Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_654.2258058025810.0
YNL144C7402604932e-53
Scas_697.176942574893e-53
Kwal_33.146297192454711e-50
KLLA0E23056g8182444352e-45
YHR131C8402474221e-43
CAGL0G06182g6812353979e-41
AFR049W7172603829e-39
CAGL0J05830g6072392327e-20
KLLA0A08206g2301881073e-05
AAL162C187466683.7
YBR184W52346674.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_654.22
         (580 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_654.22                                                           998   0.0  
YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protei...   194   2e-53
Scas_697.17                                                           192   3e-53
Kwal_33.14629                                                         186   1e-50
KLLA0E23056g complement(2044323..2046779) weakly similar to sp|P...   172   2e-45
YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein...   167   1e-43
CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces c...   157   9e-41
AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH] co...   151   9e-39
CAGL0J05830g complement(552107..553930) some similarities with s...    94   7e-20
KLLA0A08206g 730940..731632 no similarity, hypothetical start          46   3e-05
AAL162C [25] [Homologous to ScYJL005W (CYR1) - SH] (58565..64189...    31   3.7  
YBR184W (YBR184W) [368] chr2 (597320..598891) Protein of unknown...    30   4.1  

>Scas_654.22
          Length = 580

 Score =  998 bits (2581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/580 (85%), Positives = 493/580 (85%)

Query: 1   MYSMFSSFNIGSSTTRLSHKGGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MYSMFSSFNIGSSTTRLSHKGGR                                     
Sbjct: 1   MYSMFSSFNIGSSTTRLSHKGGRTKSKSITSSDASSSIFDNSGISRISSRSSLSLHEHLS 60

Query: 61  XXPPQFKIIHEHKEFQPPKIPEFDDAENEFLIHIDPYPVEPPRYDTMNPSRKISFPIYET 120
             PPQFKIIHEHKEFQPPKIPEFDDAENEFLIHIDPYPVEPPRYDTMNPSRKISFPIYET
Sbjct: 61  SSPPQFKIIHEHKEFQPPKIPEFDDAENEFLIHIDPYPVEPPRYDTMNPSRKISFPIYET 120

Query: 121 YHDTIQQPAPPSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDV 180
           YHDTIQQPAPPSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDV
Sbjct: 121 YHDTIQQPAPPSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDV 180

Query: 181 DALLQSQLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDAN 240
           DALLQSQLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDAN
Sbjct: 181 DALLQSQLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDAN 240

Query: 241 LVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHID 300
           LVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHID
Sbjct: 241 LVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHID 300

Query: 301 MGISVSLDLQIRELPTYRIVPXXXXXXXXXXXXXXXXXXXTGTAASDQIRKIFTLPSDSN 360
           MGISVSLDLQIRELPTYRIVP                   TGTAASDQIRKIFTLPSDSN
Sbjct: 301 MGISVSLDLQIRELPTYRIVPRRRRRRRRSSSRKNKGRKRTGTAASDQIRKIFTLPSDSN 360

Query: 361 AKTDTGGNGFFKSKLQKFFSGNNAATLTKDISKTAQTTDLARDQEQPIRRESVISIGFSD 420
           AKTDTGGNGFFKSKLQKFFSGNNAATLTKDISKTAQTTDLARDQEQPIRRESVISIGFSD
Sbjct: 361 AKTDTGGNGFFKSKLQKFFSGNNAATLTKDISKTAQTTDLARDQEQPIRRESVISIGFSD 420

Query: 421 EGEELIDTNEDEEDLPTTNDSAQSVYQEEGIYPXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
           EGEELIDTNEDEEDLPTTNDSAQSVYQEEGIYP                           
Sbjct: 421 EGEELIDTNEDEEDLPTTNDSAQSVYQEEGIYPDDDDEEEEDEDDGDEDEYYASDIDSDD 480

Query: 481 XXKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKGP 540
             KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKGP
Sbjct: 481 DYKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKGP 540

Query: 541 HASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDAWNELYE 580
           HASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDAWNELYE
Sbjct: 541 HASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDAWNELYE 580

