Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_661.2437237219920.0
Sklu_2360.537237218040.0
CAGL0H10142g37237217730.0
YDR035W (ARO3)37037217460.0
Kwal_56.2307937237117330.0
KLLA0F18744g37237217240.0
ABL102C37337116110.0
AFL047W36436111481e-157
Scas_597.1337235411451e-157
CAGL0C01573g35635411421e-156
YBR249C (ARO4)37035411401e-156
Sklu_1187.136835411311e-154
Kwal_14.155436435411151e-152
KLLA0F06556g36435411011e-150
Scas_26.11831678431e-114
AFR270W381107890.005
YEL023C682109654.6
CAGL0D00572g1037106655.3
KLLA0D14927g507109645.6
KLLA0D15741g49168636.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_661.24
         (372 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_661.24                                                           771   0.0  
Sklu_2360.5 YDR035W, Contig c2360 14257-15375                         699   0.0  
CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...   687   0.0  
YDR035W (ARO3) [888] chr4 (521811..522923) 2-Dehydro-3-deoxyphos...   677   0.0  
Kwal_56.23079                                                         672   0.0  
KLLA0F18744g complement(1723008..1724126) highly similar to sp|P...   668   0.0  
ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH] (206411..207...   625   0.0  
AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH] complement(...   446   e-157
Scas_597.13                                                           445   e-157
CAGL0C01573g 170694..171764 highly similar to sp|P32449 Saccharo...   444   e-156
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...   443   e-156
Sklu_1187.1 YBR249C, Contig c1187 489-1595                            440   e-154
Kwal_14.1554                                                          434   e-152
KLLA0F06556g 633167..634261 highly similar to sp|P32449 Saccharo...   428   e-150
Scas_26.1                                                             329   e-114
AFR270W [3462] [Homologous to NOHBY] complement(919886..921031) ...    39   0.005
YEL023C (YEL023C) [1401] chr5 complement(108504..110552) Protein...    30   4.6  
CAGL0D00572g complement(72970..76083) similar to sp|Q07468 Sacch...    30   5.3  
KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces...    29   5.6  
KLLA0D15741g 1327061..1328536 weakly similar to sp|P40568 Saccha...    29   6.9  

>Scas_661.24
          Length = 372

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/372 (100%), Positives = 372/372 (100%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD
Sbjct: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI
Sbjct: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360

Query: 361 EGVRNRRAALSK 372
           EGVRNRRAALSK
Sbjct: 361 EGVRNRRAALSK 372

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/372 (89%), Positives = 349/372 (93%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKNDH GDRTRLEDWRIKGYDPLTPPDLLQHEYPISE+GHK IVDARE VC+ILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYAD+LA ++  LSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT LVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAH HYFLSVTKPG+TAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGK GTN+D+ +V+ T+KEL K  L D N TQRRIMIDCSHGNS+KD+RNQPKVAQSI
Sbjct: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           YDQLTAGENAICGVMIESNLVEGRQDVPPEGGR GLKYGCSITDACIGWESTE VL+ LA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360

Query: 361 EGVRNRRAALSK 372
           +GV+NRRA L K
Sbjct: 361 KGVQNRRATLKK 372

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/372 (87%), Positives = 349/372 (93%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHEYPISE+G   I+ AR++VCDILNGKD
Sbjct: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEYAD+LA IA  LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFTKL+EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAA+HEHYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGKHGTN+DAE+V+ TK++L+K  LID  D+ RRIMIDCSHGNSNKDYRNQPKVAQ I
Sbjct: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           Y+QL+AGEN +CGVMIESNLVEGRQDVPPEGGR GLKYGCSITDACIGW++TE VL+ LA
Sbjct: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360

Query: 361 EGVRNRRAALSK 372
           EGVRNRR  LSK
Sbjct: 361 EGVRNRRKHLSK 372

>YDR035W (ARO3) [888] chr4 (521811..522923)
           2-Dehydro-3-deoxyphosphoheptonate aldolase (DAHPS),
           inhibited by phenylalanine [1113 bp, 370 aa]
          Length = 370

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/372 (86%), Positives = 348/372 (93%), Gaps = 2/372 (0%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKNDHAGDR RLEDWRIKGYDPLTPPDLLQHE+PIS +G + I+ AR++VCDILNGKD
Sbjct: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCS+HDPKAAY+YADRLAKI+  LSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF KLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGK+GTNFD ESVQ TKK+L+K  L D  D+Q+RIMIDCSHGNSNKD++NQPKVA+ I
Sbjct: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTD--DSQKRIMIDCSHGNSNKDFKNQPKVAKCI 298

