Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_654.19*2022027002e-94
Kwal_33.146072611171173e-07
Sklu_1881.32542071032e-05
AFR043W271128880.002
YHR133C29127870.003
KLLA0F27885g256119830.007
CAGL0J05918g32363710.26
YNL156C29917710.29
Scas_697.14*29429642.3
Scas_671.32146845633.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_654.19*
         (202 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_654.19*                                                          274   2e-94
Kwal_33.14607                                                          50   3e-07
Sklu_1881.3 YNL156C, Contig c1881 3706-4470                            44   2e-05
AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH] co...    39   0.002
YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein...    38   0.003
KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces...    37   0.007
CAGL0J05918g complement(558615..559586) similar to sp|P53898 Sac...    32   0.26 
YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protei...    32   0.29 
Scas_697.14*                                                           29   2.3  
Scas_671.32                                                            29   3.7  

>Scas_654.19*
          Length = 202

 Score =  274 bits (700), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 145/202 (71%), Positives = 145/202 (71%)

Query: 1   MELRRSSSTSSDLEAYVYFDQFRAFQVLTRPTLFSIYDDDIIRSSGDVDSRIGGIRKXXX 60
           MELRRSSSTSSDLEAYVYFDQFRAFQVLTRPTLFSIYDDDIIRSSGDVDSRIGGIRK   
Sbjct: 1   MELRRSSSTSSDLEAYVYFDQFRAFQVLTRPTLFSIYDDDIIRSSGDVDSRIGGIRKRVL 60

Query: 61  XXXXXXXXXXXQGTARKLFNLIVLSLFGIAYNELAFYLYQSTIINKMSPLRFMMFYGLPR 120
                      QGTARKLFNLIVLSLFGIAYNELAFYLYQSTIINKMSPLRFMMFYGLPR
Sbjct: 61  RGKRRWKYRRRQGTARKLFNLIVLSLFGIAYNELAFYLYQSTIINKMSPLRFMMFYGLPR 120

Query: 121 WMNYSLEGVSXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXFDYGWGFMLAXXXXXXX 180
           WMNYSLEGVS             KK                  FDYGWGFMLA       
Sbjct: 121 WMNYSLEGVSLGFLVPLLDVLLFKKTVTVEYPETETEIGIGTEFDYGWGFMLAIINIIMG 180

Query: 181 XXXXXRKLEWDSAMQSAEACIY 202
                RKLEWDSAMQSAEACIY
Sbjct: 181 IIYGIRKLEWDSAMQSAEACIY 202

>Kwal_33.14607
          Length = 261

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 50/117 (42%), Gaps = 15/117 (12%)

Query: 28  LTRPTLFSIYDDDIIRSSG-----DVDSRIGGIRKXXXXXXXXXXXXXXQGTARKLFNLI 82
           LTRP L+ IYD DI  S            +G                  Q     LF+L 
Sbjct: 23  LTRPQLYGIYDADITHSEDAEAYEQAKKSVGKFPDEVLNKSKHRHRSWFQKGTHLLFSLC 82

Query: 83  VLSLFGIAYNELAFYLYQSTIIN---KMSPL-------RFMMFYGLPRWMNYSLEGV 129
           VL + GI+YNEL+  L+ +  ++      PL       R + F  +P WM Y+LEGV
Sbjct: 83  VLGVAGISYNELSKQLHDNHELHAEFASRPLALGVEICRTLSFGVVPGWMAYALEGV 139

>Sklu_1881.3 YNL156C, Contig c1881 3706-4470
          Length = 254

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 76/207 (36%), Gaps = 33/207 (15%)

Query: 4   RRSSSTSSDLEAYVYFDQFRAFQVLTRPTLFSIYDDDIIRSS-GDVDSRIGGIRKXXXXX 62
           R+ S   ++L      +   +   LT+P LF +YD++I++S   ++              
Sbjct: 3   RKKSKAGNELS-----NSNESITTLTKPQLFGLYDEEIVKSEDNEIYEEAKKSAGKLTPA 57

Query: 63  XXXXXXXXXQGTARKLFNLIVLSLFGIAYNELAFYLYQSTIINK---MSPLRF------- 112
                    Q     LF+ +VL + GIAY+EL+  L+ +  ++      PL         
Sbjct: 58  GVMERRSIFQKVVHLLFSWLVLGVAGIAYHELSRNLHDNHALHPELASKPLLLGVQLSQK 117

Query: 113 MMFYGLPRWMNYSLEGVSXXXXXXXXXXXXXKKXXXXXXXXXXXXXXXXXXFDYGWGFML 172
           + F  +P W  YSLEG+              KK                   ++G     
Sbjct: 118 LSFGMVPTWAAYSLEGILFGSLLPLVDHLRGKKTASTSSSSVMRAINAMLGVEFG----- 172

Query: 173 AXXXXXXXXXXXXRKLEWDSAMQSAEA 199
                        RK+EW S++Q++ A
Sbjct: 173 ------------IRKIEWSSSLQASGA 187