>YNL144C (YNL144C) [4452] chr14 complement(352820..355042) Protein
           of unknown function, has low similarity to
           uncharacterized S. cerevisiae Yhr131p [2223 bp, 740 aa]
          Length = 740

 Score =  194 bits (493), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 109/260 (41%), Positives = 154/260 (59%), Gaps = 28/260 (10%)

Query: 76  QPPKIPEFDDAENEFLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSP 135
           +P    + D A+   L  IDPYPVEPP YD  NPS+ I +PIYE     +    PPSY+P
Sbjct: 74  EPQSGVDVDVADKNVLYCIDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTP 133

Query: 136 AVDEITLVSMKLEWESPMAPIRYAAQR-WKIVLMEVNSTQLNFYDVDALLQSQLK----- 189
           +V+  T+VSMK+E    ++P   A+ R W   ++++NSTQ+NFY +D  L   +K     
Sbjct: 134 SVEHYTVVSMKME---KLSPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGG 190

Query: 190 ---------KTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDAN 240
                    KT   R +S    +N    +  T+Q + K D E+IC  I R++ K+L D  
Sbjct: 191 DMFDHSHHSKTASDRHHSARSLLNAFTTKS-TYQ-FDKYDKERICGEIARDEHKFLSDER 248

Query: 241 LVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHID 300
           L KSYSLQ  +VG P D SS++          LR+RCE QQFL+QF+ +D LI  A++++
Sbjct: 249 LFKSYSLQCAKVGLPIDYSSRD--------FVLRMRCEGQQFLVQFSHVDELIYWAMYLN 300

Query: 301 MGISVSLDLQIRELPTYRIV 320
           MGIS+SLDL++RE+PTYR V
Sbjct: 301 MGISLSLDLELREMPTYRSV 320

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 69/99 (69%), Gaps = 4/99 (4%)

Query: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKGPHA 542
           KW+P ++  SR+RY++DSLRCIK +TE+H WVGK++F P   P+FETNN P+ +  G  +
Sbjct: 640 KWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAFETNNPPIRVYSGEDS 699

Query: 543 STVYDTTKNHYLKAHVVGAWRLIKAGSKI---YDAWNEL 578
           + +    KNHYLK ++VG+   +K GSK+   YD  N+L
Sbjct: 700 TDLMH-VKNHYLKPYIVGSCGFLKTGSKLFHFYDRTNDL 737

>Scas_697.17
          Length = 694

 Score =  192 bits (489), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 149/257 (57%), Gaps = 25/257 (9%)

Query: 69  IHEHKEFQPPKIPEFDDAENEFLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQP 128
           I  H     P I    D  NEFL  ID  PV PP Y+ MNP+++I+FPI+E         
Sbjct: 67  IATHTSPLKPHINLLRDDPNEFLQCIDHKPVSPPNYNEMNPNKRINFPIWEHTAPCPINE 126

Query: 129 APPSYSPAVDEITLVSMKLEWESP--MAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQS 186
            PPSY PAV+E+T+VSMKLEW SP  ++P+R     WK ++ME+NSTQLNFY +D  L S
Sbjct: 127 LPPSYKPAVEELTIVSMKLEWLSPYDVSPLR----TWKNLIMEINSTQLNFYHIDESLTS 182

Query: 187 QLKK------TIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDAN 240
            ++       +  P K  + F   N      T   + K+D E+I   I+RNK  YL +  
Sbjct: 183 HIRNYSNDSSSSSPSKQRSTFSFGNR-----TTYEFNKNDQEQIAFRIKRNKKLYLSNDK 237

Query: 241 LVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHID 300
           L KSYSLQF + G P D   K           LRLRCE++QFLL F  +D +IM  ++++
Sbjct: 238 LYKSYSLQFAKFGLPIDYKKKT--------YVLRLRCESEQFLLNFAHVDDMIMWTMYLN 289

Query: 301 MGISVSLDLQIRELPTY 317
           MGISV+LDL++R LP Y
Sbjct: 290 MGISVALDLELRALPDY 306

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 56/108 (51%), Gaps = 13/108 (12%)

Query: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLF------- 535
           KW+P  K T RR+Y+R+SLRCI    E   W+  +V  PT  P F+TNN P+        
Sbjct: 580 KWTPPLKITPRRKYIRNSLRCIVPFIEETNWIDNIVVKPTAGPKFKTNNSPIAGSLDSTC 639

