + +R    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYDVWET-------NTDLYLVLEYAEKGELFNLLVER--GP 127

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L E E ++    +   VS  H L   ++HRD+K EN+L+D + N K+ DFG         
Sbjct: 128 LPEHEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA------- 178

Query: 212 TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTT 267
                 A+ T+   + T   +P Y +PE++     +P     SD+W+ G+ L+ LL    
Sbjct: 179 ------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRL 229

Query: 268 PFE------LTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNIYQVL-HNIC 319
           PF+       T    +   ++E P ++  S +  +LI  +L  +P  R     +L H + 
Sbjct: 230 PFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289

Query: 320 ----------SISGMKVPIEDQY 332
                     SI G+  P ED Y
Sbjct: 290 QKYPSIRDSKSIRGL--PREDTY 310

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 129/289 (44%), Gaps = 59/289 (20%)

Query: 89  LNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN--Q 146
           +N++  E+ ++K ++   NI+ +Y +  ++  N     E+++LME     SL   ++  +
Sbjct: 232 INQLVRELSIVKNVKPHENIITFYGAYYNQHINN----EIIILMEYSDCGSLDKILSVYK 287

Query: 147 RLA---------TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFK 197
           R           T   E  I KI Y V   +  + Y    ++HRDIK  NVL++++   K
Sbjct: 288 RFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSKGQIK 346

Query: 198 LCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWAL 255
           LCDFG +     ++ +  D  V         T  Y SPE I  ++Y       K D+W+L
Sbjct: 347 LCDFGVSKK---LINSIADTFV--------GTSTYMSPERIQGNVYSI-----KGDVWSL 390

Query: 256 GIFLYKLLFFTTPFELTG------------QFAILHSKYEFPKNN-YSSKLINLIIIMLA 302
           G+ + +L+  T  F L G            Q  +       PK+  YS ++ + +     
Sbjct: 391 GLMIIELV--TGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCI 448

Query: 303 ENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQS 351
           +N   R +I+++LH+          +  +Y   P   +K+ H+  K++S
Sbjct: 449 KNERERSSIHELLHH---------DLIMKYVS-PSKDDKFRHWCRKIKS 487

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 92/198 (46%), Gaps = 34/198 (17%)

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMEL--CPNKSLLDYMNQR 147
           N++  E+ +MK ++   NIV +Y +     +      E+++LME   C +   +    +R
Sbjct: 236 NQLMRELTIMKNVKEQKNIVGFYGA----YYTAIKNHEIIILMEYMDCGSLDKISSTYRR 291

Query: 148 LATK-----------LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
             ++            TE  + KI Y V   +S + Y    ++HRDIK  N+L++++   
Sbjct: 292 YCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNILINSKGFV 350

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           K+CDFG +     M+ +  D  V         T  Y SPE I    C   + K D+W+LG
Sbjct: 351 KICDFGVSKK---MIDSIADTFV--------GTSTYMSPERIQ-GSCY--NTKGDVWSLG 396

Query: 257 IFLYKLLFFTTPFELTGQ 274
           + + +L+  T  F L G 
Sbjct: 397 LMIIELV--TGEFPLGGH 412

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 114/257 (44%), Gaps = 49/257 (19%)

Query: 40   YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEM----RNE 95
            +I  G F Q+Y+                  L+ G++  +K + + D   + ++    + E
Sbjct: 1039 FIGGGTFGQVYSA---------------INLENGEILAVKEIKIHDTTTMKKIFPLIKEE 1083

Query: 96   VEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPN---KSLLDY--MNQRLAT 150
            + V++ L   PNIVQYY     R        +V + ME C      SLLD+  +   + T
Sbjct: 1084 MTVLEMLN-HPNIVQYYGVEVHRD-------KVNIFMEYCEGGSLASLLDHGRIEDEMVT 1135

Query: 151  KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
            ++   E+L+        ++ +H   + ++HRDIK EN+L+D     K  DFG+  T    
Sbjct: 1136 QVYTFELLE-------GLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGS 1186

Query: 211  VT------THQDIAVLTQNI-YVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLL 263
             T        QD  V T+++  +  TP Y +PE I            D+WALG  + ++ 
Sbjct: 1187 RTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMA 1246

Query: 264  FFTTPFE-LTGQFAILH 279
                P+  L  ++AI++
Sbjct: 1247 TGRRPWSNLDNEWAIMY 1263

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 120/286 (41%), Gaps = 48/286 (16%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNE 95
           EI K + +G F ++Y VK  E             L     A  K+ +VQ      + R E
Sbjct: 101 EIGKILGKGKFGKVYCVKHRE-----------TGLICALKAMEKKEIVQ-YTIQKQFRRE 148

Query: 96  VEVMKQLQGAPNIVQYYDSNASRRHNGFPGFE--VLLLMELCPNKSLLDYMNQRLATKLT 153
           VE+    +   N+ Q Y         GF   E  V LLME      L  ++       L 
Sbjct: 149 VEIQGSFK-HKNLTQLY---------GFFYDEKRVYLLMEYVYYGELYKFLKNN--GPLN 196

Query: 154 EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTT 213
           E      +Y +  A+  MH     +LHRDIK EN+L+   N  KL DFG +         
Sbjct: 197 ETLASYFVYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFGWSVYN----ED 250

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF---- 269
            Q    L   I       Y SPE+I   +    + K D+WALG+  Y+LL  + PF    
Sbjct: 251 GQKRKTLCGTI------DYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFEEDT 301

Query: 270 -ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQV 314
            E+T +  IL    +FP  N S +  +LI+ +L   P+ R  + +V
Sbjct: 302 KEMTYR-RILRCDLKFPL-NVSPQARDLIVRLLQFEPSKRIPLSEV 345

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 104/230 (45%), Gaps = 29/230 (12%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E   +++L  +P++V+ + +             +  L+E  PN   L  M +  +  L E
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDES-------SLYFLLEYAPNGDFLSLMKKYGS--LDE 277

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM--VT 212
                    +  A+  +H     ++HRDIK EN+L+D +   KL DFG+     P     
Sbjct: 278 TCARYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSV 335

Query: 213 THQDIAVLTQNIYVHTTPQYRSPEMID----LYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
           +  +  + T++     T +Y SPE+++     YRC       DIWA G  L++++    P
Sbjct: 336 SKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRC-------DIWAFGCILFQMIAGKPP 388

Query: 269 FELTGQF----AILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQV 314
           F+ T ++     ++  +Y F    +   + +L+  +L +N + R  I Q+
Sbjct: 389 FKATNEYLTFQKVMKVQYAFTP-GFPLIIRDLVKKILVKNLDRRLTISQI 437

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 94/194 (48%), Gaps = 18/194 (9%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +  L+E  PN  LL  M  R    + EK        +  A+  MH     ++HRD+K EN
Sbjct: 229 LYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALGFMH--DKGVIHRDLKPEN 284

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIA--VLTQNIYVHTTPQYRSPEMI-DLYRCL 244
           +L+D     KL DFG  + +    T+  D+   +LT++     T +Y SPE++ D Y   
Sbjct: 285 ILLDVDMKVKLTDFG--TARLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPELLNDNY--- 339

Query: 245 PIDEKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINLIIIM 300
            +D + DIWA G  L++++    PF+   ++     ++  ++ F    +   + +L+  +
Sbjct: 340 -VDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTA-GFPMTVRDLVKNI 397

Query: 301 LAENPNLRPNIYQV 314
           L +NP  R  I Q+
Sbjct: 398 LIKNPERRLLINQI 411

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 127/288 (44%), Gaps = 47/288 (16%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQD-ENGLNEMRN 94
           EI++ I  G F  +Y  +                L   ++  +K V ++D +  ++ +  
Sbjct: 21  EILQCIGRGNFGDVYKAR---------------DLTSNEIVAIKVVNLEDTDEPIDLLAQ 65

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E+  + +L+ +P I  Y       +        + ++ME C   S  + +      K+TE
Sbjct: 66  EIFFLSELR-SPYITNY-------KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTE 117

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
           ++   I+ +V   +  +H      +HRDIK  N+L+    + KL DFG +     MVT  
Sbjct: 118 EQCAFIVSEVLIGLDYLH--SQRKIHRDIKSANILLTDNGHVKLGDFGVSGQM--MVTRK 173

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQ 274
           +D  V         TP + +PE+ID  +    +E +DIW+LGI + +LL    P +   +
Sbjct: 174 RDTFV--------GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLD---K 221

Query: 275 FAILHSKYEFPKNN-------YSSKLINLIIIMLAENPNLRPNIYQVL 315
           +  + +    PK +       +SS   + +   L ++P+ RP   ++L
Sbjct: 222 YDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELL 269

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 97/204 (47%), Gaps = 25/204 (12%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           +L E      LLDY+ Q     L E+   K +  +  A+  +H     ++HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLHL--NNIVHRDLKIENIM 254

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLP-IDE 248
           +      K+ DFG ++    +    + +     ++Y      + +PE++   +  P I  
Sbjct: 255 ISTSGEIKIIDFGLSN----LYDNKKQLHTFCGSLY------FAAPELL---KANPYIGP 301

Query: 249 KSDIWALGIFLYKLLFFTTPFELTGQFAILH-----SKYEFPKNNYSSKLINLIIIMLAE 303
           + DIW+ G+ +Y L+    PF+     ++LH      K E+P+ + S + I+L+  ML  
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYPQ-HLSIECISLLSKMLVV 359

Query: 304 NPNLRPNIYQVLHNICSISGMKVP 327
           +P  R ++ QV ++     G   P
Sbjct: 360 DPLKRASLKQVCNHQWMQRGFDFP 383

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 87/192 (45%), Gaps = 34/192 (17%)

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
           E   EV++  ++    NIVQ YD            F+  ++ME C    L + +   L  
Sbjct: 122 EAMYEVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGDLYEAIKDDLVP 170

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
           K T KEI  I+  +  A+  +H     + HRDIK EN+L+ +     L D+    T + +
Sbjct: 171 KKT-KEITHILTQILDAIEFVH--NKQIYHRDIKPENILITS-----LIDWKIKLTDWGL 222

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE--------KSDIWALGIFLYKL 262
            TT  D     +N+    + +Y  PE+ +    L IDE        K D+W++GI    +
Sbjct: 223 ATT--DEKSYDRNV---GSERYMPPELFE--SNLDIDERKEPYDCSKVDLWSIGIVFLNV 275

Query: 263 LFFTTPFELTGQ 274
           +F+  PF +  Q
Sbjct: 276 VFYKNPFRIADQ 287

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 99/204 (48%), Gaps = 25/204 (12%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           +L E      LLDY+ Q  + +  E +  K    +  A+  +H     ++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLH--ANNIVHRDLKIENIM 276

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLP-IDE 248
           +   +  K+ DFG ++    +  + + +     ++Y      + +PE++   +  P    
Sbjct: 277 ISDSSEIKIIDFGLSN----IYDSRKQLHTFCGSLY------FAAPELL---KANPYTGP 323

Query: 249 KSDIWALGIFLYKLLFFTTPFELTGQFAILH-----SKYEFPKNNYSSKLINLIIIMLAE 303
           + D+W+ G+ L+ L+    PF+     ++LH      K E+P+ + S ++I+L+  ML  
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQ-HLSIEVISLLSKMLVV 381

Query: 304 NPNLRPNIYQVLHNICSISGMKVP 327
           +P  R  + QV+ +   + G   P
Sbjct: 382 DPKRRATLKQVVEHHWMVRGFNGP 405

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 127/264 (48%), Gaps = 34/264 (12%)

Query: 2   STTSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEF 61
           ST S P++     +  N     P + +     K   +  I +G F+ +Y V F +   ++
Sbjct: 414 STDSSPLNSKRRLISSNKLSANPDSHLF---EKFTNVHSIGKGQFSTVYQVTFAQTNKKY 470

Query: 62  ENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHN 121
               +KP         LKR+L++ +  LNE+ N++  M Q +G   I+ Y  S   +  N
Sbjct: 471 AIKAIKP----NKYNSLKRILLEIK-ILNEVTNQI-TMDQ-EGKEYIIDYISS--WKFQN 521

Query: 122 GFPGFEVLLLMELCPNKSLLDYMNQRLATK---LTEKEILKIMYDVTYAVSQMHYLPTPL 178
            +      ++ ELC N +L  ++ +++  K   L +  I KI+ +++ A+  +H     +
Sbjct: 522 SY-----YIMTELCENGNLDGFLQEQVIAKKKRLEDWRIWKIIVELSLALRFIHD-SCHI 575

Query: 179 LHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI 238
           +H D+K  NV++  + N KL DFG  +T  P+    +D +   +        +Y +PE+I
Sbjct: 576 VHLDLKPANVMITFEGNLKLGDFG-MATHLPL----EDKSFENEG-----DREYIAPEII 625

Query: 239 DLYRCLPIDEKSDIWALGIFLYKL 262
               C   D K+DI++LG+ + ++
Sbjct: 626 S--DCT-YDYKADIFSLGLMIVEI 646

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 94/198 (47%), Gaps = 24/198 (12%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +  L+E  PN   L  + ++  T L E+  +     +  A+  MH     ++HRDIK EN
Sbjct: 193 LYFLLEYAPNGDFLSLI-KKFGT-LNEECTIYYSAQIIDAIGSMH--SHGIIHRDIKPEN 248

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQD------IAVLTQNIYVHTTPQYRSPEMI-DL 240
           +L+D     KL DFG+      ++    D        +LT++     T +Y SPE++ D 
Sbjct: 249 ILLDGNMKIKLTDFGTAK----LLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDN 304

Query: 241 YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINL 296
           Y     D K DIWA G  +Y+++    PF+ T ++     ++  ++ F    + + + +L
Sbjct: 305 Y----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTA-GFPTIIRDL 359

Query: 297 IIIMLAENPNLRPNIYQV 314
           +  +L + P  R  I Q+
Sbjct: 360 VKNILVKQPEKRLTIPQI 377

>Scas_502.2
          Length = 1116

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 93/194 (47%), Gaps = 19/194 (9%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +  L+E  PN  LL  M +     L E+        +  A+  MH     ++HRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLMKK--FGSLNEECCCYYGAQIIDAIKFMH--SKGIIHRDIKPEN 303

Query: 188 VLVDAQNNFKLCDFGSTST--KFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI-DLYRCL 244
           +L+D     K+ DFG+       P  T++    +LT++     T +Y SPE++ D Y   
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGTSYD---LLTRSKSFVGTAEYVSPELLNDNY--- 357

Query: 245 PIDEKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINLIIIM 300
             D +SDIWA G  +++++    PF+ T ++     ++  +Y F    + + + +L+  +
Sbjct: 358 -TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPTVVRDLVKRI 415

Query: 301 LAENPNLRPNIYQV 314
           L + P  R  I  +
Sbjct: 416 LIKAPEQRLTIEAI 429

>Scas_564.7
          Length = 1210

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 95/203 (46%), Gaps = 23/203 (11%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           +L E      LLDY+ Q  +  L E    K    +  A+  +H     ++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEYIHA--NNIVHRDLKIENIM 318

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 249
           +      K+ DFG ++    +    + +     ++Y      + +PE++  +       +
Sbjct: 319 ISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 250 SDIWALGIFLYKLLFFTTPFELTGQFAILH-----SKYEFPKNNYSSKLINLIIIMLAEN 304
            D+W+ G+ LY L+    PF+     ++LH      K ++P N+ S ++I+L+  ML  +
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYP-NHLSIEVISLLSKMLVVD 424

Query: 305 PNLRPNIYQVLHNICSISGMKVP 327
           P  R ++ QV+ +     G   P
Sbjct: 425 PLRRASLKQVVEHPWMTRGYDYP 447

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 92/196 (46%), Gaps = 20/196 (10%)

Query: 128 VLLLMELCPNKSLLDYMNQ--RLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKI 185
           +  L+E  PN   L  M +   L+   T     +I+  + Y  S+       ++HRDIK 
Sbjct: 256 LYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLHSKG------IIHRDIKP 309

Query: 186 ENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ--DIAVLTQNIYVHTTPQYRSPEMI-DLYR 242
           EN+L+D     K+ DFG+     P        +  +LT++     T +Y SPE++ D Y 
Sbjct: 310 ENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY- 368

Query: 243 CLPIDEKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINLII 298
              +D + DIWA G  +++++    PF+ T ++     ++  +Y F    +   + +L+ 
Sbjct: 369 ---VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPVVVRDLVK 424

Query: 299 IMLAENPNLRPNIYQV 314
            +L + P  R  I Q+
Sbjct: 425 RILLKVPEQRLTIPQI 440

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 103/232 (44%), Gaps = 33/232 (14%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN++  YD   +  +       + L++E      L + +       
Sbjct: 74  IEREIVIMKLL-SHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVDH--GP 123

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L E+E +     +   +S  H L   ++HRD+K EN+L+D+  N K+ DFG       M 
Sbjct: 124 LPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFG-------MA 174

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTTPF- 269
               D  +L  +     +P Y +PE++     LP +   SD+W+ G+ L+ LL    PF 
Sbjct: 175 ALQTDADLLETSC---GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPFD 228

Query: 270 ELTGQ-----FAILHSKYEFPKNNYSSK-LINLIIIMLAENPNLRPNIYQVL 315
           E  G        +   ++E P +   S+   +LI  +L  +P  R  I  +L
Sbjct: 229 EENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDIL 280

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 144/352 (40%), Gaps = 65/352 (18%)

Query: 27  QVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDE 86
           +  VG    E I+ + +G   ++Y V+      E +++R+      G    +KR  ++  
Sbjct: 453 EAVVGPQSFEKIRLLGQGDVGKVYLVR------EKKSDRLYALKIFGKAEMIKRKKIK-- 504

Query: 87  NGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQ 146
                +  E E++      P IV  Y S  +  +       + L ME C        +  
Sbjct: 505 ----RILAEQEILA-TSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRALQT 552

Query: 147 RLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG---- 202
           R    ++E +      +VT A+  +H +    ++RD+K EN+L+    +  L DF     
Sbjct: 553 RKTKCISEDDARFYASEVTAALEYLHLMG--FIYRDLKPENILLHQSGHVMLSDFDLSVQ 610

Query: 203 STSTKFPMV-----TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKSDIWA 254
           +  T+ P V     ++  D  V +     ++   T +Y +PE+I   R        D W 
Sbjct: 611 AKGTRNPQVKGNAQSSLVDTKVCSDGFRTNSFVGTEEYIAPEVI---RGNGHTASVDWWT 667

Query: 255 LGIFLYKLLFFTTPFEL--TGQ-FA-ILHSKYEFPKNNYSSK----LINLIIIM------ 300
           LGI  Y++LF  TPF+   T Q F+ IL +   FP NN  S+    LI  +++       
Sbjct: 668 LGILTYEMLFGFTPFKGDNTNQTFSNILKNDVYFPNNNDISRTCKDLIKKLLVKKESKRL 727

Query: 301 --------LAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTH 344
                   + ++P  +   + +L N       + P+     E  YDF K +H
Sbjct: 728 GSKFGASEIKKHPFFKTVQWALLRN------QEPPLIPVLTEDGYDFAKLSH 773

>Scas_493.2
          Length = 1117

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 110/235 (46%), Gaps = 39/235 (16%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L+ A N++  YD   +  +       + +++E      L + + ++    
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWETNSN-------LYMILEYAEKGELFNLLVEK--GP 130

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L EKE ++    +   +S  H L   ++HRD+K EN+L+D + N K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA------- 181

Query: 212 TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDE-KSDIWALGIFLYKLLFFTT 267
                 A+ T++  + T   +P Y +PE++     +P    +SD+W+ G+ L+ LL    
Sbjct: 182 ------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 268 PF-ELTGQ-----FAILHSKYEFPKNNYSSK-LINLIIIMLAENPNLRPNIYQVL 315
           PF E  G        +   ++E P ++  S+   +LI  +L  +P  R    ++L
Sbjct: 233 PFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREIL 287

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 102/233 (43%), Gaps = 34/233 (14%)

Query: 92  MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           +  E+ +MK L   PN++   +   ++        E+ L++E      L DY+  +   K
Sbjct: 173 IEREIVIMK-LISHPNVMGLLEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 222

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN-FKLCDFGSTSTKFPM 210
           L+E E +     +   VS  H     + HRD+K EN+L+D +N   K+ DFG  + + P 
Sbjct: 223 LSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADFGMAALELPN 280

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
                             +P Y SPE++    Y   P    SD+W+ GI L+ LL    P
Sbjct: 281 KLLETSCG----------SPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGHLP 326

Query: 269 FELTGQFAIL----HSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
           F       +L      +++ P    ++   +LI  +L  NP  R  I ++L++
Sbjct: 327 FNDDNIKKLLLKVQAGRFQLPP-YLTNDAKDLITRILVTNPEKRLTINEILNH 378

>Scas_685.24
          Length = 515

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 89/196 (45%), Gaps = 25/196 (12%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           + ++ME C   S  D +       L EK++  I  ++   +  +H      +HRDIK  N
Sbjct: 93  MWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAAN 150

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEM----IDLYRC 243
           +L+  + + KL DFG          + Q  + L +   V  TP + +PE+    I+ Y  
Sbjct: 151 ILLTEEGHVKLGDFG---------VSGQLKSTLRRGTIV-GTPYWMAPEVASQNIEGY-- 198

Query: 244 LPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILH--SKYEFPK--NNYSSKLINLIII 299
              DEK DIW+LGI +++LL    P        +L   S+   P+    YS    + + +
Sbjct: 199 ---DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVAL 255

Query: 300 MLAENPNLRPNIYQVL 315
            L +NPN RP    +L
Sbjct: 256 CLIKNPNERPAAVDLL 271

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 135/323 (41%), Gaps = 71/323 (21%)

Query: 5   SGPVSVNNTTVKPNNE---RYTPGTQVAVGAHKVEIIKYIAEGGFA-----------QIY 50
           + PVS+ +  VK  N+    Y P ++  V  +  EIIK +  G              Q+ 
Sbjct: 85  TAPVSIPHRKVKETNKISLEYDPISRRKV-LNTYEIIKELGHGQHGKVKLARDLLTKQLV 143

Query: 51  AVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQL--QGAPNI 108
           A+K ++  +E +NN  K          LK+   +++    +++ E+ +MK+   +    +
Sbjct: 144 AIKIVD-RHEKKNNPWK----------LKKTNTEND----KIKREIAIMKKCHHEHVVKL 188

Query: 109 VQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK------LTEKEILKIMY 162
           ++  D   SR+        + L++E C    +      +L TK      LT +   +++ 
Sbjct: 189 IEVLDDFKSRK--------IYLVLEYCSKGEIKWCPGDQLETKARGPPLLTFQRAREVLR 240

Query: 163 DVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQ 222
            V   +  +HY    ++HRDIK  N+LV      K+ DFG         TT      + +
Sbjct: 241 GVVLGLEYLHY--QGIIHRDIKPANLLVSETGTVKISDFG---VSLAASTTEDGNGFIDE 295

Query: 223 NIYVHT--TPQYRSPEMI---DLYRCLPIDEKS-----------DIWALGIFLYKLLF-- 264
                T  TP + +PE+    D       D+K+           DIWALG+ L+ LLF  
Sbjct: 296 LELAKTAGTPAFFAPEICLGHDALEKFNPDKKATKKGLCISFMIDIWALGVTLHCLLFGQ 355

