Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_660.3077477433590.0
YDR475C87663310321e-127
CAGL0M08954g8507698941e-107
YOR019W7306717322e-85
Scas_699.297167177286e-85
Kwal_47.182467735946291e-70
CAGL0H08261g7347316192e-69
AEL233C7935965748e-63
KLLA0F02684g7793033811e-37
CAGL0F07975g7702001633e-11
Kwal_14.10286801821508e-10
KLLA0E15642g766381445e-09
Scas_595.137662161428e-09
YGR237C7851951284e-07
ADL147W626391203e-06
Scas_654.91122148930.007
CAGL0J04026g119869712.4
Scas_506.6742116677.4
YOR011W (AUS1)139433668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_660.30
         (774 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_660.30                                                          1298   0.0  
YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Prote...   402   e-127
CAGL0M08954g 890764..893316 weakly similar to tr|Q99248 Saccharo...   348   e-107
YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unkno...   286   2e-85
Scas_699.29                                                           285   6e-85
Kwal_47.18246                                                         246   1e-70
CAGL0H08261g 810168..812372 weakly similar to tr|Q99248 Saccharo...   243   2e-69
AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH] (1...   225   8e-63
KLLA0F02684g 242962..245301 some similarities with sgd|S0005545 ...   151   1e-37
CAGL0F07975g complement(782229..784541) similar to sp|P50089 Sac...    67   3e-11
Kwal_14.1028                                                           62   8e-10
KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089 Saccha...    60   5e-09
Scas_595.13                                                            59   8e-09
YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein...    54   4e-07
ADL147W [1594] [Homologous to ScYGR237C - SH] complement(431887....    51   3e-06
Scas_654.9                                                             40   0.007
CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...    32   2.4  
Scas_506.6                                                             30   7.4  
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    30   8.7  

>Scas_660.30
          Length = 774

 Score = 1298 bits (3359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/774 (85%), Positives = 661/774 (85%)

Query: 1   MAFMEDQDQEDAILSTYRNIKLYPDTPKSETLVAKERNPYPYLRYKKCVSFNTIPVKTSK 60
           MAFMEDQDQEDAILSTYRNIKLYPDTPKSETLVAKERNPYPYLRYKKCVSFNTIPVKTSK
Sbjct: 1   MAFMEDQDQEDAILSTYRNIKLYPDTPKSETLVAKERNPYPYLRYKKCVSFNTIPVKTSK 60

Query: 61  DSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIHNKYITQKGFSNVKEIL 120
           DSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIHNKYITQKGFSNVKEIL
Sbjct: 61  DSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIHNKYITQKGFSNVKEIL 120

Query: 121 PPPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWEKRKLQ 180
           PPPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWEKRKLQ
Sbjct: 121 PPPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWEKRKLQ 180

Query: 181 IDSRLEKKEEVFQYSSTLFSQKNKNNNIPKKEDPYMPLSKEQKRKEKVLREAVGFPTIPR 240
           IDSRLEKKEEVFQYSSTLFSQKNKNNNIPKKEDPYMPLSKEQKRKEKVLREAVGFPTIPR
Sbjct: 181 IDSRLEKKEEVFQYSSTLFSQKNKNNNIPKKEDPYMPLSKEQKRKEKVLREAVGFPTIPR 240

Query: 241 TILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKMIDLXXXXXXXXXXXXXXXXXX 300
           TILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKMIDL                  
Sbjct: 241 TILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKMIDLSKSNKRGSRSRSRTRSQA 300

Query: 301 XXXXXEKLYSTLPEDEEEWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGK 360
                EKLYSTLPEDEEEWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGK
Sbjct: 301 RSRSSEKLYSTLPEDEEEWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGK 360

Query: 361 TKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFD 420
           TKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFD
Sbjct: 361 TKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFD 420

Query: 421 FERKLAKQFANPISTSEEELSTKNNFIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLA 480
           FERKLAKQFANPISTSEEELSTKNNFIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLA
Sbjct: 421 FERKLAKQFANPISTSEEELSTKNNFIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLA 480

Query: 481 CIVDDKDSVIAEGXXXXXXXXXXQLXXXXXXXXXXLQTKLHRTARKHRQIMARKIDEITK 540
           CIVDDKDSVIAEG          QL          LQTKLHRTARKHRQIMARKIDEITK
Sbjct: 481 CIVDDKDSVIAEGNDDIDDDNADQLSINSVSSSSSLQTKLHRTARKHRQIMARKIDEITK 540

Query: 541 DLTLDQAKKQLSKLDIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGVSGGAKPM 600
           DLTLDQAKKQLSKLDIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGVSGGAKPM
Sbjct: 541 DLTLDQAKKQLSKLDIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGVSGGAKPM 600

Query: 601 RSMLDVGXXXXXXXXXXXXXXXXQHHKSKIQFSANSKKIDENGALGNTKDYSLKPIRSYN 660
           RSMLDVG                QHHKSKIQFSANSKKIDENGALGNTKDYSLKPIRSYN
Sbjct: 601 RSMLDVGPLPKLKLKKTSSPISTQHHKSKIQFSANSKKIDENGALGNTKDYSLKPIRSYN 660

Query: 661 EPSSVSTDGRSIHSVSHSSYGETLRKIRSNESTKKSSIRHXXXXXXXXXXXXXXXXRWXX 720
           EPSSVSTDGRSIHSVSHSSYGETLRKIRSNESTKKSSIRH                RW  
Sbjct: 661 EPSSVSTDGRSIHSVSHSSYGETLRKIRSNESTKKSSIRHSNTTSSNTSSNSSGGSRWGL 720

Query: 721 XXXXXXXXXXXXXXXXXXXXXXXXXXXENDYIGFRPAPPPNXXXXXXXXXVRAK 774
                                      ENDYIGFRPAPPPN         VRAK
Sbjct: 721 FSLFRGSGSSSTHTKSGRSMSSSGSESENDYIGFRPAPPPNTTKKKSSKTVRAK 774

>YDR475C (YDR475C) [1291] chr4 complement(1407452..1410082) Protein
           of unknown function [2631 bp, 876 aa]
          Length = 876

 Score =  402 bits (1032), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/633 (37%), Positives = 358/633 (56%), Gaps = 91/633 (14%)