Query: 536 ------IGKGPHASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDAWNE 577
                 +  G  + +  +  KNHYLKA+VVG  +  +A  +    WNE
Sbjct: 640 TSYRKKLLAGCTSGSDLNRVKNHYLKAYVVGPAKFKRANPETLCNWNE 687

>Kwal_33.14629
          Length = 719

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 144/245 (58%), Gaps = 37/245 (15%)

Query: 94  IDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLEWESP- 152
           IDP P +PP Y + +PSR+++FP+YET  D     + P YSPAV+ IT+VSMKLEW  P 
Sbjct: 78  IDPLPAKPPSYKSSDPSRRVTFPVYETLDDG----SLPGYSPAVEAITVVSMKLEWLDPY 133

Query: 153 -MAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQSQLKKTIGPRKN-------------- 197
             +P R     WK  +ME+NSTQLNFY +D  L   +K     + +              
Sbjct: 134 TCSPSR----SWKNFVMEINSTQLNFYLIDPALTRGIKNYCNGKSHFGGEHLDPSLEYES 189

Query: 198 -STLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPT 256
             ++F   +++N   T+Q + K+D E I + I  NKSKYL D  L +SYSLQF + G PT
Sbjct: 190 HHSIFSSLSSKN---TYQ-FNKADQECISKKISNNKSKYLTDNKLFRSYSLQFAKYGIPT 245

Query: 257 DLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPT 316
           D + K           LR+RCE +QF+L F+ +D +IM  +++ +GI VSLDL  RELPT
Sbjct: 246 DYNRKT--------FVLRVRCETEQFMLSFSHVDDMIMWNMYLSIGIGVSLDLDFRELPT 297

Query: 317 YRIVP 321
           YR VP
Sbjct: 298 YRTVP 302

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 73/161 (45%), Gaps = 25/161 (15%)

Query: 436 PTTNDSAQSVYQEEGI--------YPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWSPT 487
           P +   A S+YQEEGI        Y                              KW P 
Sbjct: 559 PNSTTQATSIYQEEGIFHDSEDDYYYVVDRNDAFRRRASSVTSNLSSTPYGSGDVKWHPP 618

Query: 488 SKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPL--FIG-------- 537
            K+ SRRRY+RDSLRCIK + +N +W+GKV+  P  AP ++TNN P+  F+G        
Sbjct: 619 RKEMSRRRYIRDSLRCIKPLPDNEEWLGKVLIRPVSAPDYDTNNPPISGFVGGTGKSGKS 678

Query: 538 -KGPHASTVYD------TTKNHYLKAHVVGAWRLIKAGSKI 571
              P+ S+  D        KNHY K ++VG   L+K  ++ 
Sbjct: 679 KASPNKSSKSDKGVILQKCKNHYAKPYIVGPVGLLKTNARC 719

>KLLA0E23056g complement(2044323..2046779) weakly similar to
           sp|P38835 Saccharomyces cerevisiae YHR131c, start by
           similarity
          Length = 818

 Score =  172 bits (435), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 141/244 (57%), Gaps = 29/244 (11%)

Query: 89  EFLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLE 148
           E+   +D  P  PP Y ++N +R+I++PIYET  D +     P YSPAV  IT++S+K E
Sbjct: 124 EYFQWVDNAPRRPPSYKSVNSNRRITYPIYETLDDNVL----PGYSPAVKAITVISLKQE 179

Query: 149 WESPMAPIRYAAQR-WKIVLMEVNSTQLNFYDVDALLQSQLKKTIG----------PRKN 197
           W   + P   ++ R WK  +ME+NSTQLNFY +   L S +K   G            K 
Sbjct: 180 W---LNPYELSSSRAWKNFIMEINSTQLNFYHIHESLTSNIKNYYGGPTNFPNDLNSSKQ 236

Query: 198 STLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPTD 257
           ST F  +   +   T+Q + +SD + I ++I+ N+ KYL +  L KS+SLQ+G+ G PTD
Sbjct: 237 STRFLPS--LHSKSTYQ-FNRSDQQWITKMIQSNEKKYLSNDMLFKSFSLQYGKFGIPTD 293