Query: 265 --FTTPFELTGQFAILHSKYEFP 285
             F + FEL     I++    FP
Sbjct: 356 LPFISEFELELFHKIVNDSLTFP 378

>Scas_598.6
          Length = 790

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 108/240 (45%), Gaps = 32/240 (13%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFL-NEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRN 94
           ++I+   +G    +Y  + I     EF+        ++GD   +K++++  +     + N
Sbjct: 503 QMIEKAGQGASGSVYLAERIAIPPGEFDETP-----EVGDKVAIKQMILSKQPRKELIVN 557

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT---- 150
           E+ VMK  +   NIV + ++            ++ ++ME     SL D +    AT    
Sbjct: 558 EILVMKDSRHK-NIVNFLEAYLKTED------DLWVVMEFMEGGSLTDIIENSPATGSSS 610

Query: 151 -KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
             LTE +I  I+ +    +  +H     ++HRDIK +NVL+D     K+ DFG     F 
Sbjct: 611 SPLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDNVLLDNNARVKITDFG-----FC 663

Query: 210 MVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
              T Q     ++   +  TP + +PE++        DEK D+W+LGI   ++L    P+
Sbjct: 664 AKLTDQR----SKRATMVGTPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 716

>Scas_693.17
          Length = 1049

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 102/224 (45%), Gaps = 30/224 (13%)

Query: 99  MKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEIL 158
           + Q+   P+I + Y+ +    H         +L E      LLDY+ Q  +  L E    
Sbjct: 153 LGQILYHPHICRLYEMHTLSNH-------FYMLFEYVSGGQLLDYIIQHGS--LKESRAR 203

Query: 159 KIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIA 218
                +  A+  +H     ++HRD+KIEN+++    N KL DFG ++    +      + 
Sbjct: 204 TFTRQICSALKYLH--SHNIVHRDLKIENIMISKDGNIKLIDFGLSN----LYDKCNKLK 257

Query: 219 VLTQNIYVHTTPQYRSPEMIDLYRCLP-IDEKSDIWALGIFLYKLLFFTTPFELTGQFAI 277
               ++Y      + +PE++   +  P I  + D+W+ G+ LY L+    PF+      +
Sbjct: 258 TYCGSLY------FAAPELL---KATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS-NV 307

Query: 278 LHSKYEFPKNNY----SSKLINLIIIMLAENPNLRPNIYQVLHN 317
           LH K +  K  Y    S ++I+L+  ML  +P  R  + QV+++
Sbjct: 308 LHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>Kwal_23.5668
          Length = 1689

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 106/219 (48%), Gaps = 31/219 (14%)

Query: 128  VLLLMELCPNKSLLDYMN-QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIE 186
            + + ME C N++L D ++ + L  +  ++E  ++  ++  A+S +H     ++HRD+K  
Sbjct: 812  LFIQMEYCENRTLFDLIHTENLCAQ--KEEYWRLFREILDALSYIH--SQGIIHRDLKPM 867

Query: 187  NVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT--TPQYRSPEMIDLYRCL 244
            N+ +D   N K+ DFG           H+ + +L  + ++ T  T    S     LY   
Sbjct: 868  NIFIDESRNIKIGDFGLAK------NVHKSVDLLRMDSHISTASTEDLTSAIGTALYVAT 921

Query: 245  PI-------DEKSDIWALGIFLYKLLF-FTTPFELTGQF-AILHSKYEFPKNNYSSKLI- 294
             +       +EK D+++LGI  +++++ F T  E       I  S  +FP +  SSKL  
Sbjct: 922  EVLTGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKIRTSAIDFPSDFDSSKLAV 981

Query: 295  --NLIIIMLAENPNLRPNIYQVLHNICSISGMKVPIEDQ 331
               +I  +L  +PN RPN   +L      SG+ +P++ Q
Sbjct: 982  EKKIITQLLDHDPNRRPNAKTLLR-----SGL-LPVKHQ 1014

>Scas_627.7
          Length = 349

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 104/230 (45%), Gaps = 32/230 (13%)

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
           + R EVE+   L   PN+ + Y      +        V LLME      L  Y   R   
Sbjct: 135 QFRREVEIQTSL-NHPNLTKLYGHFHDEK-------RVYLLMEYLVYGEL--YKLLRSHG 184

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
              +    + ++ +  A++ +H     ++HRD+K EN+L+   N  KL DFG +    P 
Sbjct: 185 PFNDVIASRFVFQIADALNYLH--DKQIIHRDLKPENILIGFNNVIKLTDFGWSIIN-PR 241

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF- 269
               + +           T  Y SPEMI   R    D+K D+WALG+  Y+L+  + PF 
Sbjct: 242 GVKRKTLC---------GTIDYLSPEMI---RSREYDDKVDVWALGVLTYELIVGSPPFE 289

Query: 270 ----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
               ELT +  IL +  +FP+   S  + +LI  +L  NP+ R ++  V+
Sbjct: 290 EDTKELTYK-RILKNDIKFPE-TVSHDVKDLISKLLKYNPSERISMRDVM 337

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 89/191 (46%), Gaps = 14/191 (7%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +  L+E  PN   L  M +     L E+        +  A+  +H     ++HRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVMKK--FGSLNEECCRYYGAQMLDAIDFIH--KNGVVHRDIKPEN 311

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPID 247
           +L+D     KL DFG  + K           +L ++     T +Y SPE+++   C  ++
Sbjct: 312 ILLDEHMKVKLTDFG--TAKLLDRDEKSGYNLLKKSRSFVGTAEYVSPELLN-DNC--VN 366

Query: 248 EKSDIWALGIFLYKLLFFTTPFELTGQF----AILHSKYEFPKNNYSSKLINLIIIMLAE 303
            K DIWA G  LY+++    PF+ T ++     ++  +Y F    +   + +L+  +L +
Sbjct: 367 YKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAF-TAGFPLVIRDLVKQLLVK 425

Query: 304 NPNLRPNIYQV 314
           +P  R N  QV
Sbjct: 426 SPEARLNASQV 436

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 118/272 (43%), Gaps = 48/272 (17%)

Query: 36  EIIKYIAEGGFAQIY--------AVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDEN 87
           EI+  +  G + ++         A+  I+ LN FE  R    LQ+           + EN
Sbjct: 51  EILATLGNGQYGKVKLARDLGTGALVAIKILNRFEK-RSGYSLQL-----------KVEN 98

Query: 88  GLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR 147
               +  E+EVMK+     N+V+ Y+       N     +V L++E C    +      +
Sbjct: 99  P--RVNQEIEVMKRCHHE-NVVELYEI-----LNDPESTKVYLVLEYCSRGPVKWCPENK 150

Query: 148 LATKLTEKEIL------KIMYDVTYAVSQMHYLPTP-LLHRDIKIENVLVDAQNNFKLCD 200
           +  K     IL      K++ DV   VS + YL +  + HRDIK  N+L+ +    K+ D
Sbjct: 151 MEIKAVGPSILTFQQSRKVVLDV---VSGLEYLHSQGITHRDIKPSNLLISSNGTVKISD 207

Query: 201 FG---STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 257
           FG   ST+T    + +  +  + ++ +    TP + +PE+    +        DIW+LG+
Sbjct: 208 FGVAMSTATGSTNIQSSHEQLLKSRAL---GTPAFFAPELCSTEKEYSCSSAIDIWSLGV 264

Query: 258 FLYKLLFFTTPFELTGQF----AILHSKYEFP 285
            +Y LLF   PF          +I++   EFP
Sbjct: 265 TIYCLLFGKLPFNANSGLELFDSIINKPLEFP 296

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 119/292 (40%), Gaps = 46/292 (15%)

Query: 40   YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNE----MRNE 95
            +I  G F  +Y+                  L  GD+  +K + +QD   + +    ++ E
Sbjct: 1264 FIGSGSFGTVYSA---------------VNLDTGDILAVKEIKIQDAKSMKQIFPSLKEE 1308

Query: 96   VEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEK 155
            + VM+ L   PNIVQYY     R        +V + ME C   SL   +         E 
Sbjct: 1309 MRVMEILN-HPNIVQYYGVEVHRD-------KVNIFMEFCEGSSLASLLEH----GRIED 1356

Query: 156  EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQ 215
            E++  +Y +           + ++HRDIK EN+L+D     K  DFG  + K       +
Sbjct: 1357 EMVTQVYTLQLLEGLACLHQSGVVHRDIKPENILLDRNGVIKYVDFG--AAKLIAKNGSK 1414

Query: 216  DIAVLTQNIY-----VHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
             I++   N       +  TP Y +PE +            DIW+LG  + +++    P+ 
Sbjct: 1415 RISLDANNKSTGGKDMIGTPMYMAPETVTGQGHGKFG-SDDIWSLGCVVLEMVTGRRPWA 1473

Query: 271  -LTGQFAILHSKY-----EFP-KNNYSSKLINLIIIMLAENPNLRPNIYQVL 315
             L  ++AI++        +FP K+  SS     I   L ++ N R    ++L
Sbjct: 1474 NLDNEWAIMYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELL 1525

>Scas_675.2
          Length = 527

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 90/189 (47%), Gaps = 22/189 (11%)

Query: 86  ENGLNE--MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDY 143
           +NGL E  +  EV +  +    PN+++  D N ++ +       + ++ME+     L D 
Sbjct: 54  KNGLTEKDISREVLLHSRCSKNPNVLRLIDCNIAKDY-------MWMIMEMADGGDLFDK 106

Query: 144 MNQRLATKLTEKEILKIMYD-VTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
           +   +     + E+ +  +  +  A+S +H     + HRDIK EN+L+D   N KL DFG
Sbjct: 107 IEPDVGV---DSEVAQFYFQQLVRAISYLHE-ECGVAHRDIKPENILLDKNGNLKLADFG 162

Query: 203 STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
            +S         +    L  +     +P Y +PE+  L+        +DIW++GI L+ L
Sbjct: 163 LSS------QYRRKDGTLRISTDQRGSPPYMAPEI--LHSRGYYAHSTDIWSIGILLFVL 214

Query: 263 LFFTTPFEL 271
           L   TP+EL
Sbjct: 215 LTGETPWEL 223

>Kwal_26.7355
          Length = 1446

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 115/281 (40%), Gaps = 62/281 (22%)

Query: 70   LQMGDVACLKRVLV-----QDENGLN---EMRNEVEVMKQLQGAPNIVQYYDSNASRRHN 121
            +  G++  +K+V V     QDE  L+    +R+EV  +K L    NIVQY          
Sbjct: 1166 VTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHT-NIVQYL--------- 1215

Query: 122  GFPGFE-----VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPT 176
               GFE       L +E     S+   +  RL  K  E  I  +   V   +S +H    
Sbjct: 1216 ---GFENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHS--K 1268

Query: 177  PLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT------TP 230
             +LHRD+K +N+L+D     K+ DFG              I+  + NIY ++      T 
Sbjct: 1269 KILHRDMKADNLLLDVDGICKISDFG--------------ISKKSNNIYSNSDMTMRGTV 1314

Query: 231  QYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE----LTGQFAILHSKYEFPK 286
             + +PEM+D  +      K DIW+LG  + ++     P+     +   F I   K   P 
Sbjct: 1315 FWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPI 1372

Query: 287  NNYSSKLIN-----LIIIMLAENPNLRPNIYQVL-HNICSI 321
               + K+I+      +      NP  RP   ++L H  C +
Sbjct: 1373 PEDTQKIISAEGKEFLDACFEINPEKRPTADELLSHPFCIV 1413

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 122/250 (48%), Gaps = 35/250 (14%)

Query: 75  VACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGF--PGFEVLLLM 132
           V  +K V+ +++  LN++  E+ ++K L    NIV+Y+         GF    +E+ +L+
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKYH---------GFIRKSYELYILL 99

Query: 133 ELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192
           E C N SL   ++ R +T L+E E    +      +  +H     ++HRDIK  N+L+ A
Sbjct: 100 EYCANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLH--GEGVIHRDIKAANILLSA 156

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 252
            N  KL DFG        V+T  + + LT    +  T  + +PE++       +   SDI
Sbjct: 157 DNTVKLADFG--------VSTIVNSSALT----LAGTLNWMAPEILGNRGASTL---SDI 201

Query: 253 WALGIFLYKLLFFTTPFE-LTGQ---FAILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
           W+LG  + ++L    P+  LT     +A+ +  Y +P +++S  L + +     +N   R
Sbjct: 202 WSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY-YPPSSFSEPLKDFLSKCFVKNMYKR 260

Query: 309 PNIYQVLHNI 318
           P   Q+L ++
Sbjct: 261 PTADQLLKHV 270

>Scas_584.11
          Length = 1074

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 86/198 (43%), Gaps = 47/198 (23%)

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
           E   EV+++ ++    NIV   D            F+  ++ME C    L + +   L  
Sbjct: 104 EAMYEVDILTKVGKHKNIVSLVDY-----------FDSYIIMEYCSGGDLYEAIKDDLVP 152

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN-NFKLCDFGSTSTKFP 209
           K T K I  I   +  A+  +H     + HRDIK EN+L+   +   KL D+G       
Sbjct: 153 KKT-KTITHIFSQIMDAIEFVH--GKSIYHRDIKPENILITGIDWTIKLTDWG------- 202

Query: 210 MVTTHQ---DIAVLTQNIYVHTTPQYRSPEMID----------LYRCLPIDEKSDIWALG 256
           + TTH+   D +V ++        +Y +PE+ +           Y+C    +K D+WA+G
Sbjct: 203 LATTHETSFDRSVGSE--------RYMAPELFESNLDIEERKEAYKC----DKVDLWAMG 250

Query: 257 IFLYKLLFFTTPFELTGQ 274
           I    ++F   PF +  Q
Sbjct: 251 IVFLNIVFQKNPFSVANQ 268

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 103/230 (44%), Gaps = 31/230 (13%)

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLT 153
           NE+ VMK  +  PNIV + DS   +        ++ ++ME     SL D +   +   LT
Sbjct: 664 NEILVMKGSK-HPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 154 EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTT 213
           E +I  +  +    +  +H     +LHRDIK +N+L+  + + KL DFG  +        
Sbjct: 713 EGQIGAVCRETLSGLEFLHS--KGVLHRDIKSDNILLSMEGDIKLTDFGFCA-------- 762

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF--EL 271
            Q   +  +   +  TP + +PE++      P   K DIW+LGI + +++    P+  E 
Sbjct: 763 -QINELNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 818

Query: 272 TGQFAILHSKYEFPK----NNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
             +   L +    PK     N SS L   +   L   P  R +  ++LH+
Sbjct: 819 PLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 109/252 (43%), Gaps = 34/252 (13%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDEN 87
           + V     E I+ + +G   ++Y ++  +  N+    ++  K +M     +KRVL + E 
Sbjct: 317 ITVEPQSFEKIRLLGQGDVGKVYLMRERD-TNQIFALKVLNKHEMIKRKKIKRVLTEQE- 374

Query: 88  GLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR 147
                      +      P IV  Y S  ++ +       + L ME C        +  R
Sbjct: 375 -----------ILATSDHPFIVTLYHSFQTKDY-------LYLCMEYCMGGEFFRALQTR 416

Query: 148 LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG----S 203
            +  + E++      +V  A+  +H L    ++RD+K EN+L+    +  L DF     +
Sbjct: 417 KSKCIAEEDAKFYASEVVAALEYLHLLG--FIYRDLKPENILLHQSGHVMLSDFDLSIQA 474

Query: 204 TSTKFPMV--TTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKSDIWALGIF 258
           T +K P +  +T+ D  + +     ++   T +Y +PE+I   R        D W LGI 
Sbjct: 475 TGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGIL 531

Query: 259 LYKLLFFTTPFE 270
           +Y++LF  TPF+
Sbjct: 532 IYEMLFGCTPFK 543

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLT 153
           NE+ VM   +   NIV Y DS  S       G ++ ++ME      L D +   +   LT
Sbjct: 611 NEIMVMSSSKHQ-NIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 154 EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTT 213
           E +I  +  +V   +  +H     +LHRDIK +NVL+    + KL DFG           
Sbjct: 660 EGQIGAVCREVLQGLEFLH--SKGVLHRDIKSDNVLLSMNGDIKLTDFG--------FCA 709

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
             +  V+ +   V  TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 710 QVNDTVIKRTTMV-GTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 83/176 (47%), Gaps = 22/176 (12%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E+  +K L   PNI+   +   + ++ G       +++E         Y+ ++   +L E
Sbjct: 100 EINALKHLT-HPNIIYLEEVLQNSKYIG-------IVLEFVSGGEFYKYIQRK--RRLKE 149

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
               ++   +   V+ MHY    L+HRD+K+EN+L+D   N  + DFG  +  F      
Sbjct: 150 SSACRLFAQLISGVNYMHY--KGLVHRDLKLENLLLDKHENLVITDFGFVNEFF------ 201

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
           +D  ++  +     +P Y +PE++   +      K+D+W+ G+ LY +L    P++
Sbjct: 202 EDNELMKTSC---GSPCYAAPELVVSTKAYEA-RKADVWSCGVILYAMLAGYLPWD 253

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 110/251 (43%), Gaps = 39/251 (15%)

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGA--PNIVQYYDSNASRRHNGFPGFEVLLLMEL 134
           C KR ++  EN +  +  E   +  L  A  P I++ Y +   + +       +  +M+L
Sbjct: 41  CSKRHII-GENKVKYVTIEKNTLNLLGQANHPGIIKLYYTFHDQEN-------LYFVMDL 92

Query: 135 CPNKSLLDYMN-QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193
            P   LL  +  QR+ ++   +  +  + D    +  M      ++HRD+K ENVL+D +
Sbjct: 93  APGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMG-----VIHRDLKPENVLLDKE 147

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK---- 249
               + DFG+  T              T  +    T +Y SPE++       ++ K    
Sbjct: 148 GRLMIADFGAAYTVGQSDAGSDGDKPATSFV---GTAEYVSPELL-------LENKSYYS 197

Query: 250 SDIWALGIFLYKLLFFTTPF------ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAE 303
           SD+WALG  LY+ L  T PF      E   Q   L   +  P N  ++ L++ I+++   
Sbjct: 198 SDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLVSKILVL--- 254

Query: 304 NPNLRPNIYQV 314
           +P+ R  + Q+
Sbjct: 255 DPSQRYTLEQI 265

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 83/179 (46%), Gaps = 28/179 (15%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E+  +K L   PN+V+  +   + ++ G       +++E         Y+ ++   +L E
Sbjct: 103 EINALKHLTH-PNVVRLEEVLQNSKYIG-------IVLEYASGGEFYKYIQRK--RRLKE 152

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
               ++   +   V+ MH     L+HRD+K+EN+L+D   N  + DFG  +   P     
Sbjct: 153 STACRLFAQLISGVTYMH--SKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLP----- 205

Query: 215 QDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
                   N Y+ T   +P Y +PE++   R   +  K+D+W+ GI LY +L    P++
Sbjct: 206 -------DNEYMKTSCGSPCYAAPELVISTRPY-VARKADVWSCGIILYAMLAGYLPWD 256

>Scas_720.103
          Length = 804

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 122/298 (40%), Gaps = 58/298 (19%)

Query: 57  FLNEFENNRMKPK-------LQMGDVACLKRVLVQDENGLNEMR--NEVEVMKQ------ 101
           F N+F++ ++ P+       L  GDV  +  V  +  NGL  M+  N+ +++K+      
Sbjct: 391 FGNKFQDIKVNPQSFEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRV 450

Query: 102 --------LQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLT 153
                       P IV  Y S  +  +       + L ME C        +  R +  + 
Sbjct: 451 ITEQEILATSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRALQTRDSKCIC 503

Query: 154 EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG----STSTKFP 209
           E +      +V  A+  +H L    ++RD+K EN+L+    +  L DF     +  +K P
Sbjct: 504 EDDARFYASEVLAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVHAKDSKNP 561

Query: 210 MVTTHQDIAVLTQNIYVHT--------------TPQYRSPEMIDLYRCLPIDEKSDIWAL 255
           +      +     N+ V T              T +Y +PE+I   R        D W L
Sbjct: 562 IFMKDGILPTTNSNLIVDTKICSEGFRTNSFVGTEEYIAPEVI---RGNGHTVAVDWWTL 618

Query: 256 GIFLYKLLFFTTPFE---LTGQFA-ILHSKYEFP-KNNYSSKLINLIIIMLAENPNLR 308
           GI ++++LF  TPF+       FA IL   +EFP  N+ +    NLI  +L +N   R
Sbjct: 619 GILIFEMLFGKTPFKGDTTNETFANILSKDFEFPNSNDITRNCKNLIKKLLTKNETKR 676

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 78/158 (49%), Gaps = 18/158 (11%)

Query: 167 AVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYV 226
           AV  +H +   ++HRDIK EN+L+D     KL DFG T+   P   ++        ++Y 
Sbjct: 236 AVDSLHNIG--IIHRDIKPENILLDKNMKVKLTDFG-TAKILPEEPSNTADGKPYFDLYA 292

Query: 227 HT-----TPQYRSPEMI-DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQF----A 276
            +     T +Y SPE++ D Y     D + DIWA G  LY++L    PF+   ++     
Sbjct: 293 KSKSFVGTAEYVSPELLNDNY----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQK 348

Query: 277 ILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQV 314
           ++  +Y F    +   + +L+  +L  +PN R  I Q+
Sbjct: 349 VMKIQYAFTA-GFPQIVKDLVKKLLVRDPNDRLTIKQI 385

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 84/191 (43%), Gaps = 41/191 (21%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           EV++  ++    NI + YD            F+  ++ME C    L + +      + T 
Sbjct: 107 EVDIQSKIGKHKNITELYDY-----------FDSYIIMEYCSGGDLYEAIKADTIPRKT- 154

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLV-DAQNNFKLCDFGSTSTKFPMVTT 213
           +++  I+  +  AV  +H     + HRDIK EN+L+ D+    KL D+G  +T       
Sbjct: 155 RQLTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWGLATT------- 205

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDL----------YRCLPIDEKSDIWALGIFLYKLL 263
             D   + +N+    + +Y +PE+ +           Y C     K DIWA+GI L  ++
Sbjct: 206 --DQTSMDRNV---GSERYMAPELFESNLDYDERNEPYEC----SKVDIWAIGIVLLNIV 256

Query: 264 FFTTPFELTGQ 274
           F   PF +  Q
Sbjct: 257 FHKNPFSVANQ 267

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 94/196 (47%), Gaps = 25/196 (12%)

Query: 74  DVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
           D   +K++ ++ +     + NE+ VM++ + + NIV + DS  ++        ++ ++ME
Sbjct: 644 DSVAIKQMNLEKQPKKELILNEILVMRESKHS-NIVNFIDSYLAK-------GDLWIVME 695

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193
                SL D +   L   L+E +I  +  +    +  +H     +LHRDIK +N+L+  +
Sbjct: 696 YMEGGSLTDVVTHCL---LSEGQIGAVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLK 750

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253
            N KL DFG     F       ++   T    +  TP + +PE++      P   K DIW
Sbjct: 751 GNIKLTDFG-----FCAQINENNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIW 798

Query: 254 ALGIFLYKLLFFTTPF 269
           +LGI + +++    P+
Sbjct: 799 SLGIMIIEMIEGEPPY 814

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 88/182 (48%), Gaps = 19/182 (10%)

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
           ++  EV +  +    PN+++  D N S+ +       + +++E+     L D +   +  
Sbjct: 61  DITKEVVLQSKCSKHPNVLRLIDCNVSKEY-------MWIILEMADGGDLFDKIEPDVGV 113