Query: 44  RYKKCVSFNTIPVKTSKDSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDN-PDFH 102
           +Y  CVSFNT+P ++   S LDE + +FPGVQ+ A  +YTM+EYYD+ESG+ SDN  D+ 
Sbjct: 69  KYLPCVSFNTVP-RSRVSSPLDEEKREFPGVQISA--DYTMEEYYDDESGFTSDNNADYF 125

Query: 103 IHNKYITQK--GFSNVKEILPPPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEA 160
             N Y +++    S  +   PPP +   + + +  +FKI+ENGKIVREDYP+ PT  N+A
Sbjct: 126 SGNSYSSRREGSASPGRYSSPPPASK--RNIKIGKMFKISENGKIVREDYPTTPTDINDA 183

Query: 161 VVINRAVLDWGSLWEKRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNN---------IPKK 211
           +VI+RA  +W  LW K+K QID RLE+K + F Y + LF    K ++          P  
Sbjct: 184 LVISRAYANWRQLWIKKKNQIDHRLEQKRDFFNYPTILFPPNKKKSSEGATPTIKFNPPI 243

Query: 212 EDPYMPLSKEQKRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVV 271
           ED + PL+K QKRKE+VL E VGFP  PRTILC +SGR+HTWVALDW ++ L Q+TD +V
Sbjct: 244 EDGFTPLTKSQKRKERVLSEKVGFPNTPRTILCHISGRKHTWVALDWALRTLIQNTDHIV 303

Query: 272 VVANLPKMID------------------LXXXXXXXXXXXXXXXXXXXXXXXEKLYSTLP 313
           V+ANLP++                    +                        +  S  P
Sbjct: 304 VLANLPRLTKNNFEDNDSMSERKRMLMMMDDSRSVSSARRSRSRSRSRSICTRRALSLGP 363

Query: 314 EDEE---------EWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKI 364
           E+ +         EW++GY+++ IE+KL+D+F Y+++++ ++ +S+K+TVE+++GKTKK 
Sbjct: 364 EESDNKLKHQNFIEWTSGYTQNEIERKLQDLFDYVTLIIPQD-RSVKVTVEILIGKTKKT 422

Query: 365 LCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERK 424
           L E IN Y PDF +SSTL+W+RT+SLV+WKS  LTDK+CT++P+P ++VPAKRMFD E  
Sbjct: 423 LLEAINIYLPDFFVSSTLRWERTDSLVRWKSNFLTDKLCTNFPIPTFIVPAKRMFDLEID 482

Query: 425 LAKQFANPISTSEEELST-KNNFIHPKLIHANSEMSPAI------------------ISA 465
           L K+F  P  T ++  S  K  F H K   A+      I                   + 
Sbjct: 483 LQKEFKEPEVTKQKNTSGPKPGFSHSKSADASIPTISNIKRKQDNDYSIDSLCYAPEANG 542

Query: 466 EQNYSSEDIYSPKLACIVDDKDSVIAEGXXXXXXXXXXQLXXXXXXXXXXLQTKLHRTAR 525
             N S E+    +L    DD++ V++                        ++ KL   AR
Sbjct: 543 ANNSSREEASDDELNAFKDDENDVMS---------------VKSLTSNISVKEKLCTMAR 587

Query: 526 KHRQIMARKIDEITKDLTLDQAKKQLSKLDIVIESSLQFSLELDTMP------DLDMETR 579
           K R+ MA+++++   D ++   ++ L KL+I++ESSL+FSLE+D++       D+D +  
Sbjct: 588 KRRKSMAQQLNDADHDSSIPPGQRHLKKLNIILESSLKFSLEIDSITDSIENGDVDEKRA 647

Query: 580 NANLNNLKSIMKGVSGG------AKPMRSMLDV 606
           ++  +  + + + ++GG      A P RSMLDV
Sbjct: 648 HSMESGFEELKRVITGGAPPRHVATPQRSMLDV 680

>CAGL0M08954g 890764..893316 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 850

 Score =  348 bits (894), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 248/769 (32%), Positives = 390/769 (50%), Gaps = 109/769 (14%)

Query: 19  NIKLYPDTPKSETLVAKERNPYPYLR----YKKCVSFNTIPVKTSKDSLLDEYEPDFPGV 74
           N  L P TP  + +  +++     +R     + CVSFNT+P+  SK +LLDEYE DFPGV
Sbjct: 49  NDSLEPGTPVLDAVDGRKKQRSVSVRANAKVRPCVSFNTVPL-PSKHTLLDEYEQDFPGV 107

Query: 75  QLYAPDNYTMDEYYDNESGYIS-DNPDFHIHNKYITQKGF------SNVKEILPPPTT-- 125
           QL+ P  YTM+EYYD+ESGY+S DN ++ +HN YIT +        +  +   PPP    
Sbjct: 108 QLF-PQEYTMEEYYDDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPLDRE 166

Query: 126 --NGGKRVALSN--------LFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWE 175
             + GK+  +S+        +FKIA+NG+IVREDYPSRPTL N+A ++NR + DW + W 
Sbjct: 167 YPSAGKQKKMSSKQQANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWHNTWR 226

Query: 176 KRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNN--IPKKEDPYMPLSKEQKRKEKVLREAV 233
            R+  I+ R E   E F+Y   LF Q+ K +   I   ED Y PL+KEQ++KEK++ + +
Sbjct: 227 SRRHTIEQRKEDLSETFEYPQLLFPQQTKPSEPVIMMGED-YKPLTKEQRKKEKIIHKKI 285

Query: 234 GFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKMIDLXXX-XXXXXXX 292
              + PR +LC +SG+RHTWV LDWTIK L+ D D +VV+A++P+MI             
Sbjct: 286 ESTSGPRVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMISSRRLITSASASR 345

Query: 293 XXXXXXXXXXXXXEKLYS---------TLPEDEE----------EWSAGYSKDVIEQKLR 333
                         K Y+         +L +D            EW++GYS++ +E  + 
Sbjct: 346 SRSRTRSRSRDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQEDVETTME 405

Query: 334 DIFRYISVLLTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQW 393
           +IF YI+ +L +  +S+KITVE+++G     + +  NAY PD +++STL+W+RT++LV W
Sbjct: 406 NIFDYIANILPEE-RSVKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERTDNLVLW 464