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           YDQLT GEN++CGVMIESN+ EGRQD+P EGGR GLKYGCS+TDACIGWESTE VL+ LA
Sbjct: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358

Query: 361 EGVRNRRAALSK 372
           EGVRNRR AL K
Sbjct: 359 EGVRNRRKALKK 370

>Kwal_56.23079
          Length = 372

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/371 (86%), Positives = 340/371 (91%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKNDH GDRTRLEDWRIKGYDPLTPPDLLQHE PIS +GHK IVDARE VCDILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEY DRLA  +   +KDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FT LVEK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVS+DAMRAAAH HYFLSVTKPGVTAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGK GTN+DAE+V+ T++EL K  + + N   RRIMIDCSHGNS+KDYRNQPKVAQSI
Sbjct: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           Y+QLT G+NAICGVMIESNLVEGRQDVP EGGR GLKYGCSITDACIGWE+TE+VL  LA
Sbjct: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360

Query: 361 EGVRNRRAALS 371
           +GV+NRR  LS
Sbjct: 361 KGVQNRRKTLS 371

>KLLA0F18744g complement(1723008..1724126) highly similar to
           sp|P14843 Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           phenylalanine-inhibited, start by similarity
          Length = 372

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/372 (85%), Positives = 342/372 (91%), Gaps = 1/372 (0%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFI NDH GDR+ LEDWRIKGYDPLTPPDLLQHEYPI E+  KIIV+ARE VCDILNGKD
Sbjct: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEYAD L KI+  LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT+L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMR+AAH HYFLSVTKPGVTAIVGTEGN+DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGK GTNFDAE+V+ T+ EL K  + DA   QRRIM+DCSHGNS KD+RNQPKVAQS+
Sbjct: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           Y+QL+AG+NAICGVMIESNLVEGRQDVPPEGGR  L YGCSITDACIGWE+TEDVL+ LA
Sbjct: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360

Query: 361 EGVRNRRAALSK 372
           +GV+NRR ALSK
Sbjct: 361 KGVKNRR-ALSK 371

>ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH]
           (206411..207532) [1122 bp, 373 aa]
          Length = 373

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 331/371 (89%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKN++ GD++RLEDWRIKGYDPLTPP++LQHE P+S  G  IIV ARE V  +L+G+D
Sbjct: 1   MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAIIVRAREGVVQVLSGRD 60

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRL++V+GPCSIHDP+AA EYA RL+++A+ L  +LL+IMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREM+T+LVE +PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240
           RELASGLSFPIGFKNGTDG LQV+IDAMRAAAH HYFLSVTKPGVTAIVGTEGN+DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTKPGVTAIVGTEGNEDTFII 240

Query: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300
           LRGGK GTN+DA SVQ  K++L    L+D+   QRRIMIDCSHGNSNKDYRNQPKVAQ I
Sbjct: 241 LRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDCSHGNSNKDYRNQPKVAQDI 300

Query: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360
           Y+QL+ GENAICGVMIESNLVEGRQD+P   GR GLKYGCSITDACIGW+ T +VL+ LA
Sbjct: 301 YEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGCSITDACIGWDQTVEVLELLA 360

Query: 361 EGVRNRRAALS 371
           +GV N+RA +S
Sbjct: 361 KGVINKRAVMS 371

>AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH]
           complement(351599..352693) [1095 bp, 364 aa]
          Length = 364

 Score =  446 bits (1148), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/361 (60%), Positives = 268/361 (74%), Gaps = 11/361 (3%)

Query: 8   AGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVI 67
           A D  + ED RI GYDPL  P LLQ + P ++   +     R    DI+ GKDDR+++V+
Sbjct: 8   AADADQAEDVRILGYDPLVSPALLQSQIPATQACLETAQKGRREAIDIITGKDDRVLVVV 67

Query: 68  GPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQ 127
           GPCSIHD  AA EYA RL K+A  L  DL+++MRAYLEKPRTTVGWKGLINDPD++N+F 
Sbjct: 68  GPCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYLEKPRTTVGWKGLINDPDVNNTFN 127

Query: 128 INKGLRISREMFTKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASG 186
           INKGL+ +R++F  L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASG
Sbjct: 128 INKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASG 187

Query: 187 LSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKH 246
           LSFPIGFKNGTDG L V++DA++A++H H+F+ VTK GV AI  T+GN+  FVILRGGK 
Sbjct: 188 LSFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKR 247