>AFR043W [3235] [Homologous to ScYNL156C - SH; ScYHR133C - SH]
           complement(511018..511833) [816 bp, 271 aa]
          Length = 271

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 28/128 (21%)

Query: 24  AFQVLTRPTLFSIYDDDII------------RSSGDVDSRIGGIRKXXXXXXXXXXXXXX 71
           +  +LT+P LF IYD++I+            +S+G +   +G +                
Sbjct: 30  SMSMLTKPQLFGIYDEEIVESEDTEIYEEAKKSAGRMLDDMGSV------GARSRVRTRS 83

Query: 72  QGTARKLFNLIVLSLFGIAYNELAFYLYQSTIINK---MSPLRF-------MMFYGLPRW 121
           Q     + +L++L + GIAY++L+  L+ + ++++     PL         + F  LP W
Sbjct: 84  QKYMHLVSSLVILGISGIAYHQLSRNLHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPTW 143

Query: 122 MNYSLEGV 129
             Y++EG+
Sbjct: 144 AGYAVEGI 151

>YHR133C (YHR133C) [2420] chr8 complement(370723..371598) Protein
          that contains four potential transmembrane segments
          [876 bp, 291 aa]
          Length = 291

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 22 FRAFQVLTRPTLFSIYDDDIIRSSGDV 48
          F A   LT+P LFS YDDDI ++ G+V
Sbjct: 40 FTAINTLTKPALFSFYDDDITKNEGNV 66

>KLLA0F27885g 2580668..2581438 similar to sp|P53898 Saccharomyces
           cerevisiae YNL156c, start by similarity
          Length = 256

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 18/119 (15%)

Query: 26  QVLTRPTLFSIYDDDIIRSSGDVDSRI-GGIRKXXXXXXXXXXXXXXQGTARKLFNL--- 81
            +LT+P L+ +YD D+++S    DS I   ++K                      N+   
Sbjct: 20  NLLTKPALYGLYDADVLKSE---DSEIYEEVKKASSGKELENGIVQRAKKIPSSVNVALA 76

Query: 82  -IVLSLFGIAYNELAFYLYQSTIINK---MSPL-------RFMMFYGLPRWMNYSLEGV 129
            +VLS+ GIAY+EL+  L+ +  ++      PL       + + F  LP W  Y++EG+
Sbjct: 77  WVVLSIAGIAYHELSKNLHDNHELHNDFTSRPLLLGATIAQSLSFGYLPPWTFYAIEGI 135

>CAGL0J05918g complement(558615..559586) similar to sp|P53898
           Saccharomyces cerevisiae YNL156c or sp|P38837
           Saccharomyces cerevisiae YHR133c, hypothetical start
          Length = 323

 Score = 32.0 bits (71), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 12/63 (19%)

Query: 78  LFNLIVLSLFGIAYNELAFYLYQSTIINKMSPLRFMMFYG-----------LPRWMNYSL 126
           +F ++VLS+ G+AY++L+  L+ + ++++    R ++ +G           LP W  Y+L
Sbjct: 140 VFAIVVLSISGVAYHQLSRNLHDNHLLHEDFASRPLL-WGVTIQQKLSCGILPDWFGYAL 198

Query: 127 EGV 129
           EG+
Sbjct: 199 EGI 201

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query: 28 LTRPTLFSIYDDDIIRS 44
          LT P L+SIYD DI++S
Sbjct: 22 LTTPQLYSIYDQDIVKS 38

>YNL156C (YNL156C) [4441] chr14 complement(341069..341968) Protein
          of unknown function, has moderate similarity to
          uncharacterized S. cerevisiae Yhr133p [900 bp, 299 aa]
          Length = 299

 Score = 32.0 bits (71), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 16/17 (94%)

Query: 28 LTRPTLFSIYDDDIIRS 44
          LT+P L+S+YDDD++RS
Sbjct: 19 LTKPQLYSLYDDDVVRS 35

>Scas_697.14*
          Length = 294

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 21/29 (72%)

Query: 24 AFQVLTRPTLFSIYDDDIIRSSGDVDSRI 52
          +   LT+P L+S+Y +D+++S+ D  S++
Sbjct: 29 SISTLTKPALYSLYSNDVLKSNEDKTSQL 57

>Scas_671.32
          Length = 1468

 Score = 28.9 bits (63), Expect = 3.7,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 6   SSSTSSDLEAYVYFDQFRAF-QVLTRPTLFSIYDDDIIRSSGDVD 49
           ++S    +E +  FD   AF  VL  PT ++I   D+I +S +VD
Sbjct: 258 NNSNEEKVEYHESFDMIPAFGSVLRYPTFYTIILPDLIENSKNVD 302

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.139    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,083,167
Number of extensions: 112510
Number of successful extensions: 323
Number of sequences better than 10.0: 10
Number of HSP's gapped: 313
Number of HSP's successfully gapped: 12
Length of query: 202
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 105
Effective length of database: 13,238,163
Effective search space: 1390007115
Effective search space used: 1390007115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)