Query: 394 KSRKLTDKICTSYPVPVYVVPAKRMFDFERKL---AKQFANPISTSEEELSTKNN----- 445
           KS  L DK+ T +P+P++VVPA+RMF FE  L   +KQ    +     E+  +NN     
Sbjct: 465 KSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLEKENIEMEKENNVTGDI 524

Query: 446 --------FIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLACIVDDKDSVIAEGXXXX 497
                    + PK I         ++ A+   +  ++  P L   V    + IAE     
Sbjct: 525 VESEADKKIVPPKRIGTIGPPERRLVGADSFTAGFNMKRPSLGTSV---SAPIAENVFEE 581

Query: 498 XXXXXX---------QLXXXXXXXXXXLQTKLHRTARKHRQIMARKIDEITKDLTLDQAK 548
                           L          ++ KLH  AR +R   A+ + ++  + ++   +
Sbjct: 582 ESGSETGSDVDSELSDLSSDEGNDKLTVREKLHLKARSYRLQTAQYLKDLDNNKSISHEE 641

Query: 549 KQLSKLDIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGV------SGGAKPMRS 602
            Q+ K++ +I  +++FSL ++ +     +  +  L  LK ++ G       SG  K M S
Sbjct: 642 IQIKKVETIINQTIKFSLAIEDLGSESDDDDDVGLTKLKRVITGGAVLNPQSGSKKSMLS 701

Query: 603 MLDVGXXXXXXXXXXXXXXXXQHHK----SKIQFSANSKKIDENGALGN----------- 647
           +LD                    ++    S+I+F+++ K  D N ALGN           
Sbjct: 702 VLDNPKTTRKKKSLSATTSGVSGNRVPRSSQIKFASSVKHKDGNNALGNSVVHTKPQIQV 761

Query: 648 ---TKDYS--LKPIRSYNEPSSVSTDGRSIHSVSHSSYGETLRKIRSNE 691
              ++D S  L PIRSYN  SS     +++ S        +LR+++SN+
Sbjct: 762 HAASEDSSPKLTPIRSYNTGSSNQAGLKTMKS------NNSLRRVKSND 804

>YOR019W (YOR019W) [4832] chr15 (368126..370318) Protein of unknown
           function [2193 bp, 730 aa]
          Length = 730

 Score =  286 bits (732), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 210/671 (31%), Positives = 337/671 (50%), Gaps = 86/671 (12%)

Query: 45  YKKCVSFNTIPVKTSKDSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIH 104
           ++  V+F+T+P  T+  S +D+    F GV +  P+ YTM+E YD+E+   S N  +++ 
Sbjct: 44  FQPSVAFDTVP-STAGYSSIDDSREGFKGVPV--PNYYTMEECYDDETDSFSPNLQYYLR 100

Query: 105 NKYITQKGFSNVKE------ILPPPTTNG-GKRVALSNLFKIAENGKIVREDYPSRPTLS 157
           + + +    +  KE        P  ++    K   +   F +++NGKIVR DYPS P + 
Sbjct: 101 DTFQSSPFLNTRKENKSESSSFPMRSSKLLEKNSDIKKYFLVSKNGKIVRRDYPSTPVIV 160

Query: 158 NEAVVINRAVLDWGSLWEKRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNNIP-KKEDPYM 216
           NE ++INR   +W  LW +RKLQI+ RL  K++ F Y   +FS++      P  + D   
Sbjct: 161 NETLMINRFEKNWIKLWRQRKLQINERLNDKKKWFTYPELIFSEERIK---PLYRGDDSA 217

Query: 217 PLSKEQKRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANL 276
           P +KEQKRK K+L++ VG+P  P+TI+C ++G++HTWVALDWT+   A++ D +VV+  L
Sbjct: 218 PCTKEQKRKHKILQQKVGYPNNPKTIVCHINGKKHTWVALDWTVYKFARNLDHIVVITTL 277

Query: 277 PKMIDLXXXXXXXXXXXXXXXXXXXXXXXEKLYSTLPEDEEEWSAGYSKDVIEQKLRDIF 336
           PKMI                                 +D+ EW+ GY K+VI+QKL DIF
Sbjct: 278 PKMISNRKKT--------------------------AKDDTEWAPGYQKEVIDQKLNDIF 311

Query: 337 RYISVLLTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSR 396
            YI  L+     S+KIT+E+I+GK KK L +VIN +TPDF++ +TLK +R E+L+ +KS+
Sbjct: 312 DYILQLVKVVKISVKITLEIIVGKIKKSLVDVINVHTPDFLVLATLKHERNENLITYKSK 371

Query: 397 KLTDKICTSYPVPVYVVPAKRMFDFERKLAKQFANPISTSEEELSTKNNFIHPKLIHANS 456
           KLTD    SYP+P +VVP+KRM+ FE  L ++         E   +KN+  H    H + 
Sbjct: 372 KLTDVFPVSYPIPTFVVPSKRMYSFELNLQREV-------NEHYVSKNHMKHE---HTDV 421

Query: 457 E-MSPAIISAEQNYSSEDIYSPKLACIVDDKDSVIAEGXXXXXXXXXXQLXXXXXXXXXX 515
           E MS ++                    + D  S I+             +          
Sbjct: 422 ESMSSSMFKKN---------------TISDISSHISVDSYAEDFKRQGYIKKQFNTSNDS 466

Query: 516 LQTKLHRTARKHRQIMARKIDEIT---KDLTLDQAKKQLSKLDIVIESSLQFSLELDTMP 572
           +  KL   A+  R+ +   I+++    KD    + K  L K+DI+I  SL+ SL ++T+P
Sbjct: 467 IPRKLTGLAQHSRRKITGDIEKLQDDEKDRECTKEKLLLKKIDIIIRESLKSSLAIETLP 526

Query: 573 --DLDMETRNANLNNLKSIMKGVSGGAKPMRSMLDVGXXXXXXXXXXXXXXXXQHHKSKI 630
             ++   +    +++ K+ + G        R  L +                     S+I
Sbjct: 527 GKNVSQSSHGDQISSFKNALIGNGSKNTKFRKSL-IPYSSSEEQNTTTTIKLSSSPTSQI 585