Query: 247 GTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTA 306
           GTN+DA SV   K +L  T +         +MID SHGNSNKD+RNQPKV + + +Q+  
Sbjct: 248 GTNYDATSVAEAKAKLPPTGV---------LMIDYSHGNSNKDFRNQPKVNEVVSEQIAN 298

Query: 307 GENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNR 366
           GE+ I GVMIESN+ EG Q +PPE G+AGLKYG SITD CI WE+TE+VL++LA  VR R
Sbjct: 299 GEDKIVGVMIESNINEGSQKIPPE-GKAGLKYGVSITDGCISWETTEEVLRKLAGAVRKR 357

Query: 367 R 367
           R
Sbjct: 358 R 358

>Scas_597.13
          Length = 372

 Score =  445 bits (1145), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/354 (61%), Positives = 270/354 (76%), Gaps = 10/354 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +E+  +     R    +I++G+DDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLVSPALLQVQIPATEKCIETAKKGRRESIEIISGRDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EYA +L K+A  LS+DL++IMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LDAAQEYALKLKKLADELSQDLVVIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFTKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 200

Query: 194 KNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKHGTNFDAE 253
           KNGTDG L V++DA +AA+H H+F+ VTK GV AI  T+GN+  FVILRGGK GTN+DA+
Sbjct: 201 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 SVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTAGENAICG 313
           SV   K +L   +          +MID SHGNSNKD+RNQPKV  ++ +Q+  GENAI G
Sbjct: 261 SVAEAKAQLPAGS--------NGLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGENAIIG 312

Query: 314 VMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNRR 367
           VMIESN+ EG Q +PPE G+AGLKYG SITDACI +E+TEDVLK+LA  VR RR
Sbjct: 313 VMIESNINEGSQKIPPE-GKAGLKYGVSITDACISFETTEDVLKKLAAAVRQRR 365

>CAGL0C01573g 170694..171764 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4, start by
           similarity
          Length = 356

 Score =  444 bits (1142), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/354 (61%), Positives = 269/354 (75%), Gaps = 10/354 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +E   +     R+   +I+ G+DDR+++++GPCS+HD
Sbjct: 8   EDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKESIEIITGRDDRVLVIVGPCSVHD 67

Query: 75  PKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EYA RL K++  L KDL I+MRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 68  LDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 127

Query: 135 SREMFTKLVEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 128 ARQLFVNLTNTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 187

Query: 194 KNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKHGTNFDAE 253
           KNGTDG L V++DA +AA+H H+F+ VTK GV AI  T+GN+  FVILRGGK GTN+DA+
Sbjct: 188 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 247

Query: 254 SVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTAGENAICG 313
           SV   KK+L +     AN     +MID SHGNSNKD+RNQPKV  ++ +Q+  GE AI G
Sbjct: 248 SVAEAKKQLPE----GANG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEKAIVG 299

Query: 314 VMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNRR 367
           VMIESN+ EG Q +PPE G+AGLKYG SITDACI WE+TEDVL++LA  VR RR
Sbjct: 300 VMIESNINEGNQCIPPE-GKAGLKYGVSITDACISWETTEDVLRKLAAAVRQRR 352

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
           2-Dehydro-3-deoxyphosphoheptonate aldolase
           (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
           DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score =  443 bits (1140), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/354 (62%), Positives = 264/354 (74%), Gaps = 10/354 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +    +     R    DI+ GKDDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            +AA EYA RL K++  L  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFTKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGF 200

Query: 194 KNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKHGTNFDAE 253
           KNGTDG L V++DA +AAAH H+F+ VTK GV AI  T+GN+  FVILRGGK GTN+DA+
Sbjct: 201 KNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 SVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTAGENAICG 313
           SV   K +L   +          +MID SHGNSNKD+RNQPKV   + +Q+  GENAI G
Sbjct: 261 SVAEAKAQLPAGS--------NGLMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITG 312

Query: 314 VMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNRR 367
           VMIESN+ EG Q +P E G+AGLKYG SITDACIGWE+TEDVL++LA  VR RR
Sbjct: 313 VMIESNINEGNQGIPAE-GKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQRR 365

>Sklu_1187.1 YBR249C, Contig c1187 489-1595
          Length = 368

 Score =  440 bits (1131), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 265/354 (74%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P ++   +     R+   DI+ GKDDR+++++GPCSIHD
Sbjct: 19  EDVRILGYDPLVSPALLQSQVPATQVSLQTAQRGRKESIDIITGKDDRVLVIVGPCSIHD 78

Query: 75  PKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            + A EY  RL K++  L  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 79  LELAQEYGTRLKKLSDELQGDLCIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQY 138

