Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_654.1752352324570.0
YNL154C (YCK2)54639917950.0
CAGL0G06138g53939517570.0
YHR135C (YCK1)53838517160.0
KLLA0D11044g53637516850.0
AFR040W54733516840.0
Kwal_33.1459650033216740.0
Scas_697.1252937916460.0
CAGL0J05940g48632716220.0
Scas_627.447533711761e-157
YER123W (YCK3)52435811631e-155
ADL053C47134511541e-154
Kwal_47.1731442134211371e-152
KLLA0E13563g47334711421e-152
Sklu_2359.348836611411e-152
CAGL0K02299g53836211251e-149
KLLA0D03168g5052938381e-106
Kwal_56.240644752978321e-106
AFL091W4782938321e-106
CAGL0H03553g4952938271e-105
Scas_720.244732938221e-104
Sklu_1892.34742938221e-104
YPL204W (HRR25)4942938161e-103
Scas_690.124882896874e-84
KLLA0C08525g15512371828e-14
AAR009W4532131655e-12
Scas_618.84272191645e-12
AER264C14832321659e-12
YDR490C (PKH1)7662721641e-11
Kwal_56.240593532331611e-11
Kwal_23.632515422321641e-11
YPL203W (TPK2)3802331583e-11
Scas_660.209572311595e-11
AFR335C10332501578e-11
AFL090W3462291531e-10
Sklu_2437.1610712661561e-10
KLLA0E03487g6472301551e-10
Kwal_33.138463752281531e-10
Sklu_2436.147842431542e-10
Kwal_26.735514462271552e-10
KLLA0D03190g3722281493e-10
Kwal_56.226939843061505e-10
Kwal_0.964272151486e-10
CAGL0L03520g14472291499e-10
Sklu_2429.54322151479e-10
Sklu_2430.57333001461e-09
CAGL0K03399g7032301462e-09
CAGL0K12562g16822551462e-09
CAGL0I07513g10763001462e-09
KLLA0B02332g3612121432e-09
YJL164C (TPK1)3972341432e-09
YPL153C (RAD53)8212751452e-09
AEL284C4792511442e-09
CAGL0M08404g4622281433e-09
CAGL0G09020g3612291413e-09
Scas_502.211162651443e-09
YJL095W (BCK1)14782761443e-09
AFL101C3672131413e-09
YOL100W (PKH2)10812701434e-09
KLLA0B12716g7162781424e-09
YKL166C (TPK3)3982441414e-09
Kwal_26.76356912291425e-09
AFR377C7262301425e-09
YCR073C (SSK22)13312371426e-09
KLLA0F13552g12672311426e-09
YGL158W (RCK1)5122501407e-09
ABL028W7222341407e-09
KLLA0C12485g9252331408e-09
YFR014C (CMK1)4461781398e-09
YDR466W (PKH3)8982481409e-09
Scas_690.133542331379e-09
Kwal_47.183076211231372e-08
YHR102W (KIC1)10802211382e-08
KLLA0F16467g3401581352e-08
CAGL0G04609g9652391372e-08
Scas_689.25*4092141343e-08
CAGL0F04741g4421661343e-08
YDR477W (SNF1)6331781353e-08
CAGL0K08514g14892651354e-08
CAGL0K06479g9912491344e-08
YFL033C (RIM15)17702231345e-08
CAGL0M08910g6121781335e-08
Kwal_26.778812672171336e-08
ABL034W14252401336e-08
Scas_720.9416832531336e-08
CAGL0L11550g10722371327e-08
Scas_711.2515152211337e-08
YOR233W (KIN4)8002201319e-08
Scas_717.696742911319e-08
CAGL0B04301g5421391319e-08
KLLA0F14190g13382221329e-08
YDL214C (PRR2)6992841311e-07
CAGL0K07458g7041411311e-07
Kwal_14.12734152731291e-07
YNL161W (CBK1)7561511311e-07
ACR218W15692001311e-07
Scas_721.1246842351301e-07
Scas_660.286231601301e-07
KLLA0B07205g4552281291e-07
Scas_673.20*7582201301e-07
Sklu_2392.68081551301e-07
YHR205W (SCH9)8241351301e-07
Kwal_55.215458652211292e-07
YBR028C5251471282e-07
AFR035W7191511292e-07
Scas_651.183712281272e-07
CAGL0J06072g7731491292e-07
KLLA0F09020g9281851292e-07
YOL016C (CMK2)4472161272e-07
KLLA0F24618g5561351272e-07
Sklu_2232.23741591263e-07
Kwal_33.145547141551273e-07
YGR052W3692221263e-07
YKL101W (HSL1)15182721283e-07
Kwal_14.115915211541283e-07
Scas_703.57492361273e-07
YKL126W (YPK1)6802371273e-07
Kwal_47.182335981591263e-07
Scas_707.315981991274e-07
KLLA0F23155g4272141244e-07
ADL389W7112361255e-07
Scas_613.55172321255e-07
YPL141C8653081255e-07
AFR092W14232221255e-07
Kwal_47.167617441241256e-07
AEL230W6081591246e-07
Scas_654.127371511246e-07
CAGL0F09075g7461241246e-07
ADR204W3391581236e-07
CAGL0G02035g3391581227e-07
AFR205C4573101237e-07
CAGL0E05720g3582581228e-07
KLLA0D07810g7181501238e-07
Scas_580.610152211238e-07
YMR104C (YPK2)6771231239e-07
CAGL0K10604g4462161211e-06
AEL115C3861071201e-06
YOR061W (CKA2)3391591201e-06
ADL315C4342661201e-06
AEL083W5362001202e-06
YBR274W (CHK1)5271091202e-06
KLLA0A03806g6021591212e-06
KLLA0B03586g7341241212e-06
YKL171W9281881212e-06
KLLA0D08415g7741391202e-06
Kwal_26.87967962151202e-06
CAGL0L07326g5062381183e-06
CAGL0I09504g5282361183e-06
YNR031C (SSK2)15792531193e-06
YPL209C (IPL1)3671451164e-06
CAGL0M08316g9642451184e-06
ADR058C2952051154e-06
Kwal_33.144347591381174e-06
KLLA0E21780g10162211184e-06
ACL191C3651591164e-06
CAGL0C05005g10762171175e-06
ACR133C8512231175e-06
Scas_616.1014612641175e-06
CAGL0J03872g6612281166e-06
AFL188C4722391166e-06
Kwal_56.240913811171147e-06
Kwal_26.87098292271158e-06
Scas_700.546982451141e-05
Sklu_2104.12992071111e-05
Kwal_23.64588681211131e-05
KLLA0F01507g4721201122e-05
Kwal_27.119192092111082e-05
ABL011C7012551122e-05
ACL104C9472171122e-05
CAGL0F00649g5141801112e-05
CAGL0K04301g3552371102e-05
KLLA0E01584g4152431102e-05
Scas_648.173401551093e-05
CAGL0M02233g7672341113e-05
ADR379C4921261103e-05
ADL283W3061671083e-05
ABR014W9711301113e-05
ACR142W8372641103e-05
Scas_593.14d4951541103e-05
CAGL0M10153g8671421103e-05
Kwal_33.139846491841103e-05
KLLA0F11143g8132561104e-05
YHL007C (STE20)9392071094e-05
Scas_720.1038041291094e-05
Scas_655.28001381095e-05
YOR351C (MEK1)4972001085e-05
YNL183C (NPR1)7901381085e-05
Kwal_23.35904992401085e-05
Kwal_26.78619551301085e-05
YJL141C (YAK1)8071841085e-05
KLLA0C17160g8312651085e-05
Scas_700.348642311085e-05
AEL120W7732001086e-05
CAGL0K02167g11623291086e-05
Sklu_2361.38842441086e-05
Scas_721.462962061066e-05
KLLA0B13607g9892141086e-05
Kwal_56.227885151921076e-05
KLLA0E06413g11611221086e-05
Scas_689.229011661087e-05
Scas_715.3411502181087e-05
CAGL0H07535g2982071057e-05
CAGL0M02299g8932271077e-05
CAGL0C03509g8951231078e-05
YGL179C (TOS3)5602411068e-05
YCR091W (KIN82)7201201078e-05
YDL159W (STE7)5151191068e-05
KLLA0C18568g7741211078e-05