Query: 631 QFSANSKKIDENGALGNTKDYSLKPIR---SYNEPSSVSTDGRSIHSVSHS-------SY 680
           +F+ + K  D   ALG  ++  L  IR   S+++ +S     +S  SV +S       S 
Sbjct: 586 KFATSVKHKDGRAALGKARN--LPDIRHSISFDKENSFDPSDKS-SSVDNSIPLRKVKSA 642

Query: 681 GETLRKIRSNE 691
           G  LRK+++N+
Sbjct: 643 G-ALRKVKTND 652

>Scas_699.29
          Length = 716

 Score =  285 bits (728), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 230/717 (32%), Positives = 343/717 (47%), Gaps = 112/717 (15%)

Query: 4   MEDQDQEDAILSTYRNIKLYPDTPKSETLVAKERNPYPYLRYKKCVSFNTIPVKTSKDSL 63
           M    QE+A+ S YR+I L    P S+  V K     P   ++ CVSFNT+P  +S+   
Sbjct: 1   MAKDQQEEALRSIYRHIYL----PNSKDPVGK-----PVHLWEPCVSFNTVPSSSSEKEY 51

Query: 64  LDEYEPDFPGVQLYAPDN--YTMDEYYDNESGYISDNPDFHIHNKYITQKGFSNVKEILP 121
            D    DF GV + +     +   EY  N     S NP                      
Sbjct: 52  PD---LDFEGVTMPSMKRQPFYYHEYPSNSQLCSSKNPK--------------------- 87

Query: 122 PPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWEKRKLQI 181
                  ++ +++ +FK+A+ GKIVR DYPSRP + NEA+++ +    W   W +RK  I
Sbjct: 88  -------RQKSMNEMFKMAQGGKIVRVDYPSRPMVDNEAMIMTKKQPLWRKKWRERKKII 140

Query: 182 DSRLE-KKEEVFQYSSTLF----SQKNKNNNIPKKEDPYMPLS--------------KEQ 222
           ++R +   + VF+Y   LF     QK    +    +  YM LS              KEQ
Sbjct: 141 EARRKCDGDSVFKYRFILFPHEEKQKEGKGSGGTLKKRYMGLSNNSSHSSSKTDVKLKEQ 200

Query: 223 KRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKMIDL 282
           KR+++V+   +G   +PRTI+C +SGRRHTWVALDW  K L QDTD VV++ANLP+M+  
Sbjct: 201 KRQKEVINLKIGDTNLPRTIVCHISGRRHTWVALDWLFKELVQDTDHVVILANLPRMV-- 258

Query: 283 XXXXXXXXXXXXXXXXXXXXXXXEKLYSTLPE-DEEEWSAGYSKDVIEQKLRDIFRYISV 341
                                  +K+    P+  EEEW++GYS++++  ++  I  YIS+
Sbjct: 259 --------------CRSKVAPDTKKIIQDEPKLLEEEWTSGYSENLVASRIARILEYISL 304

Query: 342 LLTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDK 401
           +L  + KSIKITVE+ +GKTKK+L + IN YTP+  +  TLKW +TE+L+ +KS  L D 
Sbjct: 305 ILPVD-KSIKITVEIAIGKTKKVLIDAINIYTPNLFVFGTLKWSKTENLISYKSNILMDT 363

Query: 402 ICTSYPVPVYVVPAKRMFDFERKLAKQFANPISTSEEELSTKNNFIHPKLIHANSEMSPA 461
            C  YP+P ++VPA+RM  FE  L +QFAN     E++ S K N  H   ++ N +   +
Sbjct: 364 FCVHYPIPTFIVPARRMSKFELSLQEQFAN----CEQQKSFKKNN-HVDKVNKNQQ---S 415

Query: 462 IISAEQNYSSEDIYSPKL--ACIVDDKDSVIAEGXXXXXXXXXXQLXXXXXXXXXXLQTK 519
           I+ A Q   S+D  +     +   D  DSV               L           +  
Sbjct: 416 IMLAVQ---SQDSLTAGYESSTETDSLDSVEKTSDDKDDNESVDTLRSYSNQTGT--RAN 470

Query: 520 LHRTARKHRQIMARKIDEITKD-LTLDQAKKQLSKLDIVIESSLQFSLELDTMPDLDMET 578
           L   AR +R  M ++++ +  +   L   ++QL KLDI+I++S++  L+ D + +  + T
Sbjct: 471 LCNIARDYRHSMLKELNTLEANKKKLTNQERQLGKLDIIIKASIRLVLKTDEIDEQSIAT 530

Query: 579 RNANLNNLK-SIMKGVSGGAKPMRSMLDVGXXXXXXXXXXXXXXXXQHH---KSKIQFSA 634
            N +  NLK +I  G S      RSMLDV                  +     S+I+F+ 
Sbjct: 531 NNKDYMNLKTTITGGKSRSQSRPRSMLDVNGYDPRAETKQSELGATLYQSRGSSQIRFAG 590

Query: 635 NSKKIDENGALGNTKDYSLKPIRSYNEPSSVSTDGRSIHSVSHSSYGET--LRKIRS 689
           N    D   ALG  K           +P S      S   +S  SY +   LRKI+S
Sbjct: 591 NVNPKDGKSALGTIK-----------KPQSGGASIPSSKYISDYSYNDVIPLRKIKS 636

>Kwal_47.18246
          Length = 773

 Score =  246 bits (629), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 185/594 (31%), Positives = 283/594 (47%), Gaps = 77/594 (12%)

Query: 49  VSFNTIPVKTSKDSLLDEYEPDFPGVQLYAPDN---YTMDEYYDNESGYISDNPDF---- 101
           VSF+T+P+      L      DF   + +  D+   YT +E+YDNE      +PDF    
Sbjct: 51  VSFDTVPL------LAGTACEDFD--EGHCSDHTLEYTEEEFYDNEC-----SPDFLRPS 97

Query: 102 --------HIHNKYITQ-KGFSNVKEILPPPTTNGGKRVALSNLFKIAENGKIVREDYPS 152
                     H++  +  +G S     L   T NG   +       +  +G+I R DYPS
Sbjct: 98  GNDRLMVPFSHSRSSSPLRGQSGTSMSLIDSTMNGLDGI------HVGADGRITRTDYPS 151