Query: 135 SREMFTKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 139 ARQLFVNLTSLGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGLSFPIGF 198

Query: 194 KNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKHGTNFDAE 253
           KNGTDG L V++DA++AA+H H+F+ VTK GV AI  T+GN+  F+ILRGGK GTN+DA+
Sbjct: 199 KNGTDGTLGVALDAVKAASHSHHFMGVTKHGVAAITTTKGNEHCFIILRGGKKGTNYDAQ 258

Query: 254 SVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTAGENAICG 313
           SV   K +L  T           +M+D SHGNSNKD+RNQPKV  ++ +Q+  GE+ I G
Sbjct: 259 SVAEAKAQLPPTG---------ALMVDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 309

Query: 314 VMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNRR 367
           VMIES++ EG+Q +PPE G+AGLKYG SITD CIGWESTE VL++LA  VR RR
Sbjct: 310 VMIESHINEGQQSIPPE-GKAGLKYGVSITDGCIGWESTEQVLRKLAAAVRQRR 362

>Kwal_14.1554
          Length = 364

 Score =  434 bits (1115), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/354 (59%), Positives = 260/354 (73%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI G DPL  P LLQ + P +    + +   R     I+ G+DDRL++++GPCSIHD
Sbjct: 14  EDVRILGLDPLVSPALLQSQIPATPECLRTVQKGRVGASKIIMGEDDRLLVIVGPCSIHD 73

Query: 75  PKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
              A EYA RL K+A  L  +L IIMRAYLEKPRTTVGWKGLINDPD++NSF INKGL+ 
Sbjct: 74  LDLAQEYARRLKKVADELEGELCIIMRAYLEKPRTTVGWKGLINDPDVNNSFNINKGLQC 133

Query: 135 SREMFTKLVEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 134 ARQLFVNLTSAGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 193

Query: 194 KNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKHGTNFDAE 253
           KNGTDG + V+IDAM AA+H H+F+ VTK G  AI  T+GN+  FVILRGG  GTN+DA+
Sbjct: 194 KNGTDGTMGVAIDAMLAASHSHHFMGVTKHGFAAITTTKGNEHCFVILRGGTKGTNYDAK 253

Query: 254 SVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTAGENAICG 313
           SV   K +L              +M+DCSHGNSNKDYRNQPKV  ++ +Q+  GE+ I G
Sbjct: 254 SVAEAKAQLPPGG---------TLMVDCSHGNSNKDYRNQPKVNDAVCEQVANGEDKIIG 304

Query: 314 VMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNRR 367
           VMIES++ EG+Q +PPE G+AGLKYG SITD CIGWE+TE+VL++L+  V+ RR
Sbjct: 305 VMIESHINEGKQSIPPE-GKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQRR 357

>KLLA0F06556g 633167..634261 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           tyrosine-inhibited, start by similarity
          Length = 364

 Score =  428 bits (1101), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/354 (59%), Positives = 262/354 (74%), Gaps = 11/354 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P S+   +     R+   DI+ GKDDR+++V+GPCSIHD
Sbjct: 13  EDVRILGYDPLVSPALLQAQVPASQECLETAQKGRKESIDIITGKDDRVLVVVGPCSIHD 72

Query: 75  PKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            K A +YA  L  ++  L  DL IIMRAYLEKPRTTVGWKGLINDPD+DN++ INKGL++
Sbjct: 73  LKEAQDYAKGLKALSDELKGDLCIIMRAYLEKPRTTVGWKGLINDPDVDNTYNINKGLQV 132

Query: 135 SREMFTKLVE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           SR++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 133 SRQLFVNLTSLGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 192

Query: 194 KNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVILRGGKHGTNFDAE 253
           KNGTDG L V++DA++AA+H H+F+ VTK GV AI  T+GN+  FVILRGGK GTN+D+ 
Sbjct: 193 KNGTDGTLGVALDAVQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSV 252

Query: 254 SVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSIYDQLTAGENAICG 313
           SV   KK L  T +         +MID SHGNSNKD+RNQPKV  ++ +Q+  GE+ I G
Sbjct: 253 SVAEAKKALPPTGV---------LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 303

Query: 314 VMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLAEGVRNRR 367
           VMIES++ EG+Q +P E G+AGLKYG SITD CI  E+T +VL++LA  VR RR
Sbjct: 304 VMIESHINEGKQSIPAE-GKAGLKYGVSITDGCISLETTAEVLRKLAAAVRARR 356

