Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_661.2522522511741e-166
Kwal_56.230803141582913e-31
ABL103W3171632756e-29
YBR057C (MUM2)3661572742e-28
KLLA0F18722g2701592667e-28
CAGL0H10164g4841652581e-25
Scas_718.502361521947e-18
Sklu_2076.281536680.87
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_661.25
         (225 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_661.25                                                           456   e-166
Kwal_56.23080                                                         116   3e-31
ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   110   6e-29
YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   110   2e-28
KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   107   7e-28
CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...   103   1e-25
Scas_718.50                                                            79   7e-18
Sklu_2076.2 YLR207W, Contig c2076 599-3046 reverse complement          31   0.87 

>Scas_661.25
          Length = 225

 Score =  456 bits (1174), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%)

Query: 1   MNTHFFQNNQQQSGAFQTIPSSQTTGISNFNKNVPMNMYQYQHNQVNPDAILGDISFNSN 60
           MNTHFFQNNQQQSGAFQTIPSSQTTGISNFNKNVPMNMYQYQHNQVNPDAILGDISFNSN
Sbjct: 1   MNTHFFQNNQQQSGAFQTIPSSQTTGISNFNKNVPMNMYQYQHNQVNPDAILGDISFNSN 60

Query: 61  ARGSKNDVLSIKETQLSSLQIEMDHLKSILKERVQEQQKSVDDPNSHELLNVTNHELLFT 120
           ARGSKNDVLSIKETQLSSLQIEMDHLKSILKERVQEQQKSVDDPNSHELLNVTNHELLFT
Sbjct: 61  ARGSKNDVLSIKETQLSSLQIEMDHLKSILKERVQEQQKSVDDPNSHELLNVTNHELLFT 120

Query: 121 RLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKE 180
           RLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKE
Sbjct: 121 RLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKE 180

Query: 181 NQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLEREAKAST 225
           NQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLEREAKAST
Sbjct: 181 NQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLEREAKAST 225

>Kwal_56.23080
          Length = 314

 Score =  116 bits (291), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 110/158 (69%), Gaps = 5/158 (3%)

Query: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQ----KSVDDPNSHELLNV-TNHELLFTRLN 123
           L +KETQ+ SL++E+  LK I  + ++ +Q    +++  P  +  + V  + E +F +L+
Sbjct: 154 LQLKETQIESLEVEIQSLKLIFNDGLRLRQEHDLRALSGPAINASVEVPASLEAIFQKLS 213

Query: 124 SLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKENQE 183
           S L  K++E+ + + + ES++TA+AL+P+N +   G+ D E ++ KMV +LETLTKENQ+
Sbjct: 214 STLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVRLETLTKENQD 273

Query: 184 MSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLEREA 221
           M+K+L +  SK  +IE+ L++KEN EL+K+L+QLER+A
Sbjct: 274 MAKMLGYGRSKENHIEIELLKKENQELKKKLSQLERKA 311

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  110 bits (275), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 108/163 (66%), Gaps = 11/163 (6%)

Query: 69  LSIKETQLSSLQIEMDHLKSILKERV----QEQQKSVDDPNSHEL----LNV---TNHEL 117
           L +KETQ+ SL+ E+  LKSI  + +    QEQQ      + H L    + V    N E+
Sbjct: 147 LQLKETQIESLEDEITKLKSIFNQGLTFKQQEQQLQKRKLHQHALDLDHMPVEIPANLEI 206

Query: 118 LFTRLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETL 177
           +F +L + L+ K+ E++D R + ES++TA+AL+P+N +  +G+ D E ++ KM+ +LE L
Sbjct: 207 IFNKLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEML 266

Query: 178 TKENQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLERE 220
           TKENQEM+KLL++  SK  +IEL L++K N +L++++ QLE++
Sbjct: 267 TKENQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQLEKQ 309

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 98/157 (62%), Gaps = 9/157 (5%)

Query: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQ-------KSVDDPNSHELLNVTNHELLFTR 121
           L IKE+Q+ SL+ E+  LK I  E +  +Q       ++   P + EL    + E++F +
Sbjct: 197 LQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQTFEL--PASLEVIFRK 254