Query: 153 RPTLSNEAVVINRAVLDWGSLWEKRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNNIPKKE 212
           RPT+ N+A+VINR   D+ +LW KRK QID RL  +E  F +   LF  + K  N+P   
Sbjct: 152 RPTIVNDALVINRTHKDYSALWLKRKEQIDQRLRSREAHFVFPDILFPPE-KVANLPL-S 209

Query: 213 DPYMPLSKEQKRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVV 272
           D Y PLSKE++RK  ++ + +G+P  PRTILC +SGR+HTWV+LDW +K  +QD D +V+
Sbjct: 210 DGYTPLSKEERRKALIIGKKIGYPNSPRTILCYISGRKHTWVSLDWLLKRFSQDVDHLVI 269

Query: 273 VANLPKMID-----LXXXXXXXXXXXXXXXXXXXXXXXEKLYSTLPEDEE---------- 317
           + NLPKM +                               +  TL  D            
Sbjct: 270 ITNLPKMSNHRSRSRSRSRSTAPRSRSAAPSTHSSSGVSSIQRTLSADGHGDHNKHVHEH 329

Query: 318 --EWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKILCEVINAYTPD 375
             EW++GY  D I++ L +I RY++ +L  + +++K+TVE+++GK +KI+ + IN Y PD
Sbjct: 330 WLEWASGYDADQIKETLNNILRYVTTILPDH-RAVKVTVEIVIGKLQKIVVDAINVYGPD 388

Query: 376 FIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERKLAKQFANPIST 435
            I+ S+L+ +  ESLV+WKS  + DKIC + P+P+ +VP K+M + E ++   F      
Sbjct: 389 LIVLSSLRSKPDESLVRWKSNGVNDKICQTLPIPILLVPVKKMLELENEV---FNEICEC 445

Query: 436 SEEELSTKNNFIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLACIVDDKDSVIAEGXX 495
           S  E  T+ +   P +    S  +P I+ +  +  S    +        D    I     
Sbjct: 446 SAGEKCTE-DCKRPSMRQLKS--APQILKSYSSQKSSSSTNTG-----KDSSRTIDTSNT 497

Query: 496 XXXXXXXXQLXXXXXXXXXXLQTKLHRTARKHRQIMARKIDEITKDLTLDQAKKQLSKLD 555
                               L+  L    R   +I A+ +D I  D  L   +K + KLD
Sbjct: 498 TSLDSLMSSSADNDLKTDADLEDHLETCRR---EIKAKMLD-IDNDTRLSSEEKIILKLD 553

Query: 556 IVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGVSG--GAKPMRSMLDVG 607
            +  +SL F  ELD     D      +   LK ++ G +     +  +SMLDVG
Sbjct: 554 SITNASLHFINELD-----DKGRSTESFEELKRVITGDTNRDTVRAKKSMLDVG 602

>CAGL0H08261g 810168..812372 weakly similar to tr|Q99248
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 734

 Score =  243 bits (619), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 195/731 (26%), Positives = 343/731 (46%), Gaps = 124/731 (16%)

Query: 1   MAFMEDQDQEDAILSTYRNIKLYPDTPKSETLVAKERNPYPYLRYKKCVSFNTIPVKTSK 60
           M   ED D+  A+  TY+ IK+Y D  +          PY     +  VS++T+P K   
Sbjct: 1   MEMAEDADR--ALRDTYKRIKVYYDPAEL---------PYLVRDIRPSVSYDTVP-KYIG 48

Query: 61  DSLLDEYEPDFPGVQLY---APDNYTMDEYYDNESGYISDNPDFHIHNKYITQKGFS--- 114
            S +++ +  FPGV++     P    +          +  NP F +HN       +    
Sbjct: 49  YSAIEDMDGGFPGVEVTKHTVPVKTDLSRKGATLGSQVFLNPRFLLHNHVSGDDDYEIER 108

Query: 115 NVKEIL-PPPTTNGGKRVALS--NLFKIAENGKIVREDYPSRPTLSNEAVVINRAVLDWG 171
             K I    P  N    +  S  ++F    +GKI+R DYP++P   N+ ++ +R  + W 
Sbjct: 109 MKKRIFDASPLANNPLSLTRSKKSVFNYTADGKIIRSDYPTKPVFVNKIIIRSRTNVHWD 168

Query: 172 SLWEKRKLQIDSRLEKKEEVFQYSSTLFSQKNKNNNIPKKEDPYMPLSKEQKRKEKVLRE 231
             W +RK +I+  +E K+E F Y   LF +  +   I    D ++P++KEQ+R+ K+L  
Sbjct: 169 ERWAQRKSKIEYNMEHKDEKFMYPDILFPEVKEKPLI--MGDDFVPITKEQRRRNKILTI 226

Query: 232 AVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKMIDLXXXXXXXXX 291
               PT+PRT++C +SGRRHTW  LDW ++ LA++ D +V+VA +PKM            
Sbjct: 227 KQAHPTLPRTVVCYISGRRHTWAGLDWAVRSLAEN-DHLVIVATIPKMTSHRDQE----- 280

Query: 292 XXXXXXXXXXXXXXEKLYSTLPEDEEEWSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIK 351
                                PE +  W +GY+ D I+  + D+F YI V+   + K++K
Sbjct: 281 ---------------------PEVDGTWVSGYTFDEIDTIISDLFEYIKVIKPVH-KALK 318

Query: 352 ITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVY 411
           +T+E+ + +TK  L + IN Y+PDF+I  TLKWQR E+LV ++   + DK+CT++P+P +
Sbjct: 319 VTIEISIERTKGALIDAINVYSPDFLILGTLKWQRYENLVSYRGNNMVDKLCTTFPIPTF 378

Query: 412 VVPAKRMFDFERKLAKQFANPI--STSEEELSTKNNFIH----PKLIHANS--------- 456
           +VPA+R+F  E+++ ++    +    +++ ++ +N  I     PKL+  +S         
Sbjct: 379 IVPARRLFMLEKEIEEETLTKLISDNTKKAVTPENEEIEYPRSPKLVSTDSFGFWSKNEQ 438