Query: 151 KLTEKEILKIMYD-VTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
              + ++ +  +  +  A++ +H +   + HRDIK EN+L+D   N KL DFG  S    
Sbjct: 114 ---DSDVAQFYFQQLVSAINYLH-VECGVAHRDIKPENILLDKNGNLKLADFGLAS---- 165

Query: 210 MVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
                +    L  ++    +P Y +PE++        D ++DIW++GI L+ LL   TP+
Sbjct: 166 --QFRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGYYAD-RTDIWSIGILLFVLLTGQTPW 222

Query: 270 EL 271
           EL
Sbjct: 223 EL 224

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 104/239 (43%), Gaps = 38/239 (15%)

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA 149
           N++  EV +  +     NI++  D N S+ +       + + ME+     L D +   + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISKDY-------LWIAMEMADGGDLFDKIEPDIG 56

Query: 150 TKLTEKEILKIMYD-VTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
               + E+ +  +  +  A+  +H +   + HRDIK EN+L+D   N KL DFG  S +F
Sbjct: 57  V---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLAS-QF 111

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
                 + +A   +      +P Y +PE+I  Y      + +DIW+ GI ++ LL   TP
Sbjct: 112 RRKDGTKRLARDQRG-----SPPYMAPEII--YSSEYYADTTDIWSCGILVFVLLTGETP 164

Query: 269 FELTGQFAILHSKYEF-------------PKNNYSSKLINLIIIMLAENPNLRPNIYQV 314
           +EL  +       Y F             P        +NL+  +L  NP+ R  I Q+
Sbjct: 165 WELPSE-----DDYNFREFLEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSKRATILQL 218

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 92/203 (45%), Gaps = 26/203 (12%)

Query: 72  MGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLL 131
           +GD   +K++++  +     + NE+ VMK  Q   NIV + ++      +      + ++
Sbjct: 538 IGDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVV 590

Query: 132 MELCPNKSLLDYMNQRLAT-----KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIE 186
           ME     SL D +   + +      +TE +I  I+ +    +  +H     ++HRDIK +
Sbjct: 591 MEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSD 648

Query: 187 NVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPI 246
           NVL+D     K+ DFG  +    +       A +        TP + +PE++        
Sbjct: 649 NVLLDTHGRVKITDFGFCAK---LTDKRSKRATMV------GTPYWMAPEVVKQRE---Y 696

Query: 247 DEKSDIWALGIFLYKLLFFTTPF 269
           DEK D+W+LGI   ++L    P+
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPY 719

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 116/258 (44%), Gaps = 38/258 (14%)

Query: 75  VACLKRVLVQ-DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
           +  +K V ++ DE+   ++  E+EV+ + Q +P+IV +Y +        F    V + ME
Sbjct: 357 IMAMKEVRLELDESKFTQILMELEVLHKCQ-SPHIVDFYGAF-------FIEGAVYMCME 408

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA- 192
                SL    +Q     + E ++  I   V   + ++  +   ++HRD+K  N+L  A 
Sbjct: 409 YMDGGSLDKCYDQDCIGGIDEPQLAYITEAVICGLKELKDVHN-IIHRDVKPTNILCSAA 467

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE---- 248
           Q   KLCDFG        V+ +   ++   NI   +   Y +PE I   + L  D+    
Sbjct: 468 QGTIKLCDFG--------VSGNLVASMAKTNIGCQS---YMAPERI---KSLNPDKSTYT 513

Query: 249 -KSDIWALGIFLYKLLFFTTPF------ELTGQFAIL--HSKYEFPKNNYSSKLINLIII 299
            +SDIW+LG+ + ++     P+       +  Q + +      + P+  +S+   + + +
Sbjct: 514 VQSDIWSLGLSILEMALGAYPYPPETYDNIFSQLSAIVDGPPPKLPQAKFSADAQDFVSM 573

Query: 300 MLAENPNLRPNIYQVLHN 317
            L + P  RPN   +L +
Sbjct: 574 CLQKVPERRPNYAALLEH 591

>Scas_544.6
          Length = 489

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 100/207 (48%), Gaps = 42/207 (20%)

Query: 85  DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMEL--CPNKSLLD 142
           +E  +N++  E+ +MK ++   NI+ +Y +  +   N     E+++LME   C +   + 
Sbjct: 194 NEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHHQNN----EIVILMEYMDCGSLDRIF 249

Query: 143 YMNQRLATKLT----EKEILK---IMYDVTYAV-SQMHYLPT--PLLHRDIKIENVLVDA 192
              +R   +      EK       I+  ++YAV + ++YL     ++HRDIK  NVL+++
Sbjct: 250 STYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGLNYLYENYKIIHRDIKPSNVLINS 309

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKS 250
           +   KLCDFG +     ++ +  D  V         T  Y SPE I  ++Y       K 
Sbjct: 310 KGLVKLCDFGVSKK---LINSIADTFV--------GTSTYMSPERIQGNVY-----STKG 353

Query: 251 DIWALGIFLYKLLFFTTPFELTGQFAI 277
           D+W+LG+ + +L        +TGQF +
Sbjct: 354 DVWSLGLMIIEL--------VTGQFPL 372

>Kwal_55.20189
          Length = 812

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 33/187 (17%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           EV++  ++    NI + YD            F+  ++ME C    L + +   L  K T 
Sbjct: 107 EVDIHTKVGKHKNITELYDF-----------FDSFIVMEYCSGGDLYEAIKADLIPKRT- 154

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN-NFKLCDFGSTSTKFPMVTT 213
           K I  I   +  A+  +H     + HRD+K EN+L++  +   KL D+G  +T+     T
Sbjct: 155 KVITHIASQIMEAIEFVHQ--KGIYHRDLKPENILIEGSDWTIKLTDWGLATTE----PT 208

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDL-----YRCLPID-EKSDIWALGIFLYKLLFFTT 267
             D +V ++        +Y +PE+ +       R  P D  K D+WA+GI L  ++F   
Sbjct: 209 SLDRSVGSE--------RYMAPELFEENLDRDERSEPYDCSKVDLWAIGIVLLNIVFQKN 260

Query: 268 PFELTGQ 274
           PF +  Q
Sbjct: 261 PFSVANQ 267

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 98/223 (43%), Gaps = 37/223 (16%)

Query: 90  NEMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLL----DY 143
           ++++ E+ +MK+   +    +++  D   SR+        + L++E C    +     D 
Sbjct: 187 DKIKREIAIMKKCHHKHVVQLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 238

Query: 144 M--NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
           M  + +  + L+ +E  +I+  V   +  +HY    ++HRDIK  N+L+      K+ DF
Sbjct: 239 MESDAKGPSLLSFQETREILRGVVLGLEYLHY--QGIIHRDIKPANLLISGDGTVKISDF 296

Query: 202 G-STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--------------DLYRCLPI 246
           G S +      +   +     +      TP + +PEM               +L+R   I
Sbjct: 297 GVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCI 356

Query: 247 DEKSDIWALGIFLYKLLF----FTTPFELTGQFAILHSKYEFP 285
               DIWA+G+ LY LLF    F + FEL     I++   +FP
Sbjct: 357 SFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFP 399

>Kwal_23.5290
          Length = 819

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 94/204 (46%), Gaps = 26/204 (12%)

Query: 71  QMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLL 130
           ++GD   +K++++  +     + NE+ VMK  Q   NIV + ++            ++ +
Sbjct: 563 EIGDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTED------DLWV 615

Query: 131 LMELCPNKSLLDYMNQRLA-----TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKI 185
           +ME     SL D +    A     + LTE +I  I+ +    +  +H     ++HRDIK 
Sbjct: 616 VMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKS 673

Query: 186 ENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLP 245
           +NVL+D +   K+ DFG  +    +       A +        TP + +PE++       
Sbjct: 674 DNVLLDNRARVKITDFGFCAK---LTDKRSKRATMV------GTPYWMAPEVVKQRE--- 721

Query: 246 IDEKSDIWALGIFLYKLLFFTTPF 269
            DEK D+W+LGI   ++L    P+
Sbjct: 722 YDEKVDVWSLGIMTIEMLEGEPPY 745

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 71/156 (45%), Gaps = 22/156 (14%)

Query: 126 FEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKI 185
           F+  ++ME C    L + +      K T K I  I+  +  A+  +H     + HRDIK 
Sbjct: 154 FDSYIIMEYCSGGDLYEAIKADAVPKKT-KSITHIITQIMDAIEYVH--NKGIYHRDIKP 210

Query: 186 ENVLVDAQN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL---- 240
           EN+L+   +   KL D+G  +T         D   + +N+    + +Y SPE+ D     
Sbjct: 211 ENILISGIDWTIKLTDWGLATT---------DKTSMDRNV---GSERYMSPELFDSNLDI 258

Query: 241 -YRCLPID-EKSDIWALGIFLYKLLFFTTPFELTGQ 274
             R  P D  K D+WA+GI    ++F   PF +  Q
Sbjct: 259 KERKEPYDCAKVDLWAMGIVFLNIVFHKNPFSIANQ 294

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 95/199 (47%), Gaps = 36/199 (18%)

Query: 89  LNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR- 147
           L+++  E +++ QL   PNI++ + ++  + +N      + +  EL P   L  Y+ +  
Sbjct: 199 LSKLDKEAKILMQLN-HPNIIKVFKTHTDKSNN------LYIFQELIPGGDLFSYLAKGD 251

Query: 148 LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFK---LCDFGST 204
               +++ E L  +Y + +A+  +H     ++HRD+K++N+L+     F    L DFG  
Sbjct: 252 CLMPISQTEALVFVYQILHALKYLH--TKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA 309

Query: 205 STKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEM---------IDLYRCLPI-----DEKS 250
            T    VTT +     ++   V  TP+Y +PE+            +R   +     D K 
Sbjct: 310 RT----VTTMK-----SRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSKC 360

Query: 251 DIWALGIFLYKLLFFTTPF 269
           D+W+LG+  + +L   +PF
Sbjct: 361 DLWSLGVITHIMLTGISPF 379

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 111/248 (44%), Gaps = 42/248 (16%)

Query: 67  KPKLQMGD-VACLKRV--LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGF 123
           K KL+ G  +  LK +  L  D+    ++  E++  K  + +  IV+YY       H+  
Sbjct: 252 KCKLRHGSKIFALKTITTLTTDQESQKQIFRELQFNKSCK-SDYIVRYYGMFTDEEHS-- 308

Query: 124 PGFEVLLLMELCPNKSLLDYMNQRL---ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180
               + + ME    +SL D + + L     ++ EK + KI   V   +S +H     ++H
Sbjct: 309 ---SIYIAMEYMGGRSL-DAIYKHLLKHGGRVGEKVLGKIAESVLRGLSYLHQ--RKIIH 362

Query: 181 RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL 240
           RDIK +N+L++     KLCDFG +      + T       T   Y      Y +PE I  
Sbjct: 363 RDIKPQNILLNEAGQVKLCDFGVSGEAVNSLAT-----TFTGTSY------YMAPERI-- 409

Query: 241 YRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIM 300
            +  P    SD+W+LG+ L ++     PF+ +G+FA        P        I L++++
Sbjct: 410 -QGQPYSVTSDVWSLGLTLLEVAQAHFPFD-SGKFAA-----NMPP-------IELLMLI 455

Query: 301 LAENPNLR 308
           L   P L+
Sbjct: 456 LTFTPQLK 463

>Kwal_47.17263
          Length = 1127

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 115/274 (41%), Gaps = 57/274 (20%)

Query: 84  QDENGLNEMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLL 141
           ++ NG ++++ E+ +MK+   +    +V+  D + SR+        + L++E C    + 
Sbjct: 150 KNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRK--------IYLVLEYCSKGEVK 201

Query: 142 DYMNQRLATK------LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
                +L T+      LT +   +I   V   +  +HY    ++HRDIK  N+L+     
Sbjct: 202 WCPGDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHY--QGIIHRDIKPANLLISESGT 259

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT--TPQYRSPEMIDLY----RCLP---- 245
            K+ DFG     F    +      L +     T  TP + +PE+   +    R  P    
Sbjct: 260 VKISDFG---VSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPS 316

Query: 246 ------IDEKSDIWALGIFLYKLLFFTTPF----------ELTGQFAILHSKYEFPKNNY 289
                 I    DIWA+G+ L+ LLF   PF          ++  Q  +L + YE   +N 
Sbjct: 317 SDHGSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKT-YEEMASNG 375

Query: 290 SSKLIN---------LIIIMLAENPNLRPNIYQV 314
            SK+ N         L+  +L +NP  R  I ++
Sbjct: 376 ISKISNQEEYEAAKDLLGRLLTKNPFKRIKIAEI 409

>Scas_548.6
          Length = 1382

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 83/171 (48%), Gaps = 22/171 (12%)

Query: 150  TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
            T +TE E   I   +   +  +H     ++HRDIK ENV+VD++   K+ DFGS +    
Sbjct: 1226 TNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAY--- 1280

Query: 210  MVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTT 267
                   +     +++V T   Y +PE++  + Y   P     DIWA+GI LY ++F   
Sbjct: 1281 -------VKSGPFDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVFKEN 1328

Query: 268  PFELTGQFAILHSKYEF-PKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
            PF    +  IL  + +F   N+ S   I LI  +L  +   RP I ++ ++
Sbjct: 1329 PFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIFND 1377

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 19/124 (15%)

Query: 148 LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
           L T +TE E   I   V   +  +H     ++HRDIK EN++VD +   KL DFGS +  
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY- 141

Query: 208 FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFF 265
                    +     +++V T   Y +PE++  D Y   P     DIWA+G+ LY ++F 
Sbjct: 142 ---------VKSGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIFK 187

Query: 266 TTPF 269
             PF
Sbjct: 188 ENPF 191

>Scas_720.94
          Length = 1683

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 103/261 (39%), Gaps = 48/261 (18%)

Query: 40   YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEM----RNE 95
            +I  G F  +Y+                  L  G++  +K + +QD   + ++    + E
Sbjct: 1366 FIGGGTFGTVYSA---------------VNLDNGEILAVKEIKIQDSKTMKKIFPLVKEE 1410

Query: 96   VEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEK 155
            + V++ L   PNIVQYY     R        +V + ME C   S    M   L     E 
Sbjct: 1411 MTVLEML-NHPNIVQYYGVEVHRD-------KVNIFMEYCEGGS----MASLLEHGRIED 1458

Query: 156  EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGST------STKFP 209
            E++  +Y +       +     ++HRDIK EN+L+D     K  DFG+        TK  
Sbjct: 1459 EMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVT 1518

Query: 210  MVTTHQDIAVLTQNIY-------VHT---TPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 259
             + +                   VH    TP Y +PE I  Y+        DIW+ G  +
Sbjct: 1519 NINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVV 1578

Query: 260  YKLLFFTTPFE-LTGQFAILH 279
             +++    P+  L  ++AI++
Sbjct: 1579 LEMITGRRPWANLDNEWAIIY 1599

>Scas_668.22
          Length = 893

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 102/239 (42%), Gaps = 43/239 (17%)

Query: 48  QIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNE---------------- 91
           Q+YA K  E  +E + +++   L          V + +E G NE                
Sbjct: 593 QLYA-KLKEICSEGDPSKIYTNLVKIGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKE 651

Query: 92  -MRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
            + NE+ VMK  +  PNIV + DS            ++ ++ME     SL D +   +  
Sbjct: 652 LIINEILVMKGSR-HPNIVNFIDSY-------LLDGDLWVIMEYMEGGSLTDVVTHCI-- 701

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
            LTE +I  +  +    +  +H     +LHRDIK +N+L+    + KL DFG  +     
Sbjct: 702 -LTEGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSISGDIKLTDFGFCA----- 753

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
               Q   +  +   +  TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 754 ----QINEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/303 (21%), Positives = 126/303 (41%), Gaps = 62/303 (20%)

Query: 22  YTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV 81
           YT   +   G    E+++ + +G F Q+Y V            R K  +++  +  L + 
Sbjct: 312 YTSTKKRQYGPQDFEVLRLLGKGTFGQVYQV------------RKKDTMRIYAMKVLSKK 359

Query: 82  LVQDENGLNEMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKS 139
           ++  +N +     E  ++ +   + +P IV    S  +         ++ L+ +      
Sbjct: 360 VIVKKNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPT-------DLYLVTDFMSGGE 412

Query: 140 LLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLC 199
           L  ++ +    + TE      + ++  A+  +H     +++RD+K EN+L+DA  N  LC
Sbjct: 413 LFWHLQKE--GRFTEDRAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALC 468

Query: 200 DFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-----DIWA 254
           DFG +       T          N +  TT +Y +PE++       +DE       D W+
Sbjct: 469 DFGLSKADLKDRT----------NTFCGTT-EYLAPELL-------MDETGYTKMVDFWS 510

Query: 255 LGIFLYKLLFFTTPFELTGQFA---------ILHSKYEFPKNNYSSKLINLIIIMLAENP 305
           LG+ ++++    +PF     FA         I   K +FP++  S +  + +  +L  NP
Sbjct: 511 LGVLIFEMCCGWSPF-----FASDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNP 565

Query: 306 NLR 308
             R
Sbjct: 566 KHR 568

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 78/164 (47%), Gaps = 20/164 (12%)

Query: 150  TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
            T +TE E   +   V   V  +H     ++HRDIK EN++VD+Q   K+ DFGS +    
Sbjct: 1180 TNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAY--- 1234

Query: 210  MVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK-SDIWALGIFLYKLLFFTTP 268
                   +     +++V T   Y +PE++      P + K  DIWA+GI LY ++F   P
Sbjct: 1235 -------VKSGPFDVFVGTI-DYAAPEVLG---GSPYEGKPQDIWAIGILLYTIVFKENP 1283

Query: 269  FELTGQFAILHSKYEFPKNNY-SSKLINLIIIMLAENPNLRPNI 311
            F    +  IL  + +F  +   S +   LI  +L  N   RP I
Sbjct: 1284 FYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 112/248 (45%), Gaps = 40/248 (16%)

Query: 36  EIIKYIAEGGFAQIYAVK---------FIEFLNEFENNRMKPKLQMGDVACLKRVLVQDE 86
           ++I+   +G    +Y  +          IE +N   N+  +P   +GD   +K++++  +
Sbjct: 547 KVIEKAGQGASGSVYLAERTHIPTESNMIELIN---NDIDEP--HVGDKVAIKQMVLSKQ 601

Query: 87  NGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYM-- 144
                + NE+ VMK  +   NIV + +  A  R +     ++ ++ME     SL D +  
Sbjct: 602 PRKELIVNEILVMKDSRHK-NIVNFLE--AYLRTDD----DLWVVMEFMEGGSLTDIIEN 654

Query: 145 ---NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
              N    + LTE +I  I+ +    +  +H     ++HRDIK +NVL+D +   K+ DF
Sbjct: 655 SPTNDNSHSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRARVKITDF 712

Query: 202 GSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYK 261
           G  +    +       A +        TP + +PE++        DEK D+W+LGI   +
Sbjct: 713 GFCAR---LTDKRSKRATMV------GTPYWMAPEVVKQRE---YDEKIDVWSLGIMTIE 760

Query: 262 LLFFTTPF 269
           +L    P+
Sbjct: 761 MLEGEPPY 768

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 83/198 (41%), Gaps = 29/198 (14%)

Query: 77  CLKRVLVQDE----NGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLM 132
           C  +V+ ++E    N   + R EVE+   L   PN+ + Y      +        V LLM
Sbjct: 130 CALKVMEKEEIIKYNLQKQFRREVEIQTSL-NHPNLTKSYGYFHDEK-------RVYLLM 181

Query: 133 ELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192
           E   N  +  Y   RL     +      +Y +  A+  MH     ++HRDIK EN+L+  
Sbjct: 182 EYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPENILIGF 237

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDI 252
            N  KL DFG +    P            +   V  T  Y SPEM++       D   D 
Sbjct: 238 NNVIKLTDFGWSIINPPE----------NRRKTVCGTIDYLSPEMVE---SREYDHTIDA 284

Query: 253 WALGIFLYKLLFFTTPFE 270
           WALG+  ++LL    PFE
Sbjct: 285 WALGVLAFELLTGAPPFE 302

>YOR267C (HRK1) [5054] chr15 complement(822585..824864)
           Serine/threonine protein kinase involved in regulation
           of plasma membrane ATPase (Pma1p) activity, has
           similarity to members of the NPR1 subfamily [2280 bp,
           759 aa]
          Length = 759

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 83/171 (48%), Gaps = 29/171 (16%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVT 165
           PN+++  D  +  + N +  +EV   ME CP    +D+    +  K++  EI   +  +T
Sbjct: 275 PNVIETVDVFSDSKQNKY--YEV---MEYCP----IDFFAVVMTGKMSRGEINCCLKQLT 325

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNI 224
             V  +H +   L HRD+K++N ++ +Q   KL DFGS    ++P     +D   +   I
Sbjct: 326 EGVKYLHSMG--LAHRDLKLDNCVMTSQGILKLIDFGSAVVFRYPF----EDGVTMAHGI 379

Query: 225 YVHTTPQYRSPEMIDLYR-----CLPIDEKSDIWALGIFLYKLLFFTTPFE 270
            V + P Y +PE+I   +     C+      DIW++GI    ++    P++
Sbjct: 380 -VGSDP-YLAPEVITSTKSYDPQCV------DIWSIGIIYCCMVLKRFPWK 422

>Kwal_26.7861
          Length = 955

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLT 153
           NE+ VMK  + A NIV + DS   R        ++ ++ME     SL D +   +   LT
Sbjct: 711 NEILVMKASKHA-NIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 154 EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTT 213
           E +I  +  +    +  +H     ++HRDIK +NVL+      KL DFG  +        
Sbjct: 760 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFGFCA-------- 809

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
            Q   +  +   +  TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 810 -QINEINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 134/338 (39%), Gaps = 80/338 (23%)

Query: 14   TVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMG 73
            T+  N  R + G        K EII    +G F  +Y       LN          +  G
Sbjct: 1020 TISINKSRNSRGEYKEFAWIKGEII---GKGSFGAVYLA-----LN----------VTTG 1061

Query: 74   DVACLKRVLV-----QDENGLN---EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPG 125
            ++  +K+V V     QDE+ ++    +++EV  +K L    NIVQY             G
Sbjct: 1062 EMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNHV-NIVQYL------------G 1108

Query: 126  FE-----VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180
            FE       L +E     S+   +  R+  +  ++ I  +   V   ++ +H     +LH
Sbjct: 1109 FEEKNGIYSLFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLEGLAYLHS--KGILH 1164

Query: 181  RDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT------TPQYRS 234
            RD+K +N+L+D     K+ DFG              I+  + NIY ++      T  + +
Sbjct: 1165 RDMKADNLLLDNDGVCKISDFG--------------ISRKSNNIYSNSDMTMRGTVFWMA 1210

Query: 235  PEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE----LTGQFAILHSKYEFPKNNYS 290
            PEM+D         K DIW+LG  + ++     P+     +   F I  SK   P  + +
Sbjct: 1211 PEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPIPDDT 1268

Query: 291  SKLI-----NLIIIMLAENPNLRPNIYQVL-HNICSIS 322
              L+     + +      +P +RP    ++ H  C  S
Sbjct: 1269 KDLVSPAGQSFLDQCFEIDPEMRPTADSLVGHPFCKTS 1306

>AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH]
           (348350..350533) [2184 bp, 727 aa]
          Length = 727

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 107/230 (46%), Gaps = 36/230 (15%)