Query: 258 LSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPTY 317
            + K           LRLRCE QQFL+ F  +D +I  +V + +GI VSLDL  RE+PTY
Sbjct: 294 YTKKT--------FVLRLRCELQQFLINFAHVDDMIDWSVSLSIGIDVSLDLAYREMPTY 345

Query: 318 RIVP 321
           R VP
Sbjct: 346 RTVP 349

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 72/166 (43%), Gaps = 25/166 (15%)

Query: 427 DTNEDEEDLPT--TNDSAQSVYQEEGIYPXXXX------XXXXXXXXXXXXXXXXXXXXX 478
           +T     +LPT     +A S+Y EEGI+                                
Sbjct: 649 ETAASSNELPTRHARSAASSIYHEEGIFHDSDDDYIYVPTEIHRRRTSSITSNLSNTPYG 708

Query: 479 XXXXKWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPL--FI 536
               KW+P  K+ +RRRY+RDSLRCIK +  +  WV K+   P+  P +ETNN P+  FI
Sbjct: 709 GDEMKWNPPRKEITRRRYIRDSLRCIKPLGFDESWVNKIALAPSMGPKYETNNPPVSGFI 768

Query: 537 GKGPHAS-------TVYDT--------TKNHYLKAHVVGAWRLIKA 567
                +S        +Y+T         KNHYL  +++    L++A
Sbjct: 769 SNSDLSSKNKFSLKKLYNTQPALLLSRCKNHYLTPYIITPSGLVRA 814

>YHR131C (YHR131C) [2417] chr8 complement(365342..367864) Protein
           containing a pleckstrin homology (PH) domain, which
           mediate protein-protein and protein-lipid interactions,
           has low similarity to uncharacterized S. cerevisiae
           Ynl144p [2523 bp, 840 aa]
          Length = 840

 Score =  167 bits (422), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 149/247 (60%), Gaps = 29/247 (11%)

Query: 93  HIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLEWESP 152
           HIDP P  PP YD +NP++++ FPI+       +   PP Y+PAV E+TL+S+KLE    
Sbjct: 76  HIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKSSLPPLYAPAVYELTLISLKLER--- 132

Query: 153 MAPIRYAAQR-WKIVLMEVNSTQLNFYDVDALLQSQLKK-TIGPRKNS------TLFGMN 204
           ++P   ++ R W+  ++E+NSTQLNFY +D  L   ++  + G  K+       +     
Sbjct: 133 LSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIRNYSSGETKSEKEDRIHSDLVHR 192

Query: 205 NNRNEDITFQSYT----------KSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGF 254
           +++++ +  + +T          K+D E+I   ++R++S+YL D  L KS++LQ  R G 
Sbjct: 193 SDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDRSRYLTDEALYKSFTLQNARFGI 252

Query: 255 PTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIREL 314
           PTD + K+          LR+ CE++QFLL+F+ +D +I  ++++ +GISVSLDL++RE 
Sbjct: 253 PTDYTKKS--------FVLRMSCESEQFLLRFSHIDDMIDWSMYLSIGISVSLDLEVREY 304

Query: 315 PTYRIVP 321
           P YRIVP
Sbjct: 305 PDYRIVP 311

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKGPHA 542
           KW P  K+ SRRRY+RDSL+CIK   +++  +GKV++ P   P+FET+N   F  +    
Sbjct: 693 KWKPAIKEISRRRYLRDSLKCIKPFLDSNDCLGKVIYIPVSGPTFETSNKIHFSNR---- 748

Query: 543 STVYDTTKNHYLKAHVVGAWRLIKAGSKIYDA 574
                  KNH+LK  +VG   LI+   K  +A
Sbjct: 749 -QSLQKQKNHFLKGFIVGPTALIELNCKNKNA 779

>CAGL0G06182g 589050..591095 similar to sp|P38835 Saccharomyces
           cerevisiae YHR131c, start by similarity
          Length = 681

 Score =  157 bits (397), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 132/235 (56%), Gaps = 17/235 (7%)