Query: 457 ---EMSPAIISA------EQNYSSEDIYSPKLACIV---DDKDSVIAEGXXXXXXXXXXQ 504
              + S +I +       +++++S   +  + +  +   DD+DS + E            
Sbjct: 439 KLLDESYSISTKDKLEKRQESFTSLTTHESEDSLAIEDDDDRDSNLLES----------- 487

Query: 505 LXXXXXXXXXXLQTKLHRTARKHRQIMARKIDEITKDLT-LDQAKKQLSKLDIVIESSLQ 563
                      + +KL   A  +R+ M   ++E   + + ++  + QL+K+ ++I+ SL 
Sbjct: 488 --------TESIVSKLKSIAITNRKNMMADLEEFDNEHSNINTKENQLAKVSLIIKHSLN 539

Query: 564 FSLELDTMP-DLDMETRNANLNNLKSIMKGVSG-GAKPMRSMLDVGXXXXXXXXXXXXXX 621
            S  +  +  +LD E R   +  L+ ++ G     ++P  SM+D                
Sbjct: 540 SSNTIKNLTQNLDEENRGFAV--LQKVITGTGTVESRPKFSMVDA----VRVNGKIPGES 593

Query: 622 XXQHHKSKIQFSANSKKIDENGALGNTKDYSLKPIRSYNEPSSVSTDGRSIHSVSHSSYG 681
             +  +S+I+F++N K  D    LG               P  V   G S +S   S   
Sbjct: 594 SAKKRRSQIKFASNVKPTDGTAGLGT--------------PRIVGPTGESQYSGGTSP-- 637

Query: 682 ETLRKIRSNES 692
             LR + SNES
Sbjct: 638 --LRTVDSNES 646

>AEL233C [2273] [Homologous to ScYOR019W - SH; ScYDR475C - SH]
           (193752..196133) [2382 bp, 793 aa]
          Length = 793

 Score =  225 bits (574), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 172/596 (28%), Positives = 293/596 (49%), Gaps = 77/596 (12%)

Query: 49  VSFNTIPVKT-----SKDSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHI 103
           +SF+T+P++       +   L E++  + G  L    +YT++EYY+NE    S N D+  
Sbjct: 75  ISFDTVPIQGISPEEDEQDALHEHQRAY-GTSL----DYTLEEYYNNED--TSYNHDYRS 127

Query: 104 HNKYITQKGFSNVKEILPPPTTNGGKRVALSNLFKIAENGKIVREDYPSRPTLSNEAVVI 163
              Y  +   S ++ + P    +G +       F +  +G+ VR DYPS+ TL +++ V+
Sbjct: 128 GGGYAGE--LSPLRSLSPSRYGSGAQLAK----FDVLPDGRRVRIDYPSKSTLLSDSFVL 181

Query: 164 NRAVLDWGSLWEKRKLQIDSR-LEKKEEVFQYSSTLFSQKNKN-NNIPKKEDPYMPLSKE 221
           N+   +W S W+ RK QI+ R LE+ +  ++Y S LF +   + +++P   D  +  +  
Sbjct: 182 NKTHREWRSKWKARKAQIERRKLEEPQRWYRYPSILFPETKVDLSDLPMINDEGVAYNSN 241

Query: 222 Q----KRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLP 277
           Q    KR  +V+R  VGFP  PR +LC +SGR+HTW A+DW ++    D+D +VVVANLP
Sbjct: 242 QRANMKRIARVVRTPVGFPVSPRIVLCHVSGRKHTWAAVDWVLQNFIADSDHLVVVANLP 301

Query: 278 KMIDLXXXXXXXXXXXXXXXXXXXXXXXEKLYST-----------LPEDEEEWSAGYSKD 326
           +++                           L ST               +EEW  GY+  
Sbjct: 302 RLMSRFGYMSRSVSRSRSRSRSRSVRRTTGLNSTSSFGSDVSESMTKNKDEEWCNGYTVG 361

Query: 327 VIEQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQR 386
            IE  L  +  YI+ ++ +   +IK+TVE+++GKT+++L E +N + PD +++ST K++ 
Sbjct: 362 SIETILDHLIEYITFIIPEK-LAIKVTVEVMIGKTRQVLIEALNLHCPDLLVASTTKYKE 420

Query: 387 TESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERKL--------AKQFANPISTS-E 437
            + L+  +S++LT  +   YP+PV+VVPAKRMF    +L        A   A P+S    
Sbjct: 421 NDGLLDHRSKRLTTVLANYYPLPVFVVPAKRMFLLGMQLESIVHGSDACNAAAPVSQQFS 480

Query: 438 EELSTKNNFIHPKLIHANSEMSPAIISAEQNYSSEDIYSPKLACIVDDKDSVIAEGXXXX 497
            E+        P L   ++  SPA++   ++   E  Y    + I    DS +++G    
Sbjct: 481 SEVGDSLAPFKPSLKTMHT--SPAVMLHTESSVPEVEYGMDESEIT-SIDSELSDGVTEY 537

Query: 498 XXXXXXQLXXXXXXXXXXLQTKLHRTAR---KHRQIMARKIDEITKDLTLDQAKKQLSKL 554
                 Q            Q  + R AR    +R+ + ++  +I  D TL   ++  +KL
Sbjct: 538 AGTELLQ------------QDPVGRVARMRETYRRRVQKRFSKIDSDSTLQADERHFNKL 585

Query: 555 DIVIESSLQFSLELDTMPDLDMETRNANLNNLKSIMKGVSGGAKPM----RSMLDV 606
           D VI +SL+F+ EL+          N+   ++  + + ++GG K      +SMLDV
Sbjct: 586 DAVINASLKFNKELE----------NSKSPSILELQRIITGGEKHTGFRKKSMLDV 631

>KLLA0F02684g 242962..245301 some similarities with sgd|S0005545
           Saccharomyces cerevisiae YOR019w, hypothetical start
          Length = 779

 Score =  151 bits (381), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 155/303 (51%), Gaps = 17/303 (5%)

Query: 139 IAENGKIVREDYPSRPTLSNEAVVINRAVLDWGSLWEKRKLQIDSRLEKK-EEVFQYSST 197
              NG+I R DYPSRP L N A++  +   DW   W +R  +++ R E      F++   
Sbjct: 151 FGPNGEIRRRDYPSRPVLFNNALIRTQYHKDWKHEWRQRVEKMEERKETGVSTYFKFPEI 210