Query: 38  IKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVE 97
           +  +  G F+ +Y V F E   ++    M PK         +  ++Q+   L+E+  E  
Sbjct: 395 VTLLGRGQFSTVYQVTFPETSAKYAVKSMAPKKHYS-----RSRIIQEIQLLSEISQET- 448

Query: 98  VMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK---LTE 154
                +G   +VQ+    +S  + G        + ELC N +L  ++ ++L  +   L +
Sbjct: 449 --SDAEGREYVVQFI---SSWEYQG----TYYAMTELCENGNLDQFLQEQLVARSKRLED 499

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
             I KI+ +V   +  +H   + ++H D+K  N+++  + N KL DFG  +TK P+    
Sbjct: 500 WRIWKIIVEVCLGLRFLHETCS-IVHLDLKPANIMITFEGNLKLGDFG-MATKLPLT--- 554

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMID--LYRCLPIDEKSDIWALGIFLYKL 262
            D A   +        +Y +PE+I   +Y     D ++DI++LG+ + ++
Sbjct: 555 -DKAFENEG-----DREYIAPEIISDGIY-----DFRADIFSLGLMIVEI 593

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 122/247 (49%), Gaps = 33/247 (13%)

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
             +K V  QD++ L ++ +E++++K L    NIV+Y+     ++HN +      +++E C
Sbjct: 48  VAIKEVNYQDDDELVDIMSEIDLLKNLNHI-NIVKYH-GFIQKQHNLY------IILEYC 99

Query: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195
              SL + +++     ++E E    +      ++ +H     ++HRDIK  N+L+D++N 
Sbjct: 100 AKGSLKNLISRN--RPMSEHEAKPYVRQTLNGLNYLH--EQGVIHRDIKAANILLDSENV 155

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255
            KL DFG        V+T  +   +T    +  +  + +PE+I       +   SDIW+L
Sbjct: 156 VKLADFG--------VSTKVNNTAMT----LAGSLNWMAPEIIGNRGASTL---SDIWSL 200

Query: 256 GIFLYKLLFFTTPF----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNI 311
           G  + +LL    PF    ++   +AI +  Y FP ++ SS   + +    A+N   RP  
Sbjct: 201 GATVVELLTGNPPFHNLIDMNIYYAIENDSY-FPPSSLSSGAKDFLQQCFAKNMYKRPTA 259

Query: 312 YQVL-HN 317
            Q+L HN
Sbjct: 260 VQLLQHN 266

>Scas_703.5
          Length = 749

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 121/292 (41%), Gaps = 58/292 (19%)

Query: 31  GAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLN 90
           G +  E+++ + +G F Q+Y VK           +   ++    V   K ++ ++E    
Sbjct: 340 GPNDFEVLRLLGKGTFGQVYQVK----------KKDTKRIYAMKVLSKKVIVKKNEVAHT 389

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
                + V    + +P IV    S  +         ++ L+ +      L  ++ +    
Sbjct: 390 IGERNILVTTATKASPFIVGLKFSFQTPT-------DLYLVTDFMSGGELFWHLQKE--G 440

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
           + TE+     + ++  A+  +H     +++RD+K EN+L+DA  N  LCDFG +      
Sbjct: 441 RFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD 498

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-----DIWALGIFLYKLLFF 265
            T          N +  TT +Y +PE++       +DE       D W+LG+ ++++   
Sbjct: 499 RT----------NTFCGTT-EYLAPELL-------LDEAGYTKMVDFWSLGVLIFEMCCG 540

Query: 266 TTPFELTGQFA---------ILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
            +PF     FA         I   K +FP++  S +  + +  +L  NP  R
Sbjct: 541 WSPF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 587

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 96/199 (48%), Gaps = 36/199 (18%)

Query: 82  LVQDENGLNEMRNEVEVMKQLQGA-----PNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
           L++ ++  N+ R EV++ +++        PNIV+  +   + R+ G       +++E   
Sbjct: 81  LIKRDSISNDYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIG-------IVLEYAC 133

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTP-LLHRDIKIENVLVDAQNN 195
                 Y+ ++   +L E    ++   +   +S +HY+ +  L+HRD+K+EN+L+D   N
Sbjct: 134 GGEFYKYIQKK--RRLKEMNACRLFSQL---ISGVHYIHSKGLVHRDLKLENLLLDKNEN 188

Query: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPID-EKSD 251
             + DFG  +               ++N  + T   +P Y +PE++      P +  K+D
Sbjct: 189 LVITDFGFVN------------EFCSRNELMKTSCGSPCYAAPELV--ISAEPYEARKAD 234

Query: 252 IWALGIFLYKLLFFTTPFE 270
           IW+ G+ LY +L    P++
Sbjct: 235 IWSCGVILYAILAGYLPWD 253

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 108/238 (45%), Gaps = 27/238 (11%)

Query: 37  IIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEV 96
           +++   +G    +Y  + ++ L  +++     K Q+G+   +K++++  +     + NE+
Sbjct: 590 MVEKAGQGASGSVYLAERLQ-LPPYKDELEAEKNQLGNKVAIKQMILSKQPRKELIVNEI 648

Query: 97  EVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA-----TK 151
            VMK  +   NIV + ++            ++ ++ME     SL D +          + 
Sbjct: 649 LVMKDSKHN-NIVNFLEAYLKTED------DLWVVMEYMEGGSLTDIIENSPTGSSGQSP 701

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           LTE +I  I+ +    +  +H     ++HRDIK +NVL+D +   K+ DFG  +    + 
Sbjct: 702 LTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAK---LT 756

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
                 A +        TP + +PE++        DEK D+W+LGI   ++L    P+
Sbjct: 757 DKRSKRATMV------GTPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLESEPPY 805

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 112/256 (43%), Gaps = 38/256 (14%)

Query: 75  VACLKRVLVQ-DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
           +  +K V ++ DE+   ++  E+EV+   Q +P IV +Y +        F    V + ME
Sbjct: 443 IMAMKEVRLELDESKFRQILMELEVLHNCQ-SPYIVDFYGAF-------FIEGAVYMCME 494

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA- 192
                SL    +      + E ++ +I   V   + ++  +   ++HRD+K  N+L  A 
Sbjct: 495 YMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVHN-IIHRDVKPTNILCSAS 553

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE---- 248
           Q   KLCDFG        V+ +   ++   NI   +   Y +PE I   + L  D+    
Sbjct: 554 QGTIKLCDFG--------VSGNLVASLAKTNIGCQS---YMAPERI---KSLNPDKSTYS 599

Query: 249 -KSDIWALGIFLYKLLFFTTPF---ELTGQFAILHSKYE-----FPKNNYSSKLINLIII 299
            +SDIW+LG+ + ++     P+        F+ L +  +      P+  +S+   N + +
Sbjct: 600 VQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSM 659

Query: 300 MLAENPNLRPNIYQVL 315
            L + P  RP    +L
Sbjct: 660 CLQKIPERRPTYAALL 675

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 105/241 (43%), Gaps = 39/241 (16%)

Query: 90  NEMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR 147
           ++++ E+ +MK+   +    +++  D   SR+        + L++E C    +       
Sbjct: 194 DKIKREIAIMKKCHHKHVVKLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 245

Query: 148 LATK------LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201
           L T+      L+ +   +I+  V   +  +HY    ++HRDIK  N+L+      K+ DF
Sbjct: 246 LETEAKGPSPLSFQFTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVKISDF 303

Query: 202 G-STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--------------DLYRCLPI 246
           G S +     V    +     +      TP + +PE+               +L++   I
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 247 DEKSDIWALGIFLYKLLF----FTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLA 302
             K DIWALG+ LY L+F    F + FEL     I++   +FPK  YS  L N  ++ + 
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPK--YSDMLKNNQVLQMT 421

Query: 303 E 303
           E
Sbjct: 422 E 422

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 78/150 (52%), Gaps = 22/150 (14%)

Query: 163 DVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQ 222
           +VT A+  +H+    +++RD+K EN+L+D   + K+ DFG            +++  +T 
Sbjct: 157 EVTLALEYLHF--HNIIYRDLKPENILLDRNGHIKITDFGFA----------KEVETVTW 204

Query: 223 NIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQF----AIL 278
            +    TP Y +PE+I      P ++  D W+LG+ +Y++L   TPF  T        IL
Sbjct: 205 TL--CGTPDYIAPEVI---ATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 279 HSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
           H K  +P+  ++S +I+L+  +L  +   R
Sbjct: 260 HGKVVYPQ-FFNSDVIDLLSKLLTADLTRR 288

>Scas_640.14*
          Length = 728

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 102/228 (44%), Gaps = 39/228 (17%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E+  +K L   PNIV+  +   + ++ G       +++E         Y+ ++   +L E
Sbjct: 96  EINSLKHLTH-PNIVRLEEVLQNSKYIG-------IVLEYASGGEFYKYVQRK--RRLKE 145

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
               ++   +   VS MH     ++HRD+K+EN+L+D   N  + DFG  +  +      
Sbjct: 146 ATACRLFAQLISGVSYMH--SKGIVHRDLKLENLLLDKHENLIITDFGFVNEFY------ 197

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMI---DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFEL 271
            D  ++  +     +P Y +PE++   + Y+      K+DIW+ GI LY +L    P++ 
Sbjct: 198 ADNELMKTSC---GSPCYAAPELVITTEPYKA----RKADIWSCGIILYGMLAGYLPWDD 250

Query: 272 TGQ-----------FAILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
             Q             I  +  +FP+ +Y++ L   +  +L  NP  R
Sbjct: 251 DKQNPNGEDIVRLYHYITKTPLKFPRIHYTTFLGICLRHILVSNPVRR 298

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 127/310 (40%), Gaps = 61/310 (19%)

Query: 40   YIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEM----RNE 95
            +I  G F ++Y+                  L  G++  +K + +QD   + ++    + E
Sbjct: 1271 FIGGGTFGRVYSA---------------VDLDNGEILAVKEINIQDSKSMQKIFPLIKEE 1315

Query: 96   VEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEK 155
            + V++ L   PNIV YY     R        +V + ME C   SL       L     E 
Sbjct: 1316 MSVLEILN-HPNIVSYYGVEVHRD-------KVNIFMEYCEGGSLA----ALLEHGRIED 1363

Query: 156  EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGST------STKFP 209
            E++  +Y +       +   + ++HRD+K EN+L+D     K  DFG+        T+  
Sbjct: 1364 EMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLA 1423

Query: 210  MVTT-------HQDIAVLTQNIYVHT----------TPQYRSPEMIDLYRCLPIDEKSDI 252
             +         H+D+  ++ +  V            TP Y +PE I            D+
Sbjct: 1424 SMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDV 1483

Query: 253  WALGIFLYKLLFFTTPFE-LTGQFAILHSKY-----EFP-KNNYSSKLINLIIIMLAENP 305
            W+LG  + +++    P+  L  ++AI++        +FP K+  SS  +  +   L +NP
Sbjct: 1484 WSLGCVVLEMITGRRPWANLDNEWAIMYHVAAGHTPQFPTKDEVSSAGMKFLERCLIQNP 1543

Query: 306  NLRPNIYQVL 315
            + R +  ++L
Sbjct: 1544 SKRASAVELL 1553

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 126/313 (40%), Gaps = 62/313 (19%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQ--D 85
           + V     E ++ + +GG  ++Y VK  +                  V  LKRV     D
Sbjct: 465 ITVNGTAYEKVELLGKGGSGKVYKVKSSDH----------------KVYALKRVSFDEFD 508

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           E+ ++  + E+E++K+L+    +V+  D +         G  VL L+  C    L   + 
Sbjct: 509 ESSIDGFKGEIELLKKLENKQRVVKLIDYHM--------GQGVLFLLMECGEHDLSQVLT 560

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
           QR       + +     ++   V  +H     ++H D+K  N  V  +   K+ DFG  +
Sbjct: 561 QRSKIPFDTEFVRYHFQEMIKCVKVVH--DADIVHSDLKPAN-FVFVKGMLKIIDFGIAN 617

Query: 206 TKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRC---------LPIDEKSDIW 253
                V  H      T NIY      TP Y +PE +                + + SD+W
Sbjct: 618 A----VPDH------TVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVW 667

Query: 254 ALGIFLYKLLFFTTPF-ELTGQ---FAILHSKYEFP---KNNYSS----KLINLIIIMLA 302
           + G  LY++++   P+    G    +AI++   + P   K+++ +     +I+ I   L 
Sbjct: 668 SCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLE 727

Query: 303 ENPNLRPNIYQVL 315
            NP  R  I Q+L
Sbjct: 728 RNPISRVTIDQLL 740

>Kwal_33.14081
          Length = 580

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 113/255 (44%), Gaps = 32/255 (12%)

Query: 75  VACLKRVLVQ-DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
           +  +K V ++ DE+   ++  E+EV+ + Q +P IV +Y +        F    V + ME
Sbjct: 299 IMAMKEVRLELDESKFTQILMELEVLHKCQ-SPYIVDFYGAF-------FIEGAVYMCME 350

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA- 192
                SL    +  +   + E E+  I   +   + ++  +   ++HRD+K  NVL  A 
Sbjct: 351 YMDGGSLDKSYDSDVLGGIDEPELAYIANAIIQGLKELKDVHN-IIHRDVKPTNVLCSAA 409

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRC--LPIDEKS 250
           Q   KLCDFG        V+ +   ++   NI   +   Y +PE I  +         +S
Sbjct: 410 QGTVKLCDFG--------VSGNLVASLAKTNIGCQS---YMAPERIKSFNPDKATYTVQS 458

Query: 251 DIWALGIFLYKLLFFTTPFEL-------TGQFAILHS-KYEFPKNNYSSKLINLIIIMLA 302
           DIW+LG+ + ++   T P+ +       +   AI+ S   + PK  +S    + + + L 
Sbjct: 459 DIWSLGLSILEMAIGTYPYPVETFDNIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQ 518

Query: 303 ENPNLRPNIYQVLHN 317
           + P  R N   +L +
Sbjct: 519 KIPERRRNYAALLEH 533

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 97/202 (48%), Gaps = 33/202 (16%)

Query: 75  VACLKR-VLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
           +  +KR  + +D +   ++  E+  +K L   PNIV+  +   + ++ G       +++E
Sbjct: 96  IKLIKRDFITKDPSKETKIYREINALKHL-SHPNIVKLEEVLQNSKYIG-------IVLE 147

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTP-LLHRDIKIENVLVDA 192
                    ++ ++   +L E    ++   +   +S +HY+ +  L+HRD+K+EN+L+D 
Sbjct: 148 YAAGGEFYKFIQRK--RRLKENHACRLFSQL---ISAVHYIHSKGLVHRDLKLENLLLDN 202

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPID-E 248
           + N  + DFG  +              L QN  + T   +P Y +PE++   R  P D  
Sbjct: 203 EENLIITDFGFVN------------EFLRQNGMMKTSCGSPCYAAPELVVSNR--PYDAR 248

Query: 249 KSDIWALGIFLYKLLFFTTPFE 270
           K+D W+ GI L+ +L    P++
Sbjct: 249 KADTWSCGIILFAMLAGYLPWD 270

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 115/262 (43%), Gaps = 46/262 (17%)

Query: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136
            LKR L  +E  L  + +E+ ++++L   PNIV++ D   SR        +  ++ +L  
Sbjct: 87  LLKRALKGNE--LQMLYDELSILQKLD-HPNIVKFKDWFESRE-------KFYIVTQLAT 136

Query: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLV---DAQ 193
              L D + ++   K TE + +KI+  +  AV  MH     ++HRD+K ENVL      +
Sbjct: 137 GGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMH--SQNVVHRDLKPENVLYLDPSDE 192

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIY-VHTTPQYRSPEMIDLYRCLPIDEKSDI 252
           +   + DFG            + ++  +Q I+    +  Y +PE++         +  DI
Sbjct: 193 SQLVISDFG----------IAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH---GKPCDI 239

Query: 253 WALGIFLYKLLFFTTPF--ELTGQF----------AILHSKYEFPKNNYSSKLINLIIIM 300
           W+LG+  Y LL   +PF  E T  F             HS Y    NN S +    I+  
Sbjct: 240 WSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYW---NNISKEAKQFILRA 296

Query: 301 LAENPNLRPNIYQVLHNICSIS 322
           L   P  RP   ++L +   +S
Sbjct: 297 LTLTPARRPTAAELLTDRWIVS 318

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 128/316 (40%), Gaps = 65/316 (20%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQ--D 85
           + V   + E I+ +  GG +++Y VK          NR         V  LKRV     D
Sbjct: 433 ITVNDSQYEKIELLGRGGSSRVYKVKG-------SGNR---------VYALKRVSFDAFD 476

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           ++ ++  + E+E++++L+    ++Q  D           G  +L L+  C +  L   +N
Sbjct: 477 DSSIDGFKGEIELLEKLKDQKRVIQLLDYEM--------GDGLLYLIMECGDHDLSQILN 528

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
           QR    L    +     ++   +  +H     ++H D+K  N ++  +   K+ DFG  +
Sbjct: 529 QRSGMPLDFNFVRFYTKEMLLCIKVVH--DAGIVHSDLKPANFVL-VKGILKIIDFGIAN 585

Query: 206 TKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRC------------LPIDEKS 250
                V  H      T NIY  T   TP Y +PE +                   +   S
Sbjct: 586 A----VPEH------TVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPS 635

Query: 251 DIWALGIFLYKLLFFTTPF-ELTGQ---FAILHSKYEFPKNNYSS-------KLINLIII 299
           D+W+ G  +Y++++   P+    GQ    AI++   + P   ++S         I L+  
Sbjct: 636 DMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKA 695

Query: 300 MLAENPNLRPNIYQVL 315
            L  NP+ R  + +VL
Sbjct: 696 CLYRNPDKRWTVDKVL 711

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 81/166 (48%), Gaps = 22/166 (13%)

Query: 152  LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
            + E E   +   V  ++  +H     ++HRDIK ENV+VD+    KL DFGS +      
Sbjct: 947  MVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAY----- 999

Query: 212  TTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
                 I     +++V T   Y +PE++    Y+  P     DIWALG+ LY +++   P+
Sbjct: 1000 -----IKSGPFDVFVGTM-DYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY 1049

Query: 270  ELTGQFAILHSKYEFPKNNY-SSKLINLIIIMLAENPNLRPNIYQV 314
                +  IL  +  F K+ + S + I+LI  +L    + RP I ++
Sbjct: 1050 YNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

>Scas_633.29
          Length = 789

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 130/313 (41%), Gaps = 62/313 (19%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQ--D 85
           + V   + E I+ +  GG +++Y VK         N++ K       V  LKRV     D
Sbjct: 293 ITVNDTEYEKIELLGRGGSSRVYKVK---------NSQNK-------VFALKRVSFDEFD 336

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           ++ ++  + E+E++++L     +V+ +D              VL L+  C +  L   ++
Sbjct: 337 DSSVDGFKGEIELLEKLSNESRVVKLFDYQMDS--------GVLFLIMECGDHDLSQILS 388

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
           QR    L    +     +V   +  +H     ++H D+K  N  V  +   K+ DFG  +
Sbjct: 389 QRSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVFVKGILKIIDFGIAN 445

Query: 206 TKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMI---------DLYRCLPIDEKSDIW 253
                +  H      T NIY      TP Y +PE +         D      + + SDIW
Sbjct: 446 A----IPDH------TVNIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIW 495

Query: 254 ALGIFLYKLLFFTTPFE-LTGQ---FAILHSKY-----EFPKNNYS--SKLINLIIIMLA 302
           + G  +Y++++   P+    GQ    AI++        E   NN S    LI+L+   L 
Sbjct: 496 SCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLT 555

Query: 303 ENPNLRPNIYQVL 315
            +P  R ++ QVL
Sbjct: 556 RDPEKRWSVDQVL 568

>Kwal_26.7154
          Length = 1213

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 19/124 (15%)

Query: 148  LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
            + T +TE E + I   +   +  +H     ++HRDIK ENV+VD     K+ DFGS +  
Sbjct: 1055 MKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAY- 1111

Query: 208  FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFF 265
                     +     +++V T   Y +PE++  + Y   P     DIWA+G+ LY +++ 
Sbjct: 1112 ---------VKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYK 1157

Query: 266  TTPF 269
              PF
Sbjct: 1158 ENPF 1161

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 51/237 (21%)

Query: 91  EMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL 148
           ++R E+ +MK+   +    +++  D   SR+        + L++E C    +      +L
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSRK--------IYLVLEYCSKGEVKWCPGDQL 212

Query: 149 ATK------LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
                    LT +   +I+  V   +  +HY    ++HRDIK  N+L+   +  K+ DFG
Sbjct: 213 EAAARGPPLLTFQRTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSEHDIVKISDFG 270

Query: 203 ----STSTKFPMVTTHQDIAVL----------TQNIYVHTTPQYRSPEMI---DLYRCLP 245
               S+++  P   +    +V            +      TP + +PE+    D Y  L 
Sbjct: 271 VSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLN 330

Query: 246 IDEKS------------DIWALGIFLYKLLFFTTPF----ELTGQFAILHSKYEFPK 286
           ID +S            DIWALG+ LY LLF   PF    E+     I++   EFP+
Sbjct: 331 IDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPR 387

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 122/294 (41%), Gaps = 62/294 (21%)

Query: 31  GAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLN 90
           G    E+++ + +G F Q+Y V            R K   ++  +  L + ++  +N + 
Sbjct: 300 GPQDFEVLRLLGKGTFGQVYQV------------RKKDTKRIYAMKVLSKKVIVKKNEIA 347

Query: 91  EMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL 148
               E  ++ +   +  P IV    S  +         ++ L+ +      L  ++ +  
Sbjct: 348 HTIGERNILVRTASKSCPFIVGLKFSFQTPT-------DLYLVTDFLSGGELFWHLQKE- 399

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
             + TE+     + ++  A+  +H     +++RD+K EN+L+DA  N  LCDFG +    
Sbjct: 400 -GRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADL 456

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-----DIWALGIFLYKLL 263
              T          N +  TT +Y +PE++       +DE       D W+LG+ ++++ 
Sbjct: 457 KDRT----------NTFCGTT-EYLAPELL-------LDETGYTKMVDFWSLGVLIFEMC 498

Query: 264 FFTTPFELTGQFA---------ILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
              +PF     FA         I   K +FP++  S +  + +  +L  NP  R
Sbjct: 499 CGWSPF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 547

>Kwal_33.14167
          Length = 838

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 129/313 (41%), Gaps = 62/313 (19%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQ--D 85
           V V   + E ++ +  GG +++Y VK         NN+         V  LKRV     D
Sbjct: 508 VYVNGTEYEKLELLGRGGTSKVYKVK------NANNNK---------VYALKRVSFDEFD 552

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           ++ ++  + E+E++K+L+  P +V+  D      H    G  VL ++  C +  L   + 
Sbjct: 553 DSSIDGFKGEIELLKKLETQPRVVKLID------HEMDHG--VLYVVMECGDHDLSQTLA 604

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS 205
            R    L  + +     ++   V  +H     ++H D+K  N  V  +   K+ DFG  +
Sbjct: 605 HRSGMPLDVEFVRYHAQEMLKCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFGIAN 661

Query: 206 TKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMIDLYRC----------LPIDEKSDI 252
                V  H      T NIY  T   TP Y +PE +                 + + SDI
Sbjct: 662 A----VPEH------TVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSDI 711

Query: 253 WALGIFLYKLLFFTTPF-ELTGQ---FAILHS--KYEFPK-----NNYSSKLINLIIIML 301
           W+ G  +Y++++   P+    GQ    AI++   K  +P+     +      I+ +   L
Sbjct: 712 WSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACL 771