Query: 90  FLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSPAVDEITLVSMKLEW 149
           +L  ID  P  PP YD +N +R ++FPI+E          PP+Y P V  + +VS+KLEW
Sbjct: 51  YLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVAIVSVKLEW 110

Query: 150 ESPMAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQSQLKKTIGPRKN-------STLFG 202
            SP  P     + W+  +ME+NSTQ+NFY ++      +K     + +         +  
Sbjct: 111 LSPFEP--SPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAKSLAKGILS 168

Query: 203 MNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPTDLSSKN 262
           + N++ ++      T+   +++   + RN SKYL DA L +S++LQ+ R+G PTD     
Sbjct: 169 LGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARMGIPTDYRKSA 228

Query: 263 KGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPTY 317
                    ALRLRCEA+QFL+ F ++D LI  +++I+MGISV+LDL  R+LP Y
Sbjct: 229 H--------ALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNY 275

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (56%), Gaps = 16/93 (17%)

Query: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNN-LPLFIGKGPH 541
           KW P  K  SRRRYV+DSLRCIK   E+  W+G+VV CPT  PSF+TNN L L  GK   
Sbjct: 564 KWMPPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGKKID 623

Query: 542 ASTV---------------YDTTKNHYLKAHVV 559
             TV               Y  TKNH+L+ +++
Sbjct: 624 EKTVGNSRNKIVNSSGDKSYWKTKNHFLQLYII 656

>AFR049W [3241] [Homologous to ScYNL144C - SH; ScYHR131C - SH]
           complement(517312..519465) [2154 bp, 717 aa]
          Length = 717

 Score =  151 bits (382), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 134/260 (51%), Gaps = 40/260 (15%)

Query: 78  PKIPEFDDAE--NEFLIHIDPYPVEPPRYDTMNPSRKISFPIYETYHDTIQQPAPPSYSP 135
           P+  E +  E   + L  + P P  PP Y  +NP+R+I +PIYE   +T + PA   Y+P
Sbjct: 49  PQSGEVESGELHADVLAVLQPQPARPPPYYAVNPNRRIRYPIYER-EETNELPA---YAP 104

Query: 136 AVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDVD-------------- 181
           AV E+ LVS+K EW SP  P    ++ W+ +LME+NSTQLNFY VD              
Sbjct: 105 AVHELALVSVKQEWASPYEPA--VSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAADS 162

Query: 182 ----ALLQSQLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRRNKSKYLH 237
               A  Q+    + G  K  TL  +  +  +       + +  + +C   +R+  ++L 
Sbjct: 163 TLGVACAQAVSSLSFGQVKAGTLLALGRDERQ------LSPAHQQHVCARAQRDPERHLC 216

Query: 238 DANLVKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAV 297
              L KSYSLQ+   G P D + ++          LRLRCE +QFL+ F  +D LI  +V
Sbjct: 217 AERLYKSYSLQYATFGVPMDYTKRS--------FVLRLRCETEQFLVCFGTVDMLISWSV 268

Query: 298 HIDMGISVSLDLQIRELPTY 317
            + +GI VSLDL  R++P Y
Sbjct: 269 SLSVGIGVSLDLDHRKMPAY 288

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 11/103 (10%)

Query: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVFCPTKAPSFETNNLPLFIGKGPH- 541
           KW P  K+++RRR+VRDS+RCI+ + ++  W+G +V  P+  P   ++  P  +G G   
Sbjct: 615 KWVPPVKESTRRRFVRDSIRCIRPLCDDDTWLGALVVSPSAGPGSSSSGFPFDLGLGSKR 674

Query: 542 ----------ASTVYDTTKNHYLKAHVVGAWRLIKAGSKIYDA 574
                     + ++  T    ++KA++VG   L+ + +  ++A
Sbjct: 675 LGSRRSLKRGSQSLSGTRAARFMKAYIVGPVGLVASVNDEFNA 717

>CAGL0J05830g complement(552107..553930) some similarities with
           sp|P53907 Saccharomyces cerevisiae YNL144c or sp|P38835
           Saccharomyces cerevisiae YHR131c, hypothetical start
          Length = 607

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 107/239 (44%), Gaps = 50/239 (20%)