AEL205W7931141078e-05
AFR076W8201961078e-05
Kwal_55.217093401631058e-05
KLLA0E14828g3101891059e-05
Kwal_23.52908191141069e-05
Scas_640.14*7282571069e-05
Scas_675.25272171069e-05
KLLA0F02838g755811069e-05
Scas_201.1*2741271049e-05
Sklu_2211.511751221069e-05
Scas_629.169181231061e-04
Kwal_27.1058111541221061e-04
CAGL0K02673g9151371061e-04
Scas_705.235531831051e-04
Scas_668.228931301061e-04
KLLA0B09790g2952051041e-04
YPR111W (DBF20)5642091051e-04
CAGL0I03498g451961051e-04
ACR249C6431861051e-04
Kwal_26.87518482291051e-04
KLLA0D10527g6453041051e-04
Scas_627.73491101041e-04
KLLA0A06776g8002121051e-04
CAGL0B01925g9441351051e-04
YBL105C (PKC1)11512731051e-04
YMR139W (RIM11)3701771031e-04
CAGL0F03245g10362501051e-04
YOR231W (MKK1)5081301041e-04
ABL143C7252231051e-04
CAGL0I05896g7781841041e-04
Kwal_14.24974181231041e-04
YNL298W (CLA4)8421141042e-04
Kwal_14.1249344551032e-04
Scas_667.184371701032e-04
Sklu_1843.34861251032e-04
YNR047W8931231032e-04
YDL101C (DUN1)5132381032e-04
Scas_716.335732301032e-04
Scas_649.306481711032e-04
YPL140C (MKK2)5061251022e-04
Scas_713.216411381032e-04
CAGL0B04147g5661831022e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_654.17
         (523 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_654.17                                                           951   0.0  
YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein ki...   696   0.0  
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...   681   0.0  
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...   665   0.0  
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...   653   0.0  
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...   653   0.0  
Kwal_33.14596                                                         649   0.0  
Scas_697.12                                                           638   0.0  
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...   629   0.0  
Scas_627.4                                                            457   e-157
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...   452   e-155
ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH] (589602..59...   449   e-154
Kwal_47.17314                                                         442   e-152
KLLA0E13563g 1193481..1194902 some similarities with sp|P39962 S...   444   e-152
Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement        444   e-152
CAGL0K02299g complement(205332..206948) similar to sp|P39962 Sac...   437   e-149
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...   327   e-106
Kwal_56.24064                                                         325   e-106
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...   325   e-106
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...   323   e-105
Scas_720.24                                                           321   e-104
Sklu_1892.3 YPL204W, Contig c1892 5770-7194                           321   e-104
YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I (s...   318   e-103
Scas_690.12                                                           269   4e-84
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    75   8e-14
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    68   5e-12
Scas_618.8                                                             68   5e-12
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    68   9e-12
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    68   1e-11
Kwal_56.24059                                                          67   1e-11
Kwal_23.6325                                                           68   1e-11
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    65   3e-11
Scas_660.20                                                            66   5e-11
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    65   8e-11
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    64   1e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      65   1e-10
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    64   1e-10
Kwal_33.13846                                                          64   1e-10
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         64   2e-10
Kwal_26.7355                                                           64   2e-10
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    62   3e-10
Kwal_56.22693                                                          62   5e-10
Kwal_0.96                                                              62   6e-10
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    62   9e-10
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        61   9e-10
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           61   1e-09
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    61   2e-09
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    61   2e-09
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    61   2e-09
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    60   2e-09
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    60   2e-09
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    60   2e-09
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    60   2e-09
CAGL0M08404g complement(836791..838179) some similarities with s...    60   3e-09
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    59   3e-09
Scas_502.2                                                             60   3e-09
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    60   3e-09
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    59   3e-09