Query: 302 AENPNLRPNIYQV 314
             NPN R  + +V
Sbjct: 772 ERNPNKRWTVEEV 784

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 130/285 (45%), Gaps = 38/285 (13%)

Query: 41  IAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMK 100
           +  G ++ +Y       L++  NN   P+       C K+ +++ EN +  +  E   + 
Sbjct: 16  LGHGSYSTVYKA-----LDKARNNSGLPQHFYAIKVCSKKHIIR-ENKVKYVTIEKNTLN 69

Query: 101 QL-QGA-PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT--KLTEKE 156
            L QG  P IV+ Y +   + +  F       +++  P   LL ++ QR  T  ++  K 
Sbjct: 70  LLAQGNNPGIVKLYYTFHDQENLYF-------VLDYAPGGELL-HLLQRYGTFDEVWSKH 121

Query: 157 ILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVT---T 213
            +  + DV   V  +H     ++HRD+K ENVL+       + DFG+ S    +VT   T
Sbjct: 122 FMCQLVDV---VEYIHS--KGVIHRDLKPENVLLSKDGRLMVTDFGAAS----VVTTDGT 172

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF---- 269
             D +V  +      T +Y SPE++   +C      SDIWALG  LY+ +  + PF    
Sbjct: 173 SSDNSVSERAASFVGTAEYVSPELLLNNQCF---FSSDIWALGCILYQFMQGSPPFRGEN 229

Query: 270 ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQV 314
           EL     I+   Y + K   +  +++L+  +L  +P+ R +I  +
Sbjct: 230 ELQTFEKIVSLDYHW-KLAVNPSVMDLVRHILVIDPHERLSISAI 273

>CAGL0K01617g complement(142479..144803) similar to sp|P54199
           Saccharomyces cerevisiae YDL028c Serine/threonine
           protein kinase, start by similarity
          Length = 774

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 130/316 (41%), Gaps = 63/316 (19%)

Query: 28  VAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQ--D 85
           V+V   + E ++ +  GG + +Y V+ ++       NR         V  LK+V     D
Sbjct: 440 VSVNGTEYERVELLGRGGSSNVYKVRGLK-------NR---------VYALKKVSFDEFD 483

Query: 86  ENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN 145
           E+ +   + E+ ++KQLQ    +VQ YD           G  VL L+  C +  L   ++
Sbjct: 484 ESSVEGFKGEISLLKQLQNQNRVVQLYDFEM--------GSGVLYLLMECGDYDLSQVLH 535

Query: 146 QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG-ST 204
           QR       + I     ++   V  +H     ++H D+K  N  V  +   K+ DFG + 
Sbjct: 536 QRANQPFDMEFIRYHAREMVTCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFGIAN 592

Query: 205 STKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRC------------LPIDEKS 250
           +     V  ++D+ +         TP Y +PE +  + Y                I + +
Sbjct: 593 AVPDHTVNIYRDMQI--------GTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPA 644

Query: 251 DIWALGIFLYKLLFFTTPF-ELTGQFAIL-----HSKYEFP-----KNNYSSKLINLIII 299
           DIW+ G  +Y++++   P+ +  GQ  +L     + K E+      K    S  + L+  
Sbjct: 645 DIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQY 704

Query: 300 MLAENPNLRPNIYQVL 315
            L  NP  R +  Q+L
Sbjct: 705 CLMRNPEERWSALQIL 720

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 120/297 (40%), Gaps = 48/297 (16%)

Query: 21  RYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKR 80
            YT   +   G    E+++ + +G F Q+Y VK           +   ++    V   K 
Sbjct: 326 HYTLTKKRHYGPQDFEVLRLLGKGTFGQVYQVK----------KKDTKRIYAMKVLSKKV 375

Query: 81  VLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSL 140
           ++ ++E         + V    + +P IV    S  +         ++ L+ +      L
Sbjct: 376 IVKKNEIAHTIGERNILVTTSSKASPFIVGLKFSFQTPT-------DLYLVTDYMSGGEL 428

Query: 141 LDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCD 200
             ++ +    + TE      + ++  A+  +H     +++RD+K EN+L+DA  N  LCD
Sbjct: 429 FWHLQRE--GRFTEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCD 484

Query: 201 FGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-----DIWAL 255
           FG +       T          N +  TT +Y +PE++       +DE       D W+L
Sbjct: 485 FGLSKADLKDRT----------NTFCGTT-EYLAPELL-------LDESGYTKMVDFWSL 526

Query: 256 GIFLYKLLFFTTPFELTGQ----FAILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
           G+ ++++    +PF           I   K +FP++  S +  + +  +L  NP  R
Sbjct: 527 GVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRNPKHR 583

>Kwal_26.8709
          Length = 829

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 30/180 (16%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E+  +K L   PNIV+  +   + ++ G       +++E         Y+ ++   +L E
Sbjct: 95  EINALKHLN-HPNIVRLEEVLQNSKYIG-------IVLEYASGGEFYKYIQKK--RRLKE 144

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
               ++   +   V  MH     L+HRD+K+EN+L+D   N  + DFG  +   P     
Sbjct: 145 GPACRLFAQLISGVYYMHS--KGLVHRDLKLENLLLDKNENLLITDFGFVNEFLP----- 197

Query: 215 QDIAVLTQNIYVHT---TPQYRSPEMIDLYRCLPID-EKSDIWALGIFLYKLLFFTTPFE 270
                  +N  + T   +P Y +PE++   R  P +  K+D+W+ G+ LY +L    P++
Sbjct: 198 -------ENELMKTSCGSPCYAAPELVVTAR--PYEARKADVWSCGVILYAMLAGYLPWD 248

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 81/181 (44%), Gaps = 38/181 (20%)

Query: 148  LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS-- 205
            L T +TE E   +   V   +  +H     ++HRDIK ENV+VD +   K+ DFGS +  
Sbjct: 1101 LKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAYV 1158

Query: 206  TKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLL 263
             + P             +++V T   Y +PE++  D Y   P     D+WA+G+ LY ++
Sbjct: 1159 KRGPF------------DVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTII 1201

Query: 264  FFTTPFE-----LTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHNI 318
            +   PF      L G   I       P    S + + LI  +L  + N RP +     +I
Sbjct: 1202 YKENPFYNIDEILDGDLRI------SPAVVVSEECVALITRILNRSVNRRPTV----DDI 1251

Query: 319  C 319
            C
Sbjct: 1252 C 1252

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 108/247 (43%), Gaps = 37/247 (14%)

Query: 85  DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYM 144
           DE+   ++  E+EV+ + Q +P IV +Y +        F    V + ME     SL    
Sbjct: 413 DESKFRQILMELEVLHKCQ-SPYIVDFYGAF-------FIEGAVYMCMEFMDGGSLDKSY 464

Query: 145 NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA-QNNFKLCDFGS 203
           +      + E ++  I   V   + ++  +   ++HRD+K  N+L  A Q   KLCDFG 
Sbjct: 465 DPHEIGGIEEPQLALITESVIRGLKELKDVHN-IIHRDVKPTNILCSATQGTVKLCDFG- 522

Query: 204 TSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDE-----KSDIWALGIF 258
                  V+ +   ++   NI   +   Y +PE I   + L  D+     +SDIW+LG+ 
Sbjct: 523 -------VSGNLVASLARTNIGCQS---YMAPERI---KSLNPDKATYSVQSDIWSLGLS 569

Query: 259 LYKLLFFTTPF---ELTGQFAILHSKYE-----FPKNNYSSKLINLIIIMLAENPNLRPN 310
           + ++     P+        F+ L +  +      PK+ +SS   + + + L + P  RP 
Sbjct: 570 IVEMALGAYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIPERRPT 629

Query: 311 IYQVLHN 317
              +L +
Sbjct: 630 YASLLEH 636

>Kwal_55.20326
          Length = 750

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 85/181 (46%), Gaps = 21/181 (11%)

Query: 89  LNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL 148
           ++ +++E+ ++K+LQ   NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 531 VDALQHEMGLLKELQ-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNSY- 581

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
                E  I      +   +S +H     ++HRDIK  N+L+D +   K+ DFG +    
Sbjct: 582 -GPFEEPLIRNFTRQILIGLSYLHR--KDIIHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
           P+       A L  ++Y      + +PE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 269 F 269
           F
Sbjct: 690 F 690

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 87/187 (46%), Gaps = 33/187 (17%)

Query: 89  LNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMN--- 145
           ++ +++E+ ++K+L    NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 512 IDALQHEMNILKELH-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNNYG 563

Query: 146 ---QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
              + L    T + ++ + Y        +H     ++HRDIK  N+L+D +   K+ DFG
Sbjct: 564 PFDEPLVKNFTRQILIGLAY--------LH--KRNIIHRDIKGANILIDIKGGVKITDFG 613

Query: 203 STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
            +    P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + ++
Sbjct: 614 ISKKLSPLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVIVEM 664

Query: 263 LFFTTPF 269
                PF
Sbjct: 665 FTGKHPF 671

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 84/177 (47%), Gaps = 27/177 (15%)

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLT 153
           NE+ VMK  +   NIV + DS   +        ++ ++ME     SL D +   +   LT
Sbjct: 727 NEILVMKGSRHN-NIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 154 EKEILKIMYDVTYAVSQMHYLPTP-LLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVT 212
           E +I  +  +    +  +H+L +  ++HRDIK +N+L+    N KL DFG     F    
Sbjct: 776 EGQIAAVSRET---LRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFG-----FCAQI 827

Query: 213 THQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
              ++   T    +  TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 828 NETNLKRTT----MVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>Kwal_27.10004
          Length = 735

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 69/152 (45%), Gaps = 20/152 (13%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
            +ME C    L   +++    K   KE  +    V   +  +H     ++HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIH--SQGVVHRDIKPENVL 418

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTT----PQYRSPEMIDL----- 240
           +  +   K+ DFG +         ++D   LT  + +  T    P Y +PE++       
Sbjct: 419 ISKEGIAKMTDFGISD------WGNEDPDDLTSPVRLFDTYVGSPPYSAPEVVAFKDEDS 472

Query: 241 -YRCL-PIDE-KSDIWALGIFLYKLLFFTTPF 269
            Y+   P D  K D WALG+ L+ L++  TPF
Sbjct: 473 TYQDRKPYDAYKMDCWALGVLLFTLVYQCTPF 504

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 106/263 (40%), Gaps = 61/263 (23%)

Query: 41   IAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEM-------- 92
            I +G F  +Y               +   +  G++  +K+V V      NE+        
Sbjct: 1157 IGKGSFGAVY---------------LSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEAL 1201

Query: 93   RNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKL 152
            ++EV  +K L    NIVQY  S    R N +      L +E     S+   +  RL  + 
Sbjct: 1202 KSEVATLKDLDHL-NIVQYLGSEI--RGNIYS-----LFLEYVAGGSVGSLI--RLYGRF 1251

Query: 153  TEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVT 212
             EK I  +   V   +  +H     +LHRD+K +N+L+D     K+ DFG          
Sbjct: 1252 DEKLIRHLNTQVLSGLKYLH--SKGILHRDMKADNLLLDEDGICKISDFG---------- 1299

Query: 213  THQDIAVLTQNIYVHT------TPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFT 266
                I+  ++NIY ++      T  + +PEM+D  +      K DIW+LG  + ++    
Sbjct: 1300 ----ISKKSKNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGK 1353

Query: 267  TPFE----LTGQFAILHSKYEFP 285
             P+     +   F I  SK   P
Sbjct: 1354 RPWSNLEVVAAMFQIGKSKSAPP 1376

>KLLA0C16577g complement(1451181..1452695) some similarities with
           sp|P06784 Saccharomyces cerevisiae YDL159w STE7
           ser/thr/tyr protein kinase of MAP kinase kinase family,
           hypothetical start
          Length = 504

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 88/186 (47%), Gaps = 32/186 (17%)

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYM----- 144
           N++  E+ +MK +    NIV +Y +     +N     E+++LME     SL   +     
Sbjct: 207 NQLVRELTIMKNVSAHDNIVGFYGA----FYNPSTTNEIVILMEYMDCGSLDKILSVYRS 262

Query: 145 -----NQRLATKLT---EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
                N  ++ K +   E  + +I + V   +  + Y    ++HRDIK  N+L++++ + 
Sbjct: 263 DCHRKNVSISCKTSWFNEMPLSRISFCVLNGLIYL-YDCYKIIHRDIKPSNILINSKGDV 321

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           K+CDFG ++T   ++ +  D  V         T  Y SPE I   R      K D+W+LG
Sbjct: 322 KICDFGVSTT---LINSLADTFV--------GTSTYMSPERIQGGR---YTTKGDVWSLG 367

Query: 257 IFLYKL 262
           + + +L
Sbjct: 368 LMIIEL 373

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 82/171 (47%), Gaps = 29/171 (16%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVT 165
           PN+++  D  +  + N +  +EV   M+ CP    +D+    +  K++  EI   +  +T
Sbjct: 275 PNVIETVDVFSDSKQNKY--YEV---MQYCP----IDFFAVVMTGKMSRGEINCCLKQLT 325

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNI 224
             V  +H +   L HRD+K++N ++ A    KL DFGS    ++P     +D   +   I
Sbjct: 326 EGVRYLHSMG--LAHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPF----EDDVTMAHGI 379

Query: 225 YVHTTPQYRSPEMIDLYR-----CLPIDEKSDIWALGIFLYKLLFFTTPFE 270
            V + P Y +PE+I   +     C+      DIW++GI    ++    P++
Sbjct: 380 -VGSDP-YLAPEVITSTKSYDPQCV------DIWSIGIIYCCMMLKRFPWK 422

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 19/122 (15%)

Query: 150  TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
            T +TE E   I   V   +  +H     ++HRDIK ENV+VD++   K+ DFGS +    
Sbjct: 1200 TNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY--- 1254

Query: 210  MVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTT 267
                   +     +++V T   Y +PE++  + Y   P     DIWA+GI LY ++F   
Sbjct: 1255 -------VKSGPFDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFKEN 1302

Query: 268  PF 269
            PF
Sbjct: 1303 PF 1304

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 118/297 (39%), Gaps = 64/297 (21%)

Query: 41   IAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNE--------M 92
            I +G F  +Y       LN          +  G++  +K+V V   +  NE        +
Sbjct: 1181 IGKGSFGAVYLC-----LN----------VTTGEMMAVKQVEVPKYSSQNEAILSTVEAL 1225

Query: 93   RNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFE-----VLLLMELCPNKSLLDYMNQR 147
            R+EV  +K L    NIVQY             GFE       L +E     S+   +  R
Sbjct: 1226 RSEVSTLKDLDHL-NIVQYL------------GFENKNNIYSLFLEYVAGGSVGSLI--R 1270

Query: 148  LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
            +  +  E  I  +   V   ++ +H     +LHRD+K +N+L+D     K+ DFG  S K
Sbjct: 1271 MYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG-ISRK 1327

Query: 208  FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTT 267
               + ++ D+        +  T  + +PEM+D  +      K DIW+LG  + ++     
Sbjct: 1328 SKDIYSNSDMT-------MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1378

Query: 268  PFE----LTGQFAILHSKYEFPKNNYSSKLI-----NLIIIMLAENPNLRPNIYQVL 315
            P+     +   F I  SK   P    +  LI     N +      NP  RP   ++L
Sbjct: 1379 PWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 109/228 (47%), Gaps = 31/228 (13%)

Query: 38  IKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVE 97
           +  + +G F+ +Y V F E   ++    ++P           R+L Q+ N L+ +++ V 
Sbjct: 399 VSIMGKGQFSTVYQVTFPETGLKYAIKSVRPTKH----NFTNRIL-QEINMLSTIQDSV- 452

Query: 98  VMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK---LTE 154
                +G   IV++    +S  H G       ++ E C N +L  ++ + +  K   L +
Sbjct: 453 -TNDTEGKEYIVEFI---SSWSHKG----SFYIMTEFCENGNLDAFIQEHVIAKQQRLED 504

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
             I KI+ ++  A+  +H     ++H D+K  NVL+  + N KL DFG  +TK P+    
Sbjct: 505 WRIWKIIVEICLALRFIHD-SCSIVHLDLKPANVLITFEGNLKLADFG-MATKLPI---- 558

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
           +D +   +        +Y +PE+I   R    D ++DI++LG+ + ++
Sbjct: 559 EDKSFENEG-----DREYIAPEII---RDGIYDFRADIFSLGLMMIEI 598

>CAGL0H00979g complement(94328..95527) similar to tr|Q12003
           Saccharomyces cerevisiae YPL236c, hypothetical start
          Length = 399

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 8/95 (8%)

Query: 232 YRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE----LTG---QFAILHSKYEF 284
           Y +PE +DL     +  K D+W+ G   Y LLF   PFE    L G   ++AI   K+ F
Sbjct: 300 YMAPEFLDLKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSF 359

Query: 285 P-KNNYSSKLINLIIIMLAENPNLRPNIYQVLHNI 318
           P ++ YS  ++++I   L  +P+ RP++  VL+N+
Sbjct: 360 PSQSRYSDSILDIIRSCLQVDPSERPSVSIVLNNL 394

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 76/165 (46%), Gaps = 23/165 (13%)

Query: 108 IVQYYDSNASRRHNGFPGFEVLLLMELCPNKSL-LDYMNQ-RLATKLTEKEILKIMYDVT 165
           IVQYY      + +      + + ME    KSL   Y N  +   +++E+ I KI   V 
Sbjct: 273 IVQYYGMFTDEQSS-----SIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVL 327

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIY 225
             +S +H     ++HRDIK +N+L++ +   KLCDFG +             AV +  + 
Sbjct: 328 RGLSYLH--ERKVIHRDIKPQNILLNEKGEIKLCDFGVSGE-----------AVNSLAMT 374

Query: 226 VHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
              T  Y +PE I   +  P     D+W+LG+ L ++     PFE
Sbjct: 375 FTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

>ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C
           (MRK1) - SH] complement(1141943..1143085) [1143 bp, 380
           aa]
          Length = 380

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 101/223 (45%), Gaps = 49/223 (21%)

Query: 71  QMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIV----QYYDSNASRRHNGFPGF 126
           Q G+   +K+VL QD    N    E+E+MK LQ  PN+V     +Y+S            
Sbjct: 53  QTGEKVAIKKVL-QDRRFKN---RELEIMKLLQ-HPNVVDLRYHFYESEPQTN------- 100

Query: 127 EVLLLMELCPNKSLLDYMNQRLATKLTE----------KEILKIMYDVTYAVSQMHYLPT 176
           EV L +       +L+YM Q L  +L             EI   M+ +  +++ +H +  
Sbjct: 101 EVYLNL-------ILEYMPQSLYQRLRHFVTGRLLMPRDEIKVYMFQLFKSLNYLHRVAR 153

Query: 177 PLLHRDIKIENVLVDAQN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSP 235
            + HRDIK +N+LVDA     KLCDFGS     P   T  +++ +           YR+P
Sbjct: 154 -VCHRDIKPQNLLVDAGTLQLKLCDFGSAKQLRP---TEPNVSYICSR-------YYRAP 202

Query: 236 EMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAIL 278
           E+I  +       + DIW+ G  + +LL     F   G+F I+
Sbjct: 203 ELI--FGATNYTTQIDIWSTGCVMAELLLGQPMF--PGEFVIV 241

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 104/223 (46%), Gaps = 44/223 (19%)

Query: 75  VACLKRVLVQDENGL--NEMRNEVEVMKQLQGAPNIVQYYDSN--ASRRHNGFPGFEVLL 130
           V   K ++++  N +   ++  E+ +M+ +    NIV++Y ++  +S   NG    +V++
Sbjct: 129 VIAKKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLSSDSING--SNDVVI 186

Query: 131 LMELCPNKSLLDYMNQRLATKLTEKEIL-------------------KIMYDVTYAVSQM 171
           LME   N   LD +  R    L  + IL                   +I Y V   +S +
Sbjct: 187 LMEYM-NCGSLDTIT-RTYKSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNGLSYL 244

Query: 172 HYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQ 231
            Y    ++HRDIK  NVL++++   KLCDFG  S K      +  IA    + +V T+  
Sbjct: 245 -YENYKIIHRDIKPSNVLINSKGRIKLCDFG-VSRKL-----NNSIA----DTFVGTST- 292

Query: 232 YRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQ 274
           Y SPE I   +      K D+W+LG+ L +LL  T  F L G 
Sbjct: 293 YMSPERIQGNK---YTTKGDVWSLGLMLIELL--TGEFPLGGH 330

>Scas_713.21
          Length = 641

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 138/322 (42%), Gaps = 77/322 (23%)

Query: 30  VGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQ--DEN 87
           +   ++ I++ + +GG +++Y V+                 + G    LK++L++  DEN
Sbjct: 316 ITDEELSIVELLGKGGSSKVYKVQD----------------RTGKYYALKQILLEELDEN 359

Query: 88  GLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR 147
              ++  E+E++K+L     +V+  +     R        V +LME C N  L   +++R
Sbjct: 360 LKTDLEREIELLKRLAREERVVKLIEYKIDDRM-------VQVLME-CGNFDLSHVLHER 411

Query: 148 L-------ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCD 200
           +         +L  KE+++        +  +H   + ++H D+K  N +   +   KL D
Sbjct: 412 VNRPFDINFVRLMSKEMIE-------CIKAVH--DSDIVHSDLKPANFIF-VKGTLKLID 461

Query: 201 FGSTSTKFPMVTTHQDIAVLTQNIYVHT---TPQYRSPEMI--------DLYRCLPIDEK 249
           FG  +           IA  T N+Y +T   TP Y +PE +        +      I + 
Sbjct: 462 FGIAN----------KIADNTLNVYRNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKP 511

Query: 250 SDIWALGIFLYKLLFFTTPF-ELTGQ---FAILHS--KYEFPKNNYSSK-----LINLII 298
           SDIW+ G  LY++ +   P+    G     AI++   + ++P  +   K     L+ LI 
Sbjct: 512 SDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIK 571

Query: 299 IMLAENPNLRPNIYQVLHNICS 320
             L  +P LR    ++ H  CS
Sbjct: 572 TCLNRDPQLRATTDEIQH--CS 591

>Kwal_0.96
          Length = 427

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 116/258 (44%), Gaps = 38/258 (14%)

Query: 78  LKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPN 137
           LK+ L   +  L  + +E+ ++++L   PNIV++ D   S+        +  ++ +L   
Sbjct: 78  LKKALKGKDVELQMLYDELSILQKLD-HPNIVKFKDWFESKD-------KFYIVTQLATG 129

Query: 138 KSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLV---DAQN 194
             L D + ++   K TE++ ++I+Y +  AV  +H     ++HRD+K EN+L     A +
Sbjct: 130 GELFDRILKQ--GKFTEEDAVRIVYQILKAVEYLH--SRNIVHRDLKPENLLYLTEAADS 185

Query: 195 NFKLCDFG-STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253
              L DFG +   K      H+    +           Y +PE++         +  DIW
Sbjct: 186 QLVLGDFGIAKELKNDDELIHKAAGSMG----------YVAPEVV---TTSGHGKPCDIW 232

Query: 254 ALGIFLYKLLFFTTPF------ELTGQFAILHSKYEFPK---NNYSSKLINLIIIMLAEN 304
           +LG+  Y LL   +PF          +  I  +   F K   +N S++  + I+  L  N
Sbjct: 233 SLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNISNEAKDFILRALTVN 292

Query: 305 PNLRPNIYQVLHNICSIS 322
           P+ RP   ++L +   IS
Sbjct: 293 PHDRPTATELLQDAWIIS 310

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 90/197 (45%), Gaps = 32/197 (16%)

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGF--PGFEVLLLME 133
             +K++  +DE+ LNE   E++++K L+   NIV+Y          GF     E+ +++E
Sbjct: 36  CAIKQIEFEDESELNEHMLEIDLLKNLRH-QNIVEY---------RGFIQKAHELYIILE 85

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193
            C   SL D +       L E + +  +    Y +  +H     ++HRDIK  N+L+  +
Sbjct: 86  YCARGSLRDILKH---GPLLEDDTVNYVTQTLYGLQYLH--EQGVIHRDIKAANLLLTEE 140

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 253
              KL DFG ++    M  T+              +P + +PE++       +   SDIW
Sbjct: 141 GIVKLADFGVSTRINRMAMTYAG------------SPNWMAPEVMTGQGASTV---SDIW 185

Query: 254 ALGIFLYKLLFFTTPFE 270
           +LG  + +LL    PF 
Sbjct: 186 SLGATVVELLTGNPPFH 202

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 81/176 (46%), Gaps = 25/176 (14%)

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLT 153
           NE+ VMK  +   NIV + DS   R        ++ ++ME     SL D +   +   LT
Sbjct: 742 NEILVMKGSKHN-NIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 154 EKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTT 213
           E +I  +  +    +  +H     ++HRDIK +N+L+    + KL DFG  +        
Sbjct: 791 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFGFCA-------- 840

Query: 214 HQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
            Q   V  +   +  TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 841 -QINEVNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>Scas_336.1
          Length = 486

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 119/294 (40%), Gaps = 83/294 (28%)

Query: 24  PGTQVAVGAHKVEIIKYIAEGGFAQIY---------------AVKFIEFLNEFENNRMKP 68
           PG  V     K++ IK I  G F+ +Y               AVK I + +E  N    P
Sbjct: 155 PGETV-----KLKKIKLIGSGNFSDVYLYEALGESRSHFAQVAVKHIRYPSELVN---AP 206

Query: 69  KLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSN-----------AS 117
                D    K  L + E+ L     E++V+K +   P I++ Y  N           +S
Sbjct: 207 N---PDSPSYKDTLSRLESSLTR---ELDVLKSI-SHPCIIKLYAINDLKFFETKRPLSS 259

Query: 118 RRHNGFPGF--EVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLP 175
           R+H G  GF     ++M  C    L D  ++     L +  I +I  ++T  +  +H   
Sbjct: 260 RKH-GDKGFLPPCDMVMSYCSGGDLFDMASK---NNLPQWLIQRIFAELTMGMKYLH--E 313

Query: 176 TPLLHRDIKIENVLVDA----------------QNNFKLCDFGSTSTKFP--MVTTHQDI 217
             ++HRD+K+ENVL+                  QN  +L DFG      P  M TT    
Sbjct: 314 NLIIHRDLKLENVLLKLPLEQILAMKDVPLFKRQNLIELGDFGLCKKIQPDEMCTTRCG- 372

Query: 218 AVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK-SDIWALGIFLYKLLFFTTPFE 270
                      +  Y SPE++     LP D + SD WALG+ LY LL    PF+
Sbjct: 373 -----------SEDYVSPEIL---MGLPYDGRLSDAWALGVILYALLEDRLPFD 412

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 61/292 (20%), Positives = 119/292 (40%), Gaps = 58/292 (19%)

Query: 31  GAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLN 90
           G    E+++ + +G F Q+Y VK           +   ++    V   K ++ ++E    
Sbjct: 408 GPQDFEVLRLLGKGTFGQVYQVK----------KKDTQRIYAMKVLSKKVIVKKNEIAHT 457

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
                + V    + +P IV    S  +         ++ L+ +      L  ++ +    
Sbjct: 458 IGERNILVTTASKSSPFIVGLKFSFQTPT-------DLYLVTDYMSGGELFWHLQKE--G 508

Query: 151 KLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPM 210
           + +E      + ++  A+  +H     +++RD+K EN+L+DA  N  LCDFG +      
Sbjct: 509 RFSEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADLKD 566

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-----DIWALGIFLYKLLFF 265
            T          N +  TT +Y +PE++       +DE       D W+LG+ ++++   
Sbjct: 567 RT----------NTFCGTT-EYLAPELL-------LDETGYTKMVDFWSLGVLIFEMCCG 608

Query: 266 TTPFELTGQFA---------ILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
            +PF     FA         I   K +FP++  S +  + +  +L  NP  R
Sbjct: 609 WSPF-----FAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>Kwal_47.18307
          Length = 621

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 88/192 (45%), Gaps = 17/192 (8%)

Query: 130 LLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
            ++E      LL  + QRL  +LTE     I   +   V  MH     ++HRD+K ENVL
Sbjct: 89  FVLEYVSGGELLALI-QRLG-RLTEDLSRHITAQLVDTVDYMH--SKGVIHRDLKPENVL 144

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 249
           +  +    + DFG+  T        +      +      T +Y SPE++   +C      
Sbjct: 145 LSQEGRVVITDFGAACT-----AADRKFENTKRTASFVGTAEYVSPELLLHSQC---GFS 196

Query: 250 SDIWALGIFLYKLLFFTTPF----ELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENP 305
           SDIWALG  +Y+L     PF    EL     I+   Y++  +N S ++++++  +L  +P
Sbjct: 197 SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSN-SPQVVSIVQSILVTDP 255

Query: 306 NLRPNIYQVLHN 317
             RP+  Q+  N
Sbjct: 256 LKRPSAAQLKQN 267

>Kwal_47.16761
          Length = 744

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 121/294 (41%), Gaps = 62/294 (21%)

Query: 31  GAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLN 90
           G    E+++ + +G F Q+Y V            R K   ++  +  L + ++  +N + 
Sbjct: 330 GPQDFEVLRLLGKGTFGQVYQV------------RKKDTKRIYAMKVLSKKVIVKKNEIA 377

Query: 91  EMRNEVEVMKQL--QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL 148
               E  ++ +   +  P IV    S  +      P  ++ L+ +      L  ++ +  
Sbjct: 378 HTIGERNILVRTASKSCPFIVGLKFSFQT------PA-DLYLVTDFMSGGELFWHLQKE- 429

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
             +  E      + ++  A+  +H     +++RD+K EN+L+DA  N  LCDFG +    
Sbjct: 430 -GRFAEDRARFYIAELVLALEYLH--ENDIVYRDLKPENILLDANGNIALCDFGLSKADL 486

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-----DIWALGIFLYKLL 263
              T          N +  TT +Y +PE++       +DE       D W+LG+ ++++ 
Sbjct: 487 KDRT----------NTFCGTT-EYLAPELL-------LDESGYTKMVDFWSLGVLIFEMC 528

Query: 264 FFTTPFELTGQFA---------ILHSKYEFPKNNYSSKLINLIIIMLAENPNLR 308
              +PF     FA         I   K +FP++  S +  + +  +L  NP  R
Sbjct: 529 CGWSPF-----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPRHR 577

>Scas_643.20
          Length = 1082

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 117/276 (42%), Gaps = 77/276 (27%)

Query: 22   YTPGTQVAVGAHK-------VEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGD 74
            YTP T  ++G+ K         +++ + EG + ++          +   ++ K  + +  
Sbjct: 804  YTPST--SIGSQKRIKKFSDFTVLQQLGEGAYGKV----------KLCIHKEKRTIVVIK 851

Query: 75   VACLKRVLVQD---ENGLNEMRNEVEVMKQLQGAP--NIVQ----------YYDSNASRR 119
            +   +R+LV     +  L  + +E+++M  L   P  NIV           YY    +  
Sbjct: 852  MIFKERILVDTWVRDRKLGTIPSEIQIMATLNKKPHKNIVALLDFFEDEEYYYMETPAHG 911

Query: 120  HNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLL 179
              G    ++  L+EL  N              +TE E   I   V   +  +H     ++
Sbjct: 912  ETG--SIDLFDLIELKKN--------------MTEYEEKLIFKQVVSGLKHLH--DQGIV 953

Query: 180  HRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQ----NIYVHTTPQYRSP 235
            HRDIK ENV+VD++ + KL D+GS              A  T+    +++V T   Y +P
Sbjct: 954  HRDIKDENVIVDSKGHVKLIDYGS--------------AAYTKSGPFDVFVGTI-DYAAP 998

Query: 236  EMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
            E++   +Y   P     DIWA+GI LY ++F   PF
Sbjct: 999  EVLGGSVYDGKP----QDIWAIGILLYTIIFKENPF 1030

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 118/288 (40%), Gaps = 74/288 (25%)

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLD----YMNQ 146
           ++ +E  ++ QL+   NIV+++  +   + N      + L ME C    L      Y +Q
Sbjct: 53  QLISECAILSQLK-HDNIVEFFHWDHDAKSN-----TLFLYMEYCSKGDLSQMIRYYKHQ 106

Query: 147 RLATKLTEKEILKIMYDVTYAVSQMHY-------------LPTPL-------LHRDIKIE 186
           R    + E+ + +IM  +  A+ + HY             +  PL       +HRD+K  
Sbjct: 107 R--KYVPEEYVWRIMVQILMALFKCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRDLKPG 164

Query: 187 NVLVDAQNN---------------FKLCDFG---STSTKFPMVTTHQDIAVLTQNIYVHT 228
           N+ +   ++                KL DFG   S        TT           YV  
Sbjct: 165 NIFLTGYDDEFNQNASDVDYSKVIIKLGDFGLAKSLQASIEFATT-----------YV-G 212

Query: 229 TPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF------ELTGQFAILHSKY 282
           TP Y SPE++   R  P    SDIW+LG  LY+L     PF      EL G+  +    +
Sbjct: 213 TPYYMSPEVL---RDQPYSPLSDIWSLGCILYELCSLHVPFQAKTYTELQGK--VKAGYF 267

Query: 283 EFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHNI-CSISGMKVPIE 329
           E   + YS  L ++I   +  +   RP+ + +L++I C I    + +E
Sbjct: 268 EPLPHFYSKNLQDIITRCIQVDFTKRPSTWSLLNDIQCRICRKALDLE 315

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 110/258 (42%), Gaps = 37/258 (14%)

Query: 9   SVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKP 68
           +V+  T K  N+ +T          + ++IK I  G +  + + +F E  +E      K 
Sbjct: 6   AVDRHTFKVFNQDFTVDK-------RFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKV 58

Query: 69  KLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNG-FPGFE 127
                     KR L            E+++++  +G  NI   YD +   + +G F G  
Sbjct: 59  TNVFSKTLLCKRSL-----------RELKLLRHFRGHKNITCLYDMDIVFQPDGMFNGLY 107

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           +   +  C    ++     +    LT+      +Y +   +  +H     +LHRD+K  N
Sbjct: 108 LYEELMECDMHQIV-----KSGQPLTDAHYQSFIYQILCGLKYIH--SADVLHRDLKPGN 160

Query: 188 VLVDAQNNFKLCDFGSTS--TKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLP 245
           +LV+A    K+CDFG     ++ P+    ++   LT+ +    T  YR+PE++  Y+   
Sbjct: 161 LLVNADCQLKICDFGLARGYSENPV----ENNQFLTEYV---ATRWYRAPEIMLSYQ--G 211

Query: 246 IDEKSDIWALGIFLYKLL 263
             +  D+W+ G  L +LL
Sbjct: 212 YTKAIDVWSCGCILAELL 229

>Kwal_23.5576
          Length = 504

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 101/233 (43%), Gaps = 30/233 (12%)

Query: 34  KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMR 93
           + ++IK I  G +  + + +FIE   E      K           KR L           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSL----------- 70

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRR-HNGFPGFEVLLLMELCPNKSLLDYMNQRLATKL 152
            E+++++  +G  NI   YD +     +N F G  +   +  C    ++     +    L
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFSPNNTFNGLYLYEELMECDIHQII-----KSGQPL 125

Query: 153 TEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS--TKFPM 210
           T+      +Y +  A+  +H     +LHRD+K  N+LV+A    K+CDFG     ++ P+
Sbjct: 126 TDAHYQSFIYQLLCALKYIH--SADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPV 183

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLL 263
               ++   LT+ +    T  YR+PE++  Y+     +  DIW+ G  L +LL
Sbjct: 184 ----ENNQFLTEYV---ATRWYRAPEIMLSYQ--GYTKAIDIWSCGCILAELL 227

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 82/171 (47%), Gaps = 20/171 (11%)

Query: 150  TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
            + +TE E   I   +   +  +H     ++HRDIK ENV+VD++   KL DFGS +    
Sbjct: 1050 SNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAY--- 1104

Query: 210  MVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS-DIWALGIFLYKLLFFTTP 268
                   +     +++V T   Y +PE++      P + KS DIWA+GI LY L++   P
Sbjct: 1105 -------VKSGPFDVFVGTI-DYAAPEVLGGN---PYEGKSQDIWAIGILLYTLIYKENP 1153

Query: 269  FELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNI 318
            F    +  IL  +  F  + + S +   LI  +L      RP I ++  ++
Sbjct: 1154 FYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDV 1202

>Kwal_33.13681
          Length = 715

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 104/231 (45%), Gaps = 38/231 (16%)

Query: 38  IKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQD---ENGLNEMRN 94
           +  I  G F+ +Y V F +   ++    MKP         L+ + +     E  L+E   
Sbjct: 380 VSSIGSGQFSTVYQVTFEQTNTKYAVKSMKPNKYNTSARILQEIDILSKISETTLDE--- 436

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA---TK 151
                   +G   ++ +    +S ++ GF      ++ E C N  L  ++ +++    T+
Sbjct: 437 --------EGKEYVLNFI---SSWKYQGF----FYVMTEYCENGDLDTFLKKQIISKNTR 481

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           L +  I KI+ +++ A+  +H     + H D+K  NVL+  + N KL DFG  + K P+ 
Sbjct: 482 LEDWRIWKIIVELSLALRFVHD-SCQIAHLDLKPANVLITFEGNLKLADFG-MAAKLPVG 539

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
            T          I      +Y +PE+I    C+  D ++DI++LG+ + ++
Sbjct: 540 HT---------GIENEGDREYIAPEIIS--ECV-YDFRADIFSLGLMIVEI 578

>Kwal_47.17868
          Length = 365

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 96/202 (47%), Gaps = 38/202 (18%)

Query: 73  GDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQ----YYDSNASRRHNGFPGFEV 128
           GD   +K+VL QD    N    E+E+MKQLQ  P +V     +Y+++        P  EV
Sbjct: 59  GDRVAIKKVL-QDRRFKN---RELEIMKQLQH-PQVVDLKYYFYETD--------PQGEV 105

Query: 129 LL--LMELCPN---KSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDI 183
            L  ++E  P    + L  +++QR  + +   EI   MY +  +++ +H     + HRDI
Sbjct: 106 YLNLILEYMPQSLYQRLRHFVSQR--SNMPRIEIKLYMYQLAKSLNYLH-TNARVCHRDI 162

Query: 184 KIENVLVDAQN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYR 242
           K +N+LVD Q    KLCDFGS     P             N+    +  YR+PE+I  + 
Sbjct: 163 KPQNLLVDPQTFALKLCDFGSAKQLKPS----------EPNVSYICSRYYRAPELI--FG 210

Query: 243 CLPIDEKSDIWALGIFLYKLLF 264
                 + DIW+ G  + +L+ 
Sbjct: 211 ASNYTVQIDIWSSGCVMAELIL 232

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 83/177 (46%), Gaps = 30/177 (16%)

Query: 148  LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
            L T +TE E   +   V   +  +H     ++HRDIK ENV+VD +   KL DFGS +  
Sbjct: 1071 LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAY- 1127

Query: 208  FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFF 265
                     +     +++V T   Y +PE++  + Y   P     DIWA+G+ LY +++ 
Sbjct: 1128 ---------VKSGPFDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYK 1173

Query: 266  TTPFE-----LTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
              PF      L G   I  S +E      S++ + LI  +L  + + RP I  ++ +
Sbjct: 1174 ENPFYNIDEILDGDLRI-QSTHEV-----SAECVALIRKILNRSVSKRPTIDDIMED 1224

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 73/147 (49%), Gaps = 15/147 (10%)

Query: 125 GFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIK 184
           G   LL+ME  P     D+ N  ++  +T+ E+      + + V+ +H +   L HRD+K
Sbjct: 379 GDTYLLVMEYAP----YDFFNLVMSNLMTQDEVNCYFKQLCHGVNYLHSMG--LAHRDLK 432

Query: 185 IENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRC 243
           ++N +V      KL DFGS    ++P    ++D  V +  I V + P Y +PE++     
Sbjct: 433 LDNCVVTKDGILKLIDFGSAVVFQYP----YEDTIVKSHGI-VGSDP-YLAPELLKQTSY 486

Query: 244 LPIDEKSDIWALGIFLYKLLFFTTPFE 270
            P    +D+W++ I  Y ++    P++
Sbjct: 487 DP--RVADVWSIAIIFYCMVLKRFPWK 511

>Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement
          Length = 576

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 119/294 (40%), Gaps = 83/294 (28%)

Query: 24  PGTQVAVGAHKVEIIKYIAEGGFAQIY---------------AVKFIEFLNEFENNRMKP 68
           PG  V     K++ IK I  G F+ +Y               AVK I + +E  N    P
Sbjct: 245 PGETV-----KLKKIKLIGSGNFSDVYLYEALGESRSHFAQVAVKHIRYPSELVN---AP 296

Query: 69  KLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSN-----------AS 117
                D    K  L + E+ L     E++V+K +   P I++ Y  N           +S
Sbjct: 297 N---PDSPSYKDTLSRLESSLTR---ELDVLKSI-SHPCIIKLYAINDLKFFETKRPLSS 349

Query: 118 RRHNGFPGF--EVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLP 175
           R+H G  GF     ++M  C    L D  ++     L +  I +I  ++T  +  +H   
Sbjct: 350 RKH-GDKGFLPPCDMVMSYCSGGDLFDMASK---NNLPQWLIQRIFAELTMGMKYLH--E 403

Query: 176 TPLLHRDIKIENVLVDA----------------QNNFKLCDFGSTSTKFP--MVTTHQDI 217
             ++HRD+K+ENVL+                  QN  +L DFG      P  M TT    
Sbjct: 404 NLIIHRDLKLENVLLKLPLEQILAMKDVPLFKRQNLIELGDFGLCKKIQPDEMCTTRCG- 462

Query: 218 AVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK-SDIWALGIFLYKLLFFTTPFE 270
                      +  Y SPE++     LP D + SD WALG+ LY LL    PF+
Sbjct: 463 -----------SEDYVSPEIL---MGLPYDGRLSDAWALGVILYALLEDRLPFD 502

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 81/183 (44%), Gaps = 23/183 (12%)

Query: 82  LVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSN--ASRRHNGFPGFEVLLLMELCPNKS 139
           +   E  L     E++ M   +G  NI+   D +  + + ++G   ++            
Sbjct: 158 IFHREVLLKRAIRELKFMNYFKGHKNIINLLDLDIVSEKPYDGLYCYQ-----------E 206

Query: 140 LLDYMNQRL---ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196
           L+DY   R+   + +L+E  I   +Y +   +  +H     ++HRD+K  N+L     N 
Sbjct: 207 LIDYDLARVIHSSVQLSEFHIKSFLYQILCGLKYIH--SADVIHRDLKPGNILCTIHGNL 264

Query: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256
           K+CDFG      P     + ++ +T  +    T  YR+PE+I  ++     +  D+WA+G
Sbjct: 265 KICDFGLARGVSPQFFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVG 319

Query: 257 IFL 259
             L
Sbjct: 320 CIL 322

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 119/280 (42%), Gaps = 41/280 (14%)

Query: 41  IAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV-LVQDENGLNEMRNEVEVM 99
           I  G F  +Y  K   +LNE              V  +K V L   E  +  +  E+  +
Sbjct: 11  IGRGNFGDVYKAK-DTWLNE--------------VVAVKVVNLENSEEEVELLAQEIFFL 55

Query: 100 KQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILK 159
            +L+ +P +  Y  +             + + ME C   S+ D +     + L E +   
Sbjct: 56  AELK-SPYVTNYIATVVE-------DVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRF 107

Query: 160 IMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAV 219
           I  ++   +S +H      +HRDIK  N+L+  +   KL DFG +          + ++ 
Sbjct: 108 ITREILKGLSYLH--SQRKIHRDIKAANILLTDEGKVKLSDFGVSG---------KLLSS 156

Query: 220 LTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILH 279
             ++ +V  TP + +PE++  +     DE++DIW+LGI + ++L  + P        ++ 
Sbjct: 157 FRRDTFV-GTPYWMAPEIV-AHDSEGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIA 214

Query: 280 S--KYEFPK--NNYSSKLINLIIIMLAENPNLRPNIYQVL 315
           +  K + PK   ++S    + + + L +   +RP    +L
Sbjct: 215 NLPKRKPPKLHGDFSDDAKHFVALCLIKESAIRPTAADLL 254

>Kwal_33.14192
          Length = 577

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 19/149 (12%)

Query: 125 GFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIK 184
           G   L++ME CP     D+ N  ++  +++ EI      +   V  +H +   L HRD+K
Sbjct: 292 GTNFLVVMEYCP----YDFFNLVMSDLMSKNEISCYFKQICNGVDYLHRMG--LAHRDLK 345

Query: 185 IENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDL--Y 241
           ++N +V  Q   KL DFGS    ++P      +  +L     V + P Y +PE++    Y
Sbjct: 346 LDNCVVTKQGILKLIDFGSAVVFQYPY-----EKEILRAKGIVGSDP-YLAPELLSHPSY 399

Query: 242 RCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
              P+    D+W++ I  Y +     P++
Sbjct: 400 DPRPV----DVWSIAIMFYCITLKRFPWK 424

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 98/232 (42%), Gaps = 38/232 (16%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRV--LVQDENGLNEMR 93
           EII+++ +G +  + +VKF            K +     +A +K++  +   E  L    
Sbjct: 39  EIIQFLGKGAYGTVCSVKF------------KGRSPAARIA-VKKISNIFNKEILLKRAI 85

Query: 94  NEVEVMKQLQGAPNIVQYYDSN--ASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL--- 148
            E++ M   +G  NIV   D     S  ++G   ++            L+DY   ++   
Sbjct: 86  RELKFMNFFKGHKNIVNLIDLEIVTSSPYDGLYCYQ-----------ELIDYDLAKVIHS 134

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG-STSTK 207
           + +L+E  I   +Y +   +  +H     ++HRD+K  N+L       K+CDFG +    
Sbjct: 135 SVQLSEFHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIH 192

Query: 208 FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 259
                 H  +     N YV  T  YR+PE+  L    P  +  DIWA+G  L
Sbjct: 193 AGFFKCHSTVQPHITN-YV-ATRWYRAPEL--LLSNQPYSKSVDIWAVGCIL 240

>Scas_700.34
          Length = 864

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 94/198 (47%), Gaps = 25/198 (12%)

Query: 75  VACLKR-VLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLME 133
           +  ++R  + +D +   ++  E+  +K L   PNIV+  +   + ++ G       +++E
Sbjct: 86  IKLIRRDTISKDSSKEIKIYREINALKHLT-HPNIVKLEEVLQNSKYIG-------IVLE 137

Query: 134 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQ 193
                    Y+ ++   +L E    ++   +   V  +H     L+HRD+K+EN+L+D  
Sbjct: 138 YASGGEFYKYIQRK--KRLKEGPACRLFAQLINGVHYIHS--KGLVHRDLKLENLLLDKH 193