Query: 131 PSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFY---------DVD 181
           P YSPAV++      KLEWESP    R     W  V++ +NSTQLN Y            
Sbjct: 41  PGYSPAVEKFVRAKFKLEWESPTQVSRDPC--WYDVVLHINSTQLNLYLPRCPKSRPASK 98

Query: 182 ALLQSQLKKTI-GPRKNSTLFGMNNNRN----EDITFQ--------SYTKSDNEKI-CQL 227
           +L     K ++ G R+ S  F           E + F         SY     + +  + 
Sbjct: 99  SLSYVSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARK 158

Query: 228 IRRNKSKYLHDANL-------------------VKSYSLQFGRVGFPTDLSSKN------ 262
            R N+  +++D N                     KSYSLQ  +VG PT  S K       
Sbjct: 159 KRSNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEE 218

Query: 263 KGKRTSDPIALRLRCEAQQFLLQFTDMDSLIMSAVHIDMGISVSLDLQIRELPTYRIVP 321
              + +  + LRLR E QQFL+QF  +D +IM ++++ MGI+VS DL  RE P YRIVP
Sbjct: 219 NVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVP 277

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (72%)

Query: 483 KWSPTSKQTSRRRYVRDSLRCIKSMTENHKWVGKVVF 519
           KW+P  K+ +R+RY+R SLRCI+ +  + KW G+ ++
Sbjct: 538 KWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIY 574

>KLLA0A08206g 730940..731632 no similarity, hypothetical start
          Length = 230

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 60/188 (31%)

Query: 127 QPAPPSYSPAVDEITLVSMKLEWESPMAPIRYAAQRWKIVLMEVNSTQLNFYDVDALLQS 186
           +P PP Y+P++    L+  + E           + RW    +E+NSTQL           
Sbjct: 37  EPLPP-YTPSLQISFLLQTQFE----------HSHRWTPHCVEINSTQL----------- 74

Query: 187 QLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKIC--QLIRRN------------- 231
            L + +    +  L     ++ +++ ++ Y  + N ++C  QL++               
Sbjct: 75  -LIRPLIHSHDEKLINKWYSKLDELEYKQYKATSNHQLCHDQLVQSTQVPNQRDHIVLCT 133

Query: 232 -KSKYLH-DANL---------VKSYSLQFGRVGFPTDLSSKNKGKRTSDPIALRLRCEAQ 280
            K  YL  D +L         +K YSLQ  R+G  TD+S             LR+RCE +
Sbjct: 134 AKGLYLEKDKSLNLIQWNRDPIKKYSLQDCRIGLNTDMSR-----------CLRIRCERE 182

Query: 281 QFLLQFTD 288
           QFLL+  D
Sbjct: 183 QFLLRVPD 190

>AAL162C [25] [Homologous to ScYJL005W (CYR1) - SH] (58565..64189)
            [5625 bp, 1874 aa]
          Length = 1874

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 222  EKICQLIRRNKSKYLHDANLVKSYSLQFGRVGFPTDLS---SKNKGKR------TSDPIA 272
            EKIC + R NKS+ +  A  +K Y++ +G     T L    +KN GK+       SD + 
Sbjct: 1429 EKICDIARENKSQPMLAAERMKDYAIAYGCTDNITILCVSFNKNVGKQKQFSLNKSDLLG 1488

Query: 273  LRLRCE 278
             RL  E
Sbjct: 1489 RRLNFE 1494

>YBR184W (YBR184W) [368] chr2 (597320..598891) Protein of unknown
           function [1572 bp, 523 aa]
          Length = 523

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%)

Query: 185 QSQLKKTIGPRKNSTLFGMNNNRNEDITFQSYTKSDNEKICQLIRR 230
           +++ ++   P + +  F  N N+N DI  Q++++  NE IC LI +
Sbjct: 132 KNKTRRQSAPLQKTKYFPTNENQNTDIENQNWSQIPNEDICALIEK 177

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,417,541
Number of extensions: 746112
Number of successful extensions: 2619
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2653
Number of HSP's successfully gapped: 37
Length of query: 580
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 473
Effective length of database: 12,891,983
Effective search space: 6097907959
Effective search space used: 6097907959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)