>Scas_26.1
          Length = 183

 Score =  329 bits (843), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 160/167 (95%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           MFIKNDH GDRTRLEDWRIKGYDPLTPPDLLQHEYPISE+GHK IVDARE VC+ILNGKD
Sbjct: 3   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 62

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVIVIGPCSIHDPKAAYEYAD+LA ++  LSKDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 63  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 122

Query: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSL 167
           DIDNSFQINKGLRISREMFT LVEKLPIAGEMLDTISPQFLSDCFS+
Sbjct: 123 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSV 169

>AFR270W [3462] [Homologous to NOHBY] complement(919886..921031)
           [1146 bp, 381 aa]
          Length = 381

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 135 SREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFK 194
           +R++   + E   +  ++LD     F+SD  SL  + AR+ +  L  ++ASGL   +  +
Sbjct: 126 TRDVLRAICEHTGVCLDILDNTLMNFVSDIPSLVVLDARSPDISL--KVASGLPSNVAVR 183

Query: 195 NGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVIL 241
                 +  +I  +   A    + +V+  G+   + T GN DTF+ L
Sbjct: 184 CRNANEIFSAIKILEHIAQPTLYPTVSHDGLPICIHTTGNPDTFLAL 230

>YEL023C (YEL023C) [1401] chr5 complement(108504..110552) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.9143p [2049 bp, 682 aa]
          Length = 682

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 14/109 (12%)

Query: 183 LASGLSFPIGFKNGTDGGL---QVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFV 239
           LA  + F + FK G          SI ++ A  H+  +LS   P   +++G   N+D   
Sbjct: 414 LAEAIKFGVKFKPGAIHDFATKHTSIGSLFADTHD--YLSFNSPKKCSLLGVSDNEDG-- 469

Query: 240 ILRGGKHGTNFDAESVQITKKELKKTNLIDANDTQR---RIMIDCSHGN 285
             R  K G N   E ++   K +K+T L   ++ ++      + C H N
Sbjct: 470 -AREDKSGRN---ERMEDCLKNIKETRLSLKDEKEKVKDAFTLKCGHAN 514

>CAGL0D00572g complement(72970..76083) similar to sp|Q07468
           Saccharomyces cerevisiae YDL077c VAM6 Vacuolar
           carboxypeptidase Y, start by similarity
          Length = 1037

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/106 (20%), Positives = 44/106 (41%), Gaps = 14/106 (13%)

Query: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60
           + +   H     RL +WR + +  +       +E P++       +D  E +CD+   KD
Sbjct: 132 ILVYTTHTPRVLRLFEWRKRSFQNV-------YEVPLN-------LDKTEIICDVSTIKD 177

Query: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEK 106
           D +V       + + K A    +++ K+    + D +I     LE+
Sbjct: 178 DLVVTTNKATYLWNYKTAKPVMNKITKMVKKRTPDNIITALTELER 223

>KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w singleton, start by similarity
          Length = 507

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 7/109 (6%)

Query: 30  LLQHEYPISERGHKIIVDAREAVCDILNGKDDRLVIVIGPCSIHDPKAAYEYADRLAKIA 89
           L++ +Y  + +  K   +    V D  N    R + V    S    K AY +   L +  
Sbjct: 159 LMKPKYHFTGKNEKQFFELDPFVWDHTNEHICRFINVAQFKS--GSKWAYAFKINLLEGL 216

Query: 90  ATLSKDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRISREM 138
            T+  +L  I   YLEKP    G + L+ DP+ DNS  ++K  R  +++
Sbjct: 217 ETIPDNL--IDNPYLEKPS---GKRDLVPDPETDNSSAVSKKQRKPKQV 260

>KLLA0D15741g 1327061..1328536 weakly similar to sp|P40568
           Saccharomyces cerevisiae YIR010w hypothetical protein
           singleton, hypothetical start
          Length = 491

 Score = 28.9 bits (63), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 231 TEGNKDTFVIL-------RGGKHGTNFDAESVQ---ITKKELKKTNLIDANDTQRRIMID 280
           +E  K T  IL       R G H  ++D+E  +     + E + +NL    +T+  I++D
Sbjct: 284 SESRKITLTILKDFVRDIRKGSHDIDWDSEGPEAEPTVEDESEISNLFKEGNTENSILVD 343

Query: 281 CSHGNSNK 288
            S  N NK
Sbjct: 344 SSLSNKNK 351

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,351,734
Number of extensions: 533341
Number of successful extensions: 1259
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1256
Number of HSP's successfully gapped: 22
Length of query: 372
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 269
Effective length of database: 13,030,455
Effective search space: 3505192395
Effective search space used: 3505192395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)