Query: 198 LFSQ-KNKNNNIPKKEDPYMPLSKEQ----KRKEKVLREAVGFPTIPRTILCLLSGRRHT 252
           LF + K    + P   D    + KE+    KR  KV+R  VG    PRTIL  +SGR HT
Sbjct: 211 LFPKVKVDLTDAPLVNDNGEMIQKERRASIKRHLKVVRTPVGLVKTPRTILVHISGREHT 270

Query: 253 WVALDWTIKCLAQDTDQVVVVANLPKMIDLXXXXXXXXXXXXXXXXXXXXXXXEKLYSTL 312
           WVALDW +  LA+D D +V++AN+P+  D                         +  S  
Sbjct: 271 WVALDWAMAELAEDIDYIVIIANIPRR-DWSTRSGSYTRSRSASRSRSRSRSRMRSVSRT 329

Query: 313 PE---DEEE----WSAGYSKDVIEQKLRDIFRYISVLLTKNPKSIKITVELILGKTKKIL 365
            E   D+++    W  G +   +   L+ +  Y ++++    K +KITVE+++G T +IL
Sbjct: 330 REFGTDDDQPDATWCDGCTVGEVNDLLQRLIEYSTLIM--GGKKLKITVEIVIGSTSQIL 387

Query: 366 CEVINAYTPD-FIISSTLKWQRTESLVQWKSRKLTDKICTSYPVPVYVVPAKRMFDFERK 424
            + +NAY PD F+I S++    + S+V  KSR L   +   +P+PV+ V A+RM  FE+K
Sbjct: 388 IDSLNAYAPDFFVIGSSIDKYGSGSVVVHKSRHLAPVLMQYFPIPVFFVAARRMGWFEKK 447

Query: 425 LAK 427
           L +
Sbjct: 448 LQR 450

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 49/91 (53%), Gaps = 13/91 (14%)

Query: 519 KLHRTARKHRQIMARKIDEITKDLTLDQAKKQLSKLDIVIESSLQFSLELDTMPDLDMET 578
           ++ +    +R ++ +K+  + +D  L   ++   K+D +I ++L F+ EL+T  D     
Sbjct: 510 QIQKLRHNYRCLVDKKLKLLDEDTGLPTPEQYYGKMDSIINATLNFNKELETWGD----- 564

Query: 579 RNANLNNLKSIMKGVSGGAKPM----RSMLD 605
            +A++  +K   + ++GG +P     +SMLD
Sbjct: 565 -SADMAEIK---RSITGGVRPRVMKKKSMLD 591

>CAGL0F07975g complement(782229..784541) similar to sp|P50089
           Saccharomyces cerevisiae YGR237c, start by similarity
          Length = 770

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (46%), Gaps = 27/200 (13%)

Query: 240 RTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKM-IDLXXXXXXXXXXXXXXXX 298
           RTI+C +SGRR+TW ++DW I+ +A D D +V+V+ +P+   +L                
Sbjct: 316 RTIMCYISGRRYTWSSVDWYIENVAADGDHLVIVSRVPEFEKELETLCNQEKRKSKLQQR 375

Query: 299 XXXXXXXEKLYS---TL-------PEDEEEWSAGYSKDVIEQKLRDIFR----YISVLLT 344
                    +YS   TL       P+     + G+  + I  + R++ R    Y +  L 
Sbjct: 376 NSDRSDRISVYSESHTLSSTPSSDPDAVTPSTIGFRAEAIRDRAREVCRELLDYYAYRLK 435

Query: 345 KNPKSIKITVELILG-KTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSR--KLTDK 401
              K  KITVE++    TK  +      Y P+F I ST+    T + +++++   KL   
Sbjct: 436 D--KITKITVEIVKSDSTKDAITGAAGVYAPNFQIISTVS---TNTQIKFRNGNVKLPFF 490

Query: 402 ICTSYPVPVYVVPAKRMFDF 421
           +   YP+P +++P    F+F
Sbjct: 491 VLKHYPMPTFLIP----FEF 506

>Kwal_14.1028
          Length = 680

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 82/182 (45%), Gaps = 16/182 (8%)

Query: 240 RTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLP---KMIDLXXXXXXXXXXXXXX 296
           RTI+C +SGR+HTW A+DW +K LA+D D +++   +P   + +                
Sbjct: 308 RTIICSISGRKHTWSAVDWYVKNLARDGDYLIIATRIPVFEESVKRTPAPQTHLTENYDP 367

Query: 297 XXXXXXXXXEKLYSTLPEDEEEWSAGYSKDVI-EQKLRDIFRYISVLLTKNPKSIKITVE 355
                    E+  S      E+       D++  QK  DI  Y    L+   K +K+TVE
Sbjct: 368 RNKNQSRSQERKSSIT----EQGLLVQDIDILARQKCNDILNYYLDKLSH--KCVKVTVE 421

Query: 356 LIL-GKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSR--KLTDKICTSYPVPVYV 412
           +I    T   L   I  Y PD  I ST+    T   +++K+   KL + +   + VP YV
Sbjct: 422 IIKDNSTVFALTSAIALYKPDLKIVSTVS---TNLHIKFKNGHVKLPNFLMRHFWVPTYV 478

Query: 413 VP 414
           VP
Sbjct: 479 VP 480

>KLLA0E15642g 1393066..1395366 weakly similar to sp|P50089
           Saccharomyces cerevisiae YGR237c singleton, start by
           similarity
          Length = 766

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 28/38 (73%)

Query: 240 RTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLP 277
           RT++C L+GRRHTW  +DW IK  A+D D +VV  NLP
Sbjct: 328 RTVVCFLNGRRHTWATVDWFIKEAARDGDHLVVATNLP 365

>Scas_595.13
          Length = 766

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 95/216 (43%), Gaps = 26/216 (12%)

Query: 218 LSKEQKRKEKVLREAVGFPTIPRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLP 277
           ++K ++R     +EA+   T  RT+ C +SGRR TW  +DW I+ +A+D D V+++  +P
Sbjct: 318 VTKTKERLHSKEKEAI---TALRTVSCYISGRRFTWATVDWYIENIAKDGDHVIIMTCIP 374