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    60   4e-09
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    59   4e-09
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    59   4e-09
Kwal_26.7635                                                           59   5e-09
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    59   5e-09
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    59   6e-09
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    59   6e-09
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    59   7e-09
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    59   7e-09
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    59   8e-09
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    58   8e-09
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    59   9e-09
Scas_690.13                                                            57   9e-09
Kwal_47.18307                                                          57   2e-08
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    58   2e-08
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    57   2e-08
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    57   2e-08
Scas_689.25*                                                           56   3e-08
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    56   3e-08
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    57   3e-08
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    57   4e-08
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    56   4e-08
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    56   5e-08
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    56   5e-08
Kwal_26.7788                                                           56   6e-08
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    56   6e-08
Scas_720.94                                                            56   6e-08
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    55   7e-08
Scas_711.25                                                            56   7e-08
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    55   9e-08
Scas_717.69                                                            55   9e-08
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    55   9e-08
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    55   9e-08
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    55   1e-07
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    55   1e-07
Kwal_14.1273                                                           54   1e-07
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    55   1e-07
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    55   1e-07
Scas_721.124                                                           55   1e-07
Scas_660.28                                                            55   1e-07
KLLA0B07205g complement(624606..625973) some similarities with s...    54   1e-07
Scas_673.20*                                                           55   1e-07
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       55   1e-07
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    55   1e-07
Kwal_55.21545                                                          54   2e-07
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    54   2e-07
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    54   2e-07
Scas_651.18                                                            54   2e-07
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    54   2e-07
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    54   2e-07
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    54   2e-07
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    54   2e-07
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         53   3e-07
Kwal_33.14554                                                          54   3e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    53   3e-07
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    54   3e-07
Kwal_14.1159                                                           54   3e-07
Scas_703.5                                                             54   3e-07
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    54   3e-07
Kwal_47.18233                                                          53   3e-07
Scas_707.3                                                             54   4e-07
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    52   4e-07
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    53   5e-07
Scas_613.5                                                             53   5e-07
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    53   5e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    53   5e-07
Kwal_47.16761                                                          53   6e-07
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    52   6e-07
Scas_654.12                                                            52   6e-07
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    52   6e-07
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    52   6e-07
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    52   7e-07
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    52   7e-07
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    52   8e-07
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    52   8e-07
Scas_580.6                                                             52   8e-07
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    52   9e-07