Query: 122 LNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKEN 181
           L+S L  KE+E+ + +   ES+LTALAL+P N +  YG+ D E I+ KMV +LE LT EN
Sbjct: 255 LSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRLENLTNEN 314

Query: 182 QEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLE 218
           +EM+K+L +  SK   IEL L +KEN ELR+++  LE
Sbjct: 315 KEMAKMLAYGRSKETQIELQLAKKENLELREKIASLE 351

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  107 bits (266), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 106/159 (66%), Gaps = 7/159 (4%)

Query: 69  LSIKETQLSSLQIEMDHLKSILKERV----QEQQK---SVDDPNSHELLNVTNHELLFTR 121
           L +KETQ+ SL+IE+  LK +  + +    QE+QK   S       E+    + E++F +
Sbjct: 111 LQLKETQIESLEIEIKKLKEVFNQGLTFKQQEEQKMKKSKALTFDSEIQIPASLEIIFCK 170

Query: 122 LNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLETLTKEN 181
           L+  L+ K++E+++ + + E ++TA+AL+P+N    +G+ D E ++ KMVT+LETL KEN
Sbjct: 171 LSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKEN 230

Query: 182 QEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLERE 220
           +EM+K+L++   K  +IEL L+RKEN EL++RL  L++E
Sbjct: 231 EEMAKMLSYGRVKETSIELELLRKENQELKERLRILQQE 269

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 99/165 (60%), Gaps = 23/165 (13%)

Query: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQ---------------KSVDDPNSHELLNVT 113
           + +K+ QL SLQ E+  LKS +   V   +               K +D PNS +++   
Sbjct: 320 IQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDII--- 376

Query: 114 NHELLFTRLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQ 173
                F +L+S LQ +E+E+ + +   ES+L A+AL+P+N    +G+ D E ++ K V +
Sbjct: 377 -----FRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVR 431

Query: 174 LETLTKENQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQLE 218
           LETLTKENQEM+++L+F  +K K+I L L++KEN +L+ ++ QL+
Sbjct: 432 LETLTKENQEMARMLSFGRAKEKHIALELLKKENKDLKTQIIQLK 476

>Scas_718.50
          Length = 236

 Score = 79.3 bits (194), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 87/152 (57%), Gaps = 8/152 (5%)

Query: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQKSVDDPNSHELLNVTNHELLFTRLNSLLQD 128
           L++K+ Q+ SL+ E+ +LK IL+      +K  DD  S       ++  +FT L S L +
Sbjct: 88  LNVKDIQIESLENEIQNLKKILQLNPNGTRKGDDDKISK------HYGPIFTNLVSSLLE 141

Query: 129 KEREIKDIRFKYESML--TALALDPANPMKSYGQLDVEMISQKMVTQLETLTKENQEMSK 186
           +  E + ++  YE +    A+ LD +N +   G+ D E I+ KM+ + E LTKEN  M+K
Sbjct: 142 RNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFEMLTKENSRMAK 201

Query: 187 LLNFEVSKSKNIELNLVRKENDELRKRLNQLE 218
           +L++      +IEL LV  EN EL++R+ QLE
Sbjct: 202 MLSYGRPMETDIELQLVEMENQELKERIKQLE 233

>Sklu_2076.2 YLR207W, Contig c2076 599-3046 reverse complement
          Length = 815

 Score = 30.8 bits (68), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)

Query: 27  ISNFNKNVPMNMYQYQHNQVNPDA--ILGDISFNSN 60
           I +  +N+ +  Y   + Q NPDA  I GDI F +N
Sbjct: 558 IPDARRNMALTFYTRAYKQANPDAGVIAGDIYFRAN 593

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,265,270
Number of extensions: 311476
Number of successful extensions: 1894
Number of sequences better than 10.0: 204
Number of HSP's gapped: 1858
Number of HSP's successfully gapped: 245
Length of query: 225
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 127
Effective length of database: 13,203,545
Effective search space: 1676850215
Effective search space used: 1676850215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)