Query: 278 KMIDLXXXXXXXXXXXXXXXXXXX-XXXXEKLYSTLPED--EEEWSAGYSKDVIEQ---- 330
           +   L                            S+  +D  E + S G   + I Q    
Sbjct: 375 EFETLVEKANYQAFRDRLNSDGTSPSISRSSKDSSFNKDGYESKISEGLYIEAIYQEART 434

Query: 331 KLRDIFRYISVLLTKNPKSIKITVELILGKTKKILCEVINA-YTPDFIISSTLKWQRTES 389
           K R I  Y +  L    K +KIT+E++   + K     I A Y P+  + ST+      +
Sbjct: 435 KCRQILNYYAKRLEN--KKVKITIEMVKDNSSKRAVNAIEALYRPNLQLFSTV-----ST 487

Query: 390 LVQWKSR----KLTDKICTSYPVPVYVVPAKRMFDF 421
            +Q K R    K    I   + +PV++VP    F+F
Sbjct: 488 NIQIKFRNGNVKFPFFIMKHFFIPVFIVP----FEF 519

>YGR237C (YGR237C) [2185] chr7 complement(963302..965659) Protein of
           unknown function, has weak similarity to uncharacterized
           C. albicans Orf6.794p [2358 bp, 785 aa]
          Length = 785

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 24/195 (12%)

Query: 240 RTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLPKM---IDLXXXXXXXXXXXXXX 296
           R + C +SGRR+TW ++DW ++ L ++ D +V++  +P+    ID               
Sbjct: 337 RVVSCYISGRRYTWSSVDWYVENLTRNGDHLVIITTIPEFEAKIDTLAYKEKRRHRLERM 396

Query: 297 XXXXXXXXXEKLYSTL-PEDEEEWSAGYSKDVI----EQKLRDIFRYISVLLTKNPKSIK 351
                       +S + P+     S G   + I    +Q   DI  Y +  L    K ++
Sbjct: 397 TSNTSESMTTASHSLIGPDLSSPLSTGIRIEAIHNEAKQTCSDILNYYARRLAT--KIVR 454

Query: 352 ITVELIL-GKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSR----KLTDKICTSY 406
           I++E++    T+  +    + Y P   + ST+        +Q K R    KL   +   +
Sbjct: 455 ISIEMVKENSTRSAIISATSLYRPSLQVISTVSAN-----IQIKFRNGKVKLPFFLMKHF 509

Query: 407 PVPVYVVPAKRMFDF 421
            +P +VVP    F+F
Sbjct: 510 AMPAFVVP----FEF 520

>ADL147W [1594] [Homologous to ScYGR237C - SH]
           complement(431887..433767) [1881 bp, 626 aa]
          Length = 626

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (66%)

Query: 239 PRTILCLLSGRRHTWVALDWTIKCLAQDTDQVVVVANLP 277
           PRT+ C LSGRRH+W A+D  I   A+  D +V+ A LP
Sbjct: 245 PRTVACYLSGRRHSWSAVDAYINMFARSGDHLVIWAYLP 283

>Scas_654.9
          Length = 1122

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 8/148 (5%)

Query: 4   MEDQDQEDAILSTYRNIKLYPDTPKSETLVAKERNPYPYLRYKKCVSFNTIPVKTSKDSL 63
           MED++ ++ ++  +    + P+ P +     +E +P+         +  T  V+ S++ +
Sbjct: 538 MEDEENDNGLVPDFVPTDVDPNDPLASMFEYEEEDPF------ATTTTITPNVEESEEDI 591

Query: 64  LDEYEPDFPG-VQLYAPDNYTMDEYYDNESGYISDNPDFHIHNKYITQKGFSNVKEILPP 122
            DE E    G  ++Y+       E       Y   NP  HIH   +T       KE++P 
Sbjct: 592 FDESEEVLIGFARIYSGSISVGQEISVLGPKYDPKNPTEHIHTATVTCLYLFMGKELVPL 651

Query: 123 PTTNGGKRVALSNLF-KIAENGKIVRED 149
            T   G  V +  L  KI +NG +V++D
Sbjct: 652 DTCPSGNIVGIGGLAGKILKNGTLVQKD 679

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
           Saccharomyces cerevisiae YOR227w or tr|Q03016
           Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 61  DSLLDEYEPDFPGVQLYAPDNYTMDEYYDNESGYISDNPDFHIHNKY----ITQKGFSNV 116
           DS + E   D P   ++A + +   E YD+ +  ++ NPD H H+      +      ++
Sbjct: 376 DSRVAELTIDKP---IHAHETFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHL 432

Query: 117 KEILPPPTT 125
           +EILP P+T
Sbjct: 433 REILPIPST 441

>Scas_506.6
          Length = 742

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 12/116 (10%)

Query: 343 LTKNPKSIKITVELILGKTKKILCEVINAYTPDFIISSTLKWQRTESLVQWKSRKLTDKI 402
           LT+ P    +  E I  +T K+L   IN  TP  I S  ++   TE++  ++   L +K+
Sbjct: 137 LTQRPNKSNLLQE-IESQTNKLLVSKINVTTPQVIQSIDVQRPITETISHYEYINLVEKL 195

Query: 403 CTSYPVPVYVVPAKRMFDF-----------ERKLAKQFANPISTSEEELSTKNNFI 447
             SY +P      K+ F+            ER + K +   I T+ ++ S ++N I
Sbjct: 196 KGSYTLPQLRSYTKQNFNLSLPHVTKSKLIERIILKMWNCKIVTNGDDGSLQSNSI 251

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
            sterol uptake and anaerobic growth, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 157  SNEAVVINRAVLDWGSLWEKRKLQIDSRLEKKE 189
            + EA+ +N+  +DW +LWE     ++ +L KKE
Sbjct: 1006 AEEALTLNKEAIDWSALWES---SVEKKLVKKE 1035

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,486,594
Number of extensions: 1021071
Number of successful extensions: 2904
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2964
Number of HSP's successfully gapped: 46
Length of query: 774
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 665
Effective length of database: 12,822,747
Effective search space: 8527126755
Effective search space used: 8527126755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)