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    51   1e-06
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    51   1e-06
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    51   1e-06
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    51   1e-06
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    51   2e-06
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    51   2e-06
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    51   2e-06
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    51   2e-06
YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine...    51   2e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    51   2e-06
Kwal_26.8796                                                           51   2e-06
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    50   3e-06
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    50   3e-06
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    50   3e-06
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    49   4e-06
CAGL0M08316g 829069..831963 weakly similar to sp|P36003 Saccharo...    50   4e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    49   4e-06
Kwal_33.14434                                                          50   4e-06
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    50   4e-06
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    49   4e-06
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    50   5e-06
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    50   5e-06
Scas_616.10                                                            50   5e-06
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    49   6e-06
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    49   6e-06
Kwal_56.24091                                                          49   7e-06
Kwal_26.8709                                                           49   8e-06
Scas_700.54                                                            49   1e-05
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             47   1e-05
Kwal_23.6458                                                           48   1e-05
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    48   2e-05
Kwal_27.11919                                                          46   2e-05
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    48   2e-05
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    48   2e-05
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    47   2e-05
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    47   2e-05
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    47   2e-05
Scas_648.17                                                            47   3e-05
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    47   3e-05
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    47   3e-05
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    46   3e-05
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    47   3e-05
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    47   3e-05
Scas_593.14d                                                           47   3e-05
CAGL0M10153g complement(1010688..1013291) some similarities with...    47   3e-05
Kwal_33.13984                                                          47   3e-05
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    47   4e-05
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    47   4e-05
Scas_720.103                                                           47   4e-05
Scas_655.2                                                             47   5e-05
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    46   5e-05
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    46   5e-05
Kwal_23.3590                                                           46   5e-05
Kwal_26.7861                                                           46   5e-05
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    46   5e-05
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    46   5e-05
Scas_700.34                                                            46   5e-05
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    46   6e-05
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    46   6e-05
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            46   6e-05
Scas_721.46                                                            45   6e-05
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    46   6e-05
Kwal_56.22788                                                          46   6e-05
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    46   6e-05
Scas_689.22                                                            46   7e-05
Scas_715.34                                                            46   7e-05
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    45   7e-05
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    46   7e-05
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    46   8e-05
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    45   8e-05
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    46   8e-05
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    45   8e-05
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    46   8e-05
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    46   8e-05
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    46   8e-05
Kwal_55.21709                                                          45   8e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    45   9e-05