Query: 194 NNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPID-EKSDI 252
            N  + DFG  S  +    +H ++   +       +P Y +PE++      P + +K+DI
Sbjct: 194 ENLIITDFGFVSEFY----SHGELMKTSCG-----SPCYAAPELV--VSTKPYEAKKADI 242

Query: 253 WALGIFLYKLLFFTTPFE 270
           W+ G+ LY +L    P++
Sbjct: 243 WSCGVILYAMLAGYLPWD 260

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 85/188 (45%), Gaps = 41/188 (21%)

Query: 92  MRNEVEVMKQLQGAPNIVQ----YYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR 147
           + NE  ++++L    NI Q    Y D++             + ++E C    L D++   
Sbjct: 55  VHNEYAILRRLGTHRNICQLLDFYEDADT-----------YVFVLEYCAYGDLYDFIK-- 101

Query: 148 LATKLTEKEILKI-----MYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFG 202
               + E+  ++I     ++ +  A+S  H     + HRDIK ENVL+D +   KL DFG
Sbjct: 102 ---AIRERPTMRINFHSFLFQLCSAISYCH--SKDVSHRDIKPENVLMDDRGQVKLTDFG 156

Query: 203 STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
            +            I  ++++ Y   T +Y +PE     R       +D W+LGI ++ L
Sbjct: 157 LSQ-----------IGSVSKD-YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCL 202

Query: 263 LFFTTPFE 270
           +F + PFE
Sbjct: 203 MFGSCPFE 210

>Scas_673.20*
          Length = 758

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 111/251 (44%), Gaps = 53/251 (21%)

Query: 19  NERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACL 78
           NERY    ++  GA  +    Y  E G     A+K I+        +++P+LQM      
Sbjct: 478 NERYRKLKRIGEGASGIVYTAY--EIGTDISVAIKQIDL-------KIQPRLQM------ 522

Query: 79  KRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNK 138
                        +  E+ V+K+ Q  PNI+ +   N+   H+      + ++ME     
Sbjct: 523 -------------IWTEMLVLKEYQ-HPNIINFI--NSYLLHD-----TLWIVMEYMDGG 561

Query: 139 SLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKL 198
           SL D ++    T   E+++  I  +  + ++ +H     ++HRDIK +N+L+    + K+
Sbjct: 562 SLADIVSFFTPT---EEQMATICRETLFGLNFLH--SRGIVHRDIKSDNILLSMNGDIKI 616

Query: 199 CDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIF 258
            DFG     F    T  +    T+   +  TP + +PE+I      P   K D+W+LGI 
Sbjct: 617 TDFG-----FCGQLTESN----TKRTTMVGTPYWMAPEVIASKEYGP---KVDVWSLGIM 664

Query: 259 LYKLLFFTTPF 269
           + +++    P+
Sbjct: 665 IIEMIEGEPPY 675

>Kwal_56.24584
          Length = 435

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 91/198 (45%), Gaps = 36/198 (18%)

Query: 90  NEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA 149
           +++  E+ +M+ ++   NIV ++ +  +   +     E+++LME     SL   M+   A
Sbjct: 142 SQLIRELSIMQNVKPHDNIVGFFGAFYTASTSN----EIVILMEYMDCSSLDKIMSTYKA 197

Query: 150 -----------TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKL 198
                      T   E  + KI Y V   +S + Y    ++HRDIK  NVL++++   K+
Sbjct: 198 FVARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKI 256

Query: 199 CDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALG 256
           CDFG +     ++ +  D  V         T  Y SPE I   +Y       K D+W+LG
Sbjct: 257 CDFGVSK---KLINSIADTFV--------GTSTYMSPERIQGSVY-----STKGDVWSLG 300

Query: 257 IFLYKLLFFTTPFELTGQ 274
           + + +L+  T  F L G 
Sbjct: 301 LMIIELV--TGEFPLGGH 316

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 85/184 (46%), Gaps = 24/184 (13%)

Query: 91  EMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
           ++  EV++  +     N+++  D N S          + + MEL     L D +   +  
Sbjct: 61  DVLREVKLHSRCSNFVNVLKVIDCNLSDPF-------LWIAMELAEGGDLFDKIEPDIGV 113

Query: 151 KLTEKEILKIMY-DVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
              + E+ +  Y  +  A+S +H     + HRDIK EN+L+D   N KL DFG  S    
Sbjct: 114 ---DSEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPENILLDKDGNLKLADFGLAS---- 165

Query: 210 MVTTHQDIAVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKLLFFTT 267
            +   +D +         + P Y +PE+I  D Y      + +DIW++G+ L+ LL   T
Sbjct: 166 -LFKRKDGSKRISRDQRGSLP-YMAPEIIYCDGYYA----DMTDIWSIGVLLFVLLTGET 219

Query: 268 PFEL 271
           P+EL
Sbjct: 220 PWEL 223

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 93/203 (45%), Gaps = 26/203 (12%)

Query: 72  MGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLL 131
           +GD   +K++++  +     + NE+ VM   +   NIV + ++            ++ ++
Sbjct: 606 IGDKVAIKQMVLSKQPRKELIVNEIMVMNDSRHE-NIVNFLEAYLKTED------DLWVV 658

Query: 132 MELCPNKSLLDYM-----NQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIE 186
           ME     SL D +     N    + L+E +I  I+ +    +  +H     ++HRDIK +
Sbjct: 659 MEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH--DKNIIHRDIKSD 716

Query: 187 NVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPI 246
           NVL+D +   K+ DFG     F    T Q     ++   +  TP + +PE++        
Sbjct: 717 NVLLDTKARVKITDFG-----FCAKLTDQR----SKRATMVGTPYWMAPEVVKQKE---Y 764

Query: 247 DEKSDIWALGIFLYKLLFFTTPF 269
           D K D+W+LGI   ++L    P+
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPY 787

>Kwal_26.8941
          Length = 661

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 80/167 (47%), Gaps = 21/167 (12%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVT 165
           PN+++  D  +  + N +  +EV   ME CP    +D+    ++  ++  EI   +  ++
Sbjct: 191 PNVIETLDIFSDAKQNKY--YEV---MEYCP----IDFFAVVMSGNMSRGEINCCLRQLS 241

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNI 224
             V  +H +   L HRD+K++N ++      KL DFGS    K+P      D +V   + 
Sbjct: 242 EGVRYLHNMG--LAHRDLKLDNCVMTCDGILKLIDFGSAVVFKYPF-----DSSVTMAHG 294

Query: 225 YVHTTPQYRSPE-MIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
            V + P Y +PE M    R  P  +  DIW++GI    ++    P++
Sbjct: 295 IVGSDP-YLAPEVMTSTKRYDP--QFVDIWSIGIIYCCMMLKRFPWK 338

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/280 (22%), Positives = 118/280 (42%), Gaps = 54/280 (19%)

Query: 6   GPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNR 65
           G VS+    V P N  +  G ++  G+     +   A+ G  ++ AVK +E         
Sbjct: 375 GTVSLPTKIVTPKN--WLKGARIGSGSFGTVYLGMNAQTG--ELMAVKQVE--------- 421

Query: 66  MKPKLQMGDVACLKRVLVQDENG----------------LNEMRNEVEVMKQLQGAPNIV 109
           +KP      +A      V+D+N                 ++ +++E+ ++K+LQ   NIV
Sbjct: 422 IKPA-----IAATADANVEDKNAEKNVAKAPSTNLHRKMIDALQHEMSLLKELQ-HENIV 475

Query: 110 QYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVS 169
            YY S+         G  + + +E  P  S+   ++        E  I+     +   V+
Sbjct: 476 TYYGSSQE-------GGNLNIFLEYVPGGSVSSMLSNY--GPFEEPLIVNFTRQILIGVA 526

Query: 170 QMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTT 229
            +H     ++HRDIK  N+L+D +   K+ DFG +    P+   +QD     +   +  +
Sbjct: 527 YLHR--KNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQENQD-----KRTSLQGS 579

Query: 230 PQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
             + SPE++   +      K+DIW+ G  + ++     P+
Sbjct: 580 VYWMSPEVV---KQTATTSKADIWSTGCVVIEMFTGKHPY 616

>Scas_711.25
          Length = 1515

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 108/262 (41%), Gaps = 59/262 (22%)

Query: 41   IAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLV-----QDE---NGLNEM 92
            I +G F  +Y       LN          +  G++  +K+V V     QDE   + +  +
Sbjct: 1220 IGKGSFGAVYLC-----LN----------VTTGEMMAVKQVEVPKYSSQDEAIISTVEAL 1264

Query: 93   RNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFE-----VLLLMELCPNKSLLDYMNQR 147
            R+EV  +K L    NIVQY             GFE       L +E     S+   +  R
Sbjct: 1265 RSEVSTLKDLDHL-NIVQYL------------GFENKDNIYSLFLEYVAGGSVGSLI--R 1309

Query: 148  LATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
            +  +  E  I  +   V   ++ +H     +LHRD+K +N+L+D     K+ DFG  S K
Sbjct: 1310 MYGRFDEPLIRHLNTQVLRGLAYLHS--RGILHRDMKADNLLLDQDGVCKISDFG-ISRK 1366

Query: 208  FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTT 267
               + ++ D+        +  T  + +PEM+D  +      K DIW+LG  + ++     
Sbjct: 1367 SKDIYSNSDMT-------MRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1417

Query: 268  PFE----LTGQFAILHSKYEFP 285
            P+     +   F I  SK   P
Sbjct: 1418 PWSNYEVVAAMFKIGKSKSAPP 1439

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 106/236 (44%), Gaps = 36/236 (15%)

Query: 34  KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMR 93
           + ++IK I  G +  + + +F+E + +      K           KR L           
Sbjct: 22  RFQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSL----------- 70

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNG-FPGFEVLLLMELCPNKSLLDY-MNQRLATK 151
            E+++++  +G  NI   YD +     +G F G ++         + L+++ M+Q + + 
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVLLPDGSFNGLDLY--------EELMEWDMHQIIKSG 122

Query: 152 --LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS--TK 207
             LT+      +Y +   +  +H     +LHRD+K  N+LV+A    K+CDFG     ++
Sbjct: 123 QPLTDAHYQSFVYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE 180

Query: 208 FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLL 263
            P+    ++   LT+ +    T  YR+PE++  Y+        D+W+ G  L +LL
Sbjct: 181 NPI----ENDQFLTEYV---ATRWYRAPEIMLSYQ--GYTRAIDVWSCGCVLAELL 227

>Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement
          Length = 809

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 105/227 (46%), Gaps = 36/227 (15%)

Query: 41  IAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMK 100
           I  G F+Q+Y V F      +    ++PK         KR+L Q+   L+E+    E   
Sbjct: 480 IGTGQFSQVYQVTFGPANTRYAVKSIQPK----KYNSRKRIL-QEIELLSEIS---ETTL 531

Query: 101 QLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA---TKLTEKEI 157
             +G   +V Y    +S +H G       ++ E C N SL  ++ +++    T+L +  +
Sbjct: 532 DQEGKEYVVAYI---SSWKHQG----AYYVMTEYCENGSLDGFLREQVIAKNTRLEDWRV 584

Query: 158 LKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDI 217
            KI+ +++ A+  +H     ++H D+K  NVL+  +   KL DFG  + K P        
Sbjct: 585 WKIIVELSLALRFIHD-SCRVVHLDLKPANVLITFEGTLKLADFG-MAAKLP-------- 634

Query: 218 AVLTQNIYVHTTPQYRSPEMI--DLYRCLPIDEKSDIWALGIFLYKL 262
            +  +        +Y +PE+I   +Y     D ++DI++LG+ + ++
Sbjct: 635 -ISEEGFENEGDREYIAPEIIADGVY-----DFRADIFSLGLMIVEI 675

>Scas_477.5
          Length = 703

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (46%), Gaps = 22/181 (12%)

Query: 89  LNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL 148
           ++ +++E+ ++K+L    NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 485 VDALQHEMNLLKELH-HENIVTYYGSSQE-------GPNLNIFLEYVPGGSVSSMLNNY- 535

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
                E  I+  +  V   V+ +H     ++HRDIK  N+L+D +   K+ DFG  S K 
Sbjct: 536 -GPFEESLIVNFIRQVLIGVAYLH--NKNIIHRDIKGANILIDTKGCVKITDFG-ISKKL 591

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
             ++     A L  ++Y      + +PE++   +     EK+DIW+ G  + ++     P
Sbjct: 592 SPLSKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKHP 642

Query: 269 F 269
           F
Sbjct: 643 F 643

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 84/181 (46%), Gaps = 21/181 (11%)

Query: 89  LNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL 148
           ++ +++E+ ++K+L    NIV YY S+         G  + + +E  P  S+   +N   
Sbjct: 510 IDALQHEMNLLKELH-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNNY- 560

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
                E  I      +   ++ +H     ++HRDIK  NVL+D +   K+ DFG +    
Sbjct: 561 -GPFEEPLIKNFTRQILIGLAYLHR--KNIIHRDIKGANVLIDIKGCVKITDFGISKKLS 617

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
           P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 618 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 269 F 269
           F
Sbjct: 669 F 669

>Scas_653.25
          Length = 666

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 82/169 (48%), Gaps = 17/169 (10%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK--LTEKEILKIMYD 163
           PNI++  D   +      P  ++  +ME CP+    D+ N  ++    LT +E       
Sbjct: 329 PNIIETLDIFYN------PSGQISEIMEWCPH----DFFNIVMSRTHLLTRRETFCYFKQ 378

Query: 164 VTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQN 223
           +   V  +H L   + HRD+K++N ++      KL DFGS +T F +  + ++   L  +
Sbjct: 379 LCNGVRYLHTLG--IAHRDLKLDNCVITYNGILKLIDFGS-ATIFQLNKSTEEKPELIPS 435

Query: 224 IYVHTTPQYRSPEMIDLYRCLPIDEK-SDIWALGIFLYKLLFFTTPFEL 271
             +  +  Y +PE++ L + +P D   +D+W+LGI    ++    P+ +
Sbjct: 436 RGIVGSDPYLAPEVL-LSKEIPYDASLADVWSLGIIFCAIMLKRFPWRI 483

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 95/211 (45%), Gaps = 41/211 (19%)

Query: 103 QGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQR-LATKLTEKEILKIM 161
           +G PN+++ +D+      N      + +  +L     L  Y+ ++     ++E E L I+
Sbjct: 213 RGQPNVIKVHDTFVDENDN------IYIFEDLVAGGDLFSYLAKKDCLAPISETEALVIV 266

Query: 162 YDVTYAVSQMHYLPTPLLHRDIKIENVLV---DAQNNFKLCDFGSTSTKFPMVTTHQDIA 218
           Y +  A+  +H     ++HRD+K++N+L+   +  +   L DFG  +   P         
Sbjct: 267 YQILQALKFLH--SKGIVHRDLKLDNILLCTPEPCSRIVLADFG-IAKDLP--------- 314

Query: 219 VLTQNIYVHT---TPQYRSPEM---IDL--YRCLP---------IDEKSDIWALGIFLYK 261
             +  + +HT   TP+Y +PE+   +D   YR             D K D+W+LG+  + 
Sbjct: 315 --STRVRMHTIVGTPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHI 372

Query: 262 LLFFTTPFELTGQFAILHSKYEFPKNNYSSK 292
           +L   +PF   G  A +    +  K N+ +K
Sbjct: 373 MLTGISPFYGDGTEASIIRNVKIGKLNFGTK 403

>CAGL0I05390g complement(508677..510041) similar to sp|Q12505
           Saccharomyces cerevisiae YPL026c SKS1 suppressor kinase
           of SNF3 or tr|Q03785 Saccharomyces cerevisiae YDR247w,
           start by similarity
          Length = 454

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 40/151 (26%)

Query: 140 LLDYMNQRLATKLTEKE------------ILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           ++DY    L T + +K+             LKI   + Y  S   Y      H DIK EN
Sbjct: 136 VMDYYENDLFTSIVDKQYFANDGLLVKDVFLKICTALQYCHSMGVY------HCDIKPEN 189

Query: 188 VLVDAQNNFKLCDFG-STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPI 246
           +L+DA +N  LCDFG +T +K+           L  N+ V +   Y +PE I LY   P+
Sbjct: 190 ILLDASDNVYLCDFGLATDSKY-----------LAPNVCVGSF-YYMAPERI-LYSSAPL 236

Query: 247 DEK--------SDIWALGIFLYKLLFFTTPF 269
           + +        SDIW+LGI L  L+    P+
Sbjct: 237 ETETAVLPTATSDIWSLGIILINLVCMRNPW 267

>Kwal_26.8703
          Length = 444

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 98/222 (44%), Gaps = 47/222 (21%)

Query: 97  EVMKQLQ-----GAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRL--- 148
           +V+++LQ      +  IV+YY   A    +      + + ME    KSL D + + L   
Sbjct: 200 QVLRELQFNRSCSSEYIVRYYGMFAEESTS-----SIYIAMEYMGGKSL-DAIYKHLLER 253

Query: 149 ATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKF 208
             ++ EK + KI   V   +S +      ++HRDIK +N+L++     KLCDFG +    
Sbjct: 254 GGRIGEKVLGKIAESVLKGLSYLQE--RKIIHRDIKPQNILLNEAGQVKLCDFGVSG--- 308

Query: 209 PMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTP 268
                   +AV +       T  Y +PE I   +  P    SD+W+LG+ L +       
Sbjct: 309 --------VAVNSLATTFTGTSFYMAPERI---QGQPYSVTSDVWSLGLTLLE------- 350

Query: 269 FELTGQFAILHSKYEFPKNNYSSKL--INLIIIMLAENPNLR 308
                   +   ++ F  +N ++ +  I L++++L   P L+
Sbjct: 351 --------VAQGQFPFGSDNMAANMPPIELLMLILTFTPALK 384

>KLLA0A02717g 245082..246380 some similarities with sp|P53233
           Saccharomyces cerevisiae YGR052w, hypothetical start
          Length = 432

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 83/201 (41%), Gaps = 47/201 (23%)

Query: 92  MRNEVEVMKQLQG-APNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLAT 150
           +RNE  V+K+L    PNI    D    + H  F     + ++E C N  L DYM +   +
Sbjct: 51  VRNEYRVLKKLGNRHPNICAMLD--FYQDHEKF-----VFVLEYCHNGDLYDYMKRIKES 103

Query: 151 KLTEK------------------EILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192
             T+K                      +M+ +  A+   H L   + HRD K EN+LV  
Sbjct: 104 GGTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCHTLG--IAHRDFKPENILVTN 161

Query: 193 QNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI---DLYRCLPIDEK 249
               KL DFG   + F  V +   I           T +Y +PE     D Y        
Sbjct: 162 TGKIKLTDFG--LSYFGEVASDHGIG----------TEKYLAPETFSHNDTYN----TYS 205

Query: 250 SDIWALGIFLYKLLFFTTPFE 270
           +D+W+LGI +  ++F + PF+
Sbjct: 206 ADLWSLGISVLYIVFGSCPFK 226

>Kwal_33.13831
          Length = 700

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 96/233 (41%), Gaps = 40/233 (17%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVT 165
           PNI++  D    + H+GF   EVL   E CP+  L   +++     L   E    M  + 
Sbjct: 468 PNILKMLD--LMQTHDGF--IEVL---EFCPSGDLYSLLSRTSKNGLHPLEADCFMKQLL 520

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIY 225
           + V  MH     + H D+K EN+L   Q   K+CDFG TS  F      Q   V  Q   
Sbjct: 521 HGVKYMH--DHGIAHCDLKPENILFGPQGVLKICDFG-TSCVFQTAWEKQ---VHFQTGA 574

Query: 226 VHTTPQYRSPE-----------MIDLYRCLPIDEKSDIWALGIFLYKLLF---------F 265
           V + P Y +PE           ++D + C  I        LG +L+K+           F
Sbjct: 575 VGSEP-YVAPEEFIAEREYDPRLVDSWSCGVI---YCTMVLGHYLWKIPLVDKDPVYKSF 630

Query: 266 TTPFELTGQF-AILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
                   +F AI   K+  P+ N   KL   +  +   NP  R +I ++LH+
Sbjct: 631 VEEMRSKREFVAIEDLKHVTPEVNRCRKLC--LYAIFQWNPEKRTSIEKLLHS 681

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 123/273 (45%), Gaps = 48/273 (17%)

Query: 65  RMKPKLQMGD-VAC---LKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRH 120
           R   K+  GD VA    LK+ L  ++  L  + +E+ ++++L   PNIV++ D   S+  
Sbjct: 61  RQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLN-HPNIVKFKDWFESKE- 118

Query: 121 NGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLH 180
                 +  ++ +L     L D + Q+   K TE + +KI+  +  AV  +H     ++H
Sbjct: 119 ------KFYIVTQLATGGELFDRILQK--GKFTEVDAVKIVVQILKAVEYLH--SRNIVH 168

Query: 181 RDIKIENVL-VDAQNNFKLC--DFG-STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPE 236
           RD+K EN+L +D  +N +L   DFG +   K      H+    +           Y +PE
Sbjct: 169 RDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMG----------YVAPE 218

Query: 237 MIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF----------ELT-GQFAI-LHSKYEF 284
           ++         +  DIW++G+  Y LL   +PF          E T GQ+ +  H  Y  
Sbjct: 219 VL---TSNGHGKPCDIWSIGVITYTLLCGYSPFIAESVDGFLEECTSGQYPVTFHKPYW- 274

Query: 285 PKNNYSSKLINLIIIMLAENPNLRPNIYQVLHN 317
             NN S +    I+ +L  +P  RP    +L +
Sbjct: 275 --NNISKEAKLFILRVLTISPKKRPTATDLLSD 305

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 76/169 (44%), Gaps = 22/169 (13%)

Query: 95  EVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTE 154
           E+  +K L   PNIV   +   + ++ G       +++          Y+ ++   +L E
Sbjct: 108 EINALKHL-AHPNIVTLEEVLQNSKYIG-------IVLHYASGGEFYKYIQKK--RRLKE 157

Query: 155 KEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTH 214
               ++   +   V  MH+    L HRD+K+EN+L+D   N  + DFG  +      ++ 
Sbjct: 158 PAACRLFAQLISGVHYMHH--KGLAHRDLKLENLLLDEHENLIITDFGFVNE----FSSR 211

Query: 215 QDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLL 263
            D+   +       +P Y +PE++   +      K+D+W+ G+ LY +L
Sbjct: 212 NDLMKTSCG-----SPCYAAPELVVTTKAYEA-RKADVWSCGVILYAML 254

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 80/180 (44%), Gaps = 22/180 (12%)

Query: 95  EVEVMKQLQGAPNIVQ---YYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK 151
           E+E+++ +   PN+V+   +Y   +   H  +    +  L E+  N+ +L Y    L   
Sbjct: 72  ELEILR-IADHPNVVKLEYFYTHISPTDHKLYQHLAMECLPEMLQNE-ILRYKKNNLELP 129

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN-FKLCDFGSTSTKFPM 210
           L  K +    Y +   +  +H L   + HRDIK  NVLVD Q    K+CDFGS      +
Sbjct: 130 L--KHVKLYAYQIARGMLYLHALG--ICHRDIKPSNVLVDPQTGILKICDFGSAKK---L 182

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
            +    I+ +           YR+PE+I    C     K DIW LG  L ++L     F+
Sbjct: 183 ESNQPSISYICSR-------YYRAPELI--VGCTQYTTKIDIWGLGCVLGEMLLGKAVFQ 233

>Scas_692.24
          Length = 718

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 82/171 (47%), Gaps = 29/171 (16%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVT 165
           PN+++  D  +  + N +  FEV   M+ CP    +D+    +  K++  EI   +  + 
Sbjct: 274 PNVIETVDIFSDSKQNKY--FEV---MQYCP----VDFFAVVMTGKMSRGEINCCLKQLL 324

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNI 224
             V  +H +   L HRD+K++N +++     KL DFGS    ++P    ++D   +   I
Sbjct: 325 EGVKYLHSMG--LAHRDLKLDNCVMNEDGILKLIDFGSAVVFRYP----YEDDIAMAHGI 378

Query: 225 YVHTTPQYRSPEMIDLYR-----CLPIDEKSDIWALGIFLYKLLFFTTPFE 270
            V + P Y +PE+I   +     C+      DIW++GI    ++    P++
Sbjct: 379 -VGSDP-YLAPEVITSTKSYDPQCV------DIWSVGIIYCCMMLKRFPWK 421

>AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326)
           [1086 bp, 361 aa]
          Length = 361

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 56/233 (24%), Positives = 93/233 (39%), Gaps = 53/233 (22%)

Query: 128 VLLLMELCPNKSLLDYMNQRL--ATKLTEKEILKIMYDVTYAVSQMH------------- 172
           V ++++  P  SL   ++  L     L E  +L +M +V  AV  +H             
Sbjct: 110 VYMVLQYFPTGSLQQLIDTTLVEGVPLPEPRVLALMVEVCRAVRAVHQPGDEGVESGSAT 169

Query: 173 -----YLPTPLLHRDIKIENVLVDAQNNFKLCDFGS-----TSTKFPMVTTHQDIAVLTQ 222
                +L    L  D+ +E      + +F LCD        T    P+++   D++   +
Sbjct: 170 QSEDTHLLADALEMDV-LEASTSSPRRSFVLCDLRPSAVMLTPQGMPIIS---DLSACVR 225

Query: 223 NIY----------------VHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFT 266
           + Y                 H +P Y +PE+  L     I   +DIW+LG   Y L++  
Sbjct: 226 SGYALANATRLARMRAVLDTHGSPMYLAPELCALEPNACILPPADIWSLGCICYALMYGI 285

Query: 267 TPFELTGQF-------AILHSKYEFPKNN-YSSKLINLIIIMLAENPNLRPNI 311
           +PFE   Q        A     + FP N  YS +L++++   LA  P+ RP I
Sbjct: 286 SPFEREEQLHGTPLRQARASGLFSFPDNPVYSLQLLDIVRQCLAVKPDARPTI 338

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 91/200 (45%), Gaps = 33/200 (16%)

Query: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135
           A +K++    ++G      ++ ++K+L    NIV YY S+         G  + + +E  
Sbjct: 468 AVVKKLTDPPQDGGRASSTKMNLLKELH-HENIVTYYGSSQE-------GGNLNIFLEYV 519

Query: 136 PNKSLLDYMN------QRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           P  S+   +N      + L    T + ++ + Y        +H     ++HRDIK  N+L
Sbjct: 520 PGGSVSSMLNSYGPFEEPLVKNFTRQTLVGLTY--------LHR--KNIIHRDIKGANLL 569

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 249
           +D + + K+ DFG +    P+       A L  ++Y      + +PE++   + +   EK
Sbjct: 570 IDIKGSVKITDFGISKKLSPLNKKQNKRASLQGSVY------WMAPEVV---KQVVTTEK 620

Query: 250 SDIWALGIFLYKLLFFTTPF 269
           +DIW++G  + ++     PF
Sbjct: 621 ADIWSVGCVVVEMFTGKHPF 640

>CAGL0L06820g 767038..768138 highly similar to sp|P38615
           Saccharomyces cerevisiae YMR139w MDS1
           Serine/threonine-protein kinase, start by similarity
          Length = 366

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 95/193 (49%), Gaps = 30/193 (15%)

Query: 78  LKRVLVQDENGLNEMRNEVEVMKQLQGAPNIV--QYYDSNASRRHNGFPGFEVLLLMELC 135
           +K+VL QD+   N    E+E+MK LQ   NI+  +YY      R + F      L+++  
Sbjct: 65  IKKVL-QDKRFKN---RELEIMKMLQHR-NIIDLKYYFYEIDEREDVFLN----LILDYM 115

Query: 136 PN---KSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDA 192
           P    + L  +++QR  T +   EI   MY +  A++ +H+    + HRDIK +N+LVD 
Sbjct: 116 PQSLYQRLRHFVHQR--TPMPRLEIKIYMYQLFKALNYLHHTAN-VCHRDIKPQNLLVDP 172

Query: 193 QN-NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSD 251
            +   +LCDFGS     P   T  +++ +           YR+PE+I  +       + D
Sbjct: 173 NSWCLRLCDFGSAKQLKP---TEPNVSYICSR-------YYRAPELI--FGATNYTNQID 220

Query: 252 IWALGIFLYKLLF 264
           IW+ G  + +LL 
Sbjct: 221 IWSSGCVMAELLL 233

>CAGL0G05720g complement(547617..549833) similar to sp|P22211
           Saccharomyces cerevisiae YNL183c NPR1 ser/thr protein
           kinase, start by similarity
          Length = 738

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 103/224 (45%), Gaps = 28/224 (12%)

Query: 131 LMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLV 190
           +ME C      D     ++ KLT  E+      V + +S +H     + HRD+K++N +V
Sbjct: 433 VMEYCD----YDLYALVVSNKLTYDEVCCYFKQVLHGISYLH--DIGISHRDLKLDNCVV 486

Query: 191 DAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS 250
           + +   KL DFGS ST F   T + +  V+ ++  +H +  Y +PE+   +   P    +
Sbjct: 487 NKEGVLKLIDFGS-STVFN--TPYLEHRVVMRSSGIHGSNPYLAPEVCYYWSYDP--RPT 541

Query: 251 DIWALGIFLYKLLFFTTPFE----LTGQFAILHSKYEFPKNNYSSKLIN--LIIIMLAEN 304
           DIWA  I    ++    P+        QF   + KY+ P+    S+ +N  +++ +L + 
Sbjct: 542 DIWAAAIMFICMITKRFPWREPRCSDLQFT-RYIKYKEPQEQIMSRHVNSKVLLRLLQKT 600

Query: 305 PNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNK 348
           P      Y+ L+N    S   V    ++ +  +D+E Y  F  K
Sbjct: 601 P------YEHLNN----SSRGVSERHKHRKNLHDYEHYCRFLEK 634

>Kwal_27.11919
          Length = 209

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 86/190 (45%), Gaps = 34/190 (17%)

Query: 75  VACLKRVLVQ--DENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLL- 131
           V  LK++ ++  DE   +    E+ ++K+L+   NIV+ YD   S  H  +  FE L L 
Sbjct: 33  VVALKKIRLESEDEGVPSTAIREISLLKELKD-DNIVRLYDIVHSDAHKLYLVFEFLDLD 91

Query: 132 ----MELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
               ME  P +       Q L   + +K ++++   + Y  S        +LHRD+K +N
Sbjct: 92  LKRYMEAIPKE-------QPLGDNIIKKFMMQLCKGIAYCHSHR------ILHRDLKPQN 138

Query: 188 VLVDAQNNFKLCDFG-STSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPI 246
           +L++   N KL DFG + +   P+     +I  L           YR+PE+  L      
Sbjct: 139 LLINRDGNMKLADFGLARAFGVPLRAYTHEIVTL----------WYRAPEV--LLGGKQY 186

Query: 247 DEKSDIWALG 256
               DIW++G
Sbjct: 187 STGVDIWSIG 196

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 86/181 (47%), Gaps = 27/181 (14%)

Query: 95  EVEVMKQLQGA-----PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA 149
           E+++ ++L        PNIV+  +   + ++ G       ++++         Y+ ++  
Sbjct: 92  EIKIYRELNALKLLSHPNIVRLEEVLQNSKYIG-------IVLQYASGGEFYKYIQKK-- 142

Query: 150 TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFP 209
            +L E    ++   +   V  +HY    L HRD+K+EN+L+D   N  + DFG  + +F 
Sbjct: 143 RRLKEPPACRLFAQLISGVHYIHY--KGLAHRDLKLENLLLDEHENLIITDFGFVN-EF- 198

Query: 210 MVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF 269
               H++  + T       +P Y +PE++   +     +K+D+W+ G+ LY +L    P+
Sbjct: 199 ----HKNDLMRTSC----GSPCYAAPELVVSSKPYSA-QKADVWSCGVILYAMLAGYLPW 249

Query: 270 E 270
           +
Sbjct: 250 D 250

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 96/213 (45%), Gaps = 36/213 (16%)

Query: 67  KPKLQMGD-VACLKRVLVQDENGLNEMRNEVEVMKQLQ-----GAPNIVQYYDSNASRRH 120
           K KL+ G  +  LK +   + +G     +E ++ ++LQ      +  IV+YY   A    
Sbjct: 195 KCKLRNGSKIFALKTIATIENDG-----SEKQIFRELQFNKSCKSDFIVRYYGMFACEET 249

Query: 121 NGFPGFEVLLLMELCPNKSLLDYMNQRLATK---LTEKEILKIMYDVTYAVSQMHYLPTP 177
           +      + + ME    +SL D + + L +K   + EK + KI   V   +  +H     
Sbjct: 250 S-----TIFIAMEYMGGRSL-DSVYKHLLSKGGRIGEKVLGKIAESVLRGLFYLH--ERK 301

Query: 178 LLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEM 237
           ++HRDIK +N+L +     KLCDFG +             AV +       T  Y +PE 
Sbjct: 302 IIHRDIKPQNILFNEIGQIKLCDFGVSGE-----------AVNSLATTFTGTSYYMAPER 350

Query: 238 IDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
           I   +  P    SD+W+LG+ L ++    +PF+
Sbjct: 351 I---QGQPYSVTSDVWSLGLTLLEVAQGHSPFD 380

>Kwal_26.8347
          Length = 592

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 77/159 (48%), Gaps = 14/159 (8%)

Query: 179 LHRDIKIENVLVD-AQNNFKLCDFGST---STKFPMVTTHQDIAVLTQNIYVHTTPQYRS 234
           LHRD+K  N+L+D A  N  L DFGS+     K P    +   A   +   +  TP + +
Sbjct: 244 LHRDVKPSNILLDGASGNVLLSDFGSSLLLPEKLPFEDPNMLDAYQEEVHKIVGTPAFTA 303

Query: 235 PEMIDLYRCLP-IDE-KSDIWALGIFLYKLLFFTTPFELTGQFAILH--SKYEFPK-NNY 289
           PE+ +    +P +D  K DIW+LG+  Y LL    PF    +F      +K E PK  N+
Sbjct: 304 PELCNFEAGVPKLDGFKLDIWSLGVTAYCLLENKLPFWGENEFHTFQKIAKDELPKTGNW 363

Query: 290 SSKLINLIIIMLAENPNLRPNI---YQVLHNICSISGMK 325
              L+     +L ++P+ R  I    ++L +    SGMK
Sbjct: 364 LHDLVT--TKLLEKDPSKRIGIKELVEILQHPRKESGMK 400

>Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement
          Length = 616

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 79/167 (47%), Gaps = 21/167 (12%)

Query: 106 PNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVT 165
           PNI++  D  +    N +  +EV   ME CP    +D+    ++ ++   EI   +  +T
Sbjct: 271 PNIIETLDIFSDSHQNKY--YEV---MEYCP----IDFFAVVMSGRMGRGEINCCLKQLT 321

Query: 166 YAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTST-KFPMVTTHQDIAVLTQNI 224
             V  +H +   L HRD+K++N ++      KL DFGS    K+P      D  V   + 
Sbjct: 322 EGVRYLHSMG--LAHRDLKLDNCVMTHDGILKLIDFGSAVVFKYPF-----DTDVTMAHG 374

Query: 225 YVHTTPQYRSPEMI-DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFE 270
            V + P Y +PE++    R  P  +  DIW++GI    ++    P++
Sbjct: 375 IVGSDP-YLAPEVLTSTKRYDP--QGVDIWSIGIIYCCMMLKRFPWK 418

>Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement
          Length = 521

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 99/233 (42%), Gaps = 30/233 (12%)

Query: 34  KVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMR 93
           + ++IK I  G +  + + +F E + E      K           KR L           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFTEAVEETTVAIKKVTNVFSKTLLCKRSL----------- 70

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNG-FPGFEVLLLMELCPNKSLLDYMNQRLATKL 152
            E+++++  +G  NI   YD +     +G F G  +   +  C    ++     +    L
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFGIDGSFNGLYLYEELMECDMHQII-----KSGQPL 125

Query: 153 TEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTS--TKFPM 210
           ++      +Y +   +  +H     +LHRD+K  N+LV+A    K+CDFG     ++ P+
Sbjct: 126 SDAHYQSFIYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPV 183

Query: 211 VTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLL 263
               ++   LT+ +    T  YR+PE++  Y+        D+W+ G  L +LL
Sbjct: 184 ----ENNQFLTEYV---ATRWYRAPEIMLSYQ--GYTRAIDVWSCGCILAELL 227

>Scas_634.5
          Length = 790

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 106/235 (45%), Gaps = 46/235 (19%)

Query: 38  IKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVE 97
           +  I  G F+ +Y V F     ++                +K V     N LN +  E++
Sbjct: 447 VHMIGSGQFSSVYQVTFAPTNKKY---------------AVKAVKANKYNSLNRILQEIK 491

Query: 98  VMKQ-------LQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA- 149
           ++ +       L+G   ++ +    +S ++ G       ++ E   N +L  ++ +++  
Sbjct: 492 ILDEIRTSQLDLEGKEYVIDFI---SSWKYQG----SFYIMSEYYDNGNLDSFLQEQIIS 544

Query: 150 --TKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTK 207
             T+L +  I KI+ +++ A+  +H     ++H D+K  N+L+  + N KL DFG     
Sbjct: 545 KNTRLEDWRIWKIIVELSLALRFIHQT-CHVVHLDLKPTNILITFEGNLKLADFG----- 598

Query: 208 FPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKL 262
              +  H  + +  Q+       +Y +PE+I    C+  D K+DI++LG+ + ++
Sbjct: 599 ---MAAH--LPLRDQDFENEGDREYIAPEIIS--ECI-YDFKADIFSLGLMIVEI 645

>Scas_640.16
          Length = 505

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 89/209 (42%), Gaps = 48/209 (22%)

Query: 108 IVQYY----DSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLA--TKLTEKEILKIM 161
           IV+YY    D N+S          + + ME    KSL       L+   +++EK + KI 
Sbjct: 269 IVRYYGMFNDVNSS---------SIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKIS 319

Query: 162 YDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLT 221
             V   +S +H     ++HRDIK +N+L + +   KLCDFG +             AV +
Sbjct: 320 ESVLRGLSYLH--EQKVIHRDIKPQNILFNEKGQVKLCDFGVSGE-----------AVNS 366

Query: 222 QNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSK 281
                  T  Y +PE I   +  P     DIW+LG+ +                 +   +
Sbjct: 367 LATTFTGTSFYMAPERI---QGQPYSVTCDIWSLGLTI---------------LEVAQGR 408

Query: 282 YEFPKNNYSSKL--INLIIIMLAENPNLR 308
           + F  +  ++ +  I L++++L  NP L+
Sbjct: 409 FPFGSDKITATIAPIELLVLILTFNPELK 437

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 105/253 (41%), Gaps = 47/253 (18%)

Query: 107 NIVQYY--DSNASRRHNG--FPGFEVLLL-MELCPNKSLLDYMNQRLATK--LTEKEILK 159
           NIV++Y  D  +SR  N   +   EVL L ME C    L   +      +  + E++I +
Sbjct: 85  NIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCSCGDLSQMIKHYKGMRKYVPERDIWR 144

Query: 160 IMYDVTYAVSQMHY---LP---------------------TPLLHRDIKIENVLV--DAQ 193
           I   +  A+ + H    LP                     T ++HRD+K  N+ +  D  
Sbjct: 145 IAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDLKPGNIFLTGDGV 204

Query: 194 NNFKLCDFGSTSTK---FPMVTTHQDIAVLTQNIYVHTTPQYRSPE-MIDLYRCLPIDEK 249
                 D+     K   F +  + Q  A+     YV  TP Y SPE ++D     P    
Sbjct: 205 GGRGSVDYSKVEVKLGDFGLAKSLQS-AIEFATTYV-GTPYYMSPEVLMDQ----PYSPL 258

Query: 250 SDIWALGIFLYKLLFFTTPFE----LTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENP 305
           SDIW+LG  +Y+L     PF     +  Q  I  +  +   + YS +L  L+I  +  N 
Sbjct: 259 SDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLPDYYSKELQQLVISCINPNE 318

Query: 306 NLRPNIYQVLHNI 318
            LRP+ + +L  +
Sbjct: 319 KLRPSAFDLLQCL 331

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 18/141 (12%)

Query: 178 LLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVT-------THQDIAVLTQNIYVHT-T 229
           ++HRD+K ENVL+D      + DFG+ +T  P ++       +  + +   QN      T
Sbjct: 134 IIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCASFVGT 193

Query: 230 PQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF----ELTGQFAILHSKYEFP 285
            +Y SPE++   +C      SDIWALG  +Y+ +    PF    EL     I+   Y + 
Sbjct: 194 AEYVSPELLLYNQC---GYGSDIWALGCMIYQFVQGQPPFRGENELKTFEKIVALDYPWG 250

Query: 286 KNNY---SSKLINLIIIMLAE 303
            NN    S+  IN ++I L +
Sbjct: 251 PNNRINNSTSPINPLVINLVQ 271

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 106/237 (44%), Gaps = 34/237 (14%)

Query: 73  GDVACLKRVLVQDE--NGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLL 130
           G++  +K+++  D+    L  +R E++++++ Q   NI+  +D         F   EV +
Sbjct: 36  GEIVAIKKIVPFDKPLFALRTLR-EIKILRRFQHE-NIISIFDIQKPESFEKFN--EVYI 91

Query: 131 LMELCPNKSLLDYMNQRLATK-LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVL 189
           + EL         +++ +AT+ LT+  I   +Y    A+  +H   + ++HRD+K  N+L
Sbjct: 92  IQELMQTD-----LHRVIATQTLTDDHIQYFIYQTLRAIKTLH--GSNVIHRDLKPSNIL 144

Query: 190 VDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 249
           +++  + K+CDFG             ++  +    YV  T  YR+PE+  +         
Sbjct: 145 INSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYV-ATRWYRAPEV--MLTNAKYSRA 201

Query: 250 SDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPN 306
            DIW+ G  L + LF   P               FP  +Y  +L  L+I  L   P+
Sbjct: 202 MDIWSCGCILGE-LFLKRPL--------------FPGKDYRHQL--LLIFGLIGTPD 241

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 109/258 (42%), Gaps = 51/258 (19%)

Query: 36  EIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKP--KLQMGDVACLKRVLVQDENGLNEMR 93
           +I++ +  G F +++ ++         N R      L+   V  LK+V         E  
Sbjct: 153 QILRTLGTGSFGRVHLIR------SNHNGRFYALKALKKHTVVKLKQV---------EHT 197

Query: 94  NEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYM--NQRLATK 151
           N+   M  +   P I++ + +    +H       V ++M+      L   +  +QR    
Sbjct: 198 NDERRMLSIVSHPFIIRMWGTFQDSQH-------VFMVMDYIEGGELFSLLRKSQRFPNP 250

Query: 152 LTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMV 211
           + +    ++   + Y  S+       +++RD+K EN+L+D   + K+ DFG  +   P V
Sbjct: 251 VAKFYAAEVCLALEYLHSK------EIIYRDLKPENILLDKNGHIKITDFG-FAKYVPDV 303

Query: 212 TTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFFTTPF-- 269
           T             +  TP Y +PE++      P ++  D W+ GI +Y++L   TPF  
Sbjct: 304 T-----------YTLCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPFYD 349

Query: 270 --ELTGQFAILHSKYEFP 285
              +     IL+S+ +FP
Sbjct: 350 ANTMKTYEHILNSELKFP 367

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 123/303 (40%), Gaps = 69/303 (22%)

Query: 4   TSGPVSVNNTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFA-----------QIYAV 52
           T GPV   NT     +  Y P ++  V  +  EII+ +  G              Q+ A+
Sbjct: 89  TYGPVKETNTV----SLEYDPISKRKV-LNTYEIIEELGHGQHGKVKLARDLVTKQLVAI 143

Query: 53  KFIE------FLNEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQL--QG 104
           K +       F ++F N    P  Q G         ++DE    +++ E+ +MK+   + 
Sbjct: 144 KIVNRHKKRTFNDKFSNRFKTP--QSG---------IEDE----KIKREIAIMKKCHHEH 188

Query: 105 APNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKSLLDYMNQRLATK------LTEKEIL 158
              +++  D   SR+        + L++E C    +       + TK      L+ +   
Sbjct: 189 VVKLIEVLDDAKSRK--------IYLVLEYCSKGEIKWCPGDVIETKARGPPLLSFQRTR 240

Query: 159 KIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIA 218
           +I   V   +  +H+    ++HRDIK  N+L+      K+ DFG  S  F   ++   + 
Sbjct: 241 EIFRGVLLGLEYLHF--QGIIHRDIKPANLLLSEDGIVKISDFG-VSLAFSSDSSTDSLN 297

Query: 219 VLTQNIYVHTTPQYRSPEMI---DLYRCLPIDEKS---------DIWALGIFLYKLLFFT 266
            L +      TP + +PE+    D  +   +D  S         DIWA+GI L+ LLF  
Sbjct: 298 EL-ELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPIISFPTDIWAMGITLHCLLFGM 356

Query: 267 TPF 269
            PF
Sbjct: 357 LPF 359

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 95/209 (45%), Gaps = 33/209 (15%)

Query: 128 VLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIEN 187
           + + ME C N++L D ++     +    E  ++   +  A+S +H     ++HRD+K  N
Sbjct: 784 LFIQMEYCENRTLYDLIHSENLNQ-QRDEYWRLFRQILEALSYIH--SQGIIHRDLKPMN 840

Query: 188 VLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVL---TQNI--------YVHTTPQYRSPE 236
           + +D   N K+ DFG           H+ + +L   +QN+            T  Y + E
Sbjct: 841 IFIDESRNVKIGDFGLAK------NVHRSLDILKLDSQNLPGSSDNLTSAIGTAMYVATE 894

Query: 237 MIDLYRCLPIDEKSDIWALGIFLYKLLF-FTTPFELTGQFAILHS-KYEFP------KNN 288
           ++D       +EK D+++LGI  +++++ F+T  E       L S   EFP      K  
Sbjct: 895 VLD--GTGHYNEKIDMYSLGIIFFEMIYPFSTGMERVNILKKLRSVSIEFPPDFDDNKMK 952

Query: 289 YSSKLINLIIIMLAENPNLRPNIYQVLHN 317
              K+I L+I     +PN RP    +L++
Sbjct: 953 VEKKIIRLLI---DHDPNKRPGARTLLNS 978

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,743,858
Number of extensions: 1422855
Number of successful extensions: 5368
Number of sequences better than 10.0: 617
Number of HSP's gapped: 5100
Number of HSP's successfully gapped: 648
Length of query: 1095
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 983
Effective length of database: 12,718,893
Effective search space: 12502671819
Effective search space used: 12502671819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)