Kwal_23.5290                                                           45   9e-05
Scas_640.14*                                                           45   9e-05
Scas_675.2                                                             45   9e-05
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    45   9e-05
Scas_201.1*                                                            45   9e-05
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          45   9e-05
Scas_629.16                                                            45   1e-04
Kwal_27.10581                                                          45   1e-04
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    45   1e-04
Scas_705.23                                                            45   1e-04
Scas_668.22                                                            45   1e-04
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    45   1e-04
YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein...    45   1e-04
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    45   1e-04
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    45   1e-04
Kwal_26.8751                                                           45   1e-04
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    45   1e-04
Scas_627.7                                                             45   1e-04
KLLA0A06776g 612115..614517 some similarities with sp|P36003 Sac...    45   1e-04
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    45   1e-04
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    45   1e-04
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    44   1e-04
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    45   1e-04
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    45   1e-04
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    45   1e-04
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    45   1e-04
Kwal_14.2497                                                           45   1e-04
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    45   2e-04
Kwal_14.1249                                                           44   2e-04
Scas_667.18                                                            44   2e-04
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         44   2e-04
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    44   2e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    44   2e-04
Scas_716.33                                                            44   2e-04
Scas_649.30                                                            44   2e-04
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    44   2e-04
Scas_713.21                                                            44   2e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    44   2e-04
Scas_698.37                                                            44   2e-04
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         44   3e-04
Kwal_26.7276                                                           44   3e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    44   3e-04
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    44   3e-04
Kwal_55.20326                                                          44   3e-04
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    44   3e-04
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    44   3e-04
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    44   3e-04
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    44   3e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    44   3e-04
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    44   3e-04
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    44   3e-04
Scas_683.12                                                            43   3e-04
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       44   3e-04
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...    44   4e-04
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    44   4e-04
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    44   4e-04
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    43   4e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    44   4e-04
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            43   4e-04
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         43   5e-04
Scas_707.36                                                            43   5e-04
Scas_584.8                                                             43   5e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         43   5e-04
Scas_707.34                                                            43   5e-04
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            43   5e-04
Kwal_26.8703                                                           43   5e-04
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...    43   5e-04
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    43   6e-04
Scas_671.16                                                            43   6e-04
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    43   6e-04
Scas_598.6                                                             43   6e-04
Kwal_27.9804                                                           43   6e-04
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    43   6e-04
Scas_713.38                                                            42   6e-04
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    43   7e-04
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        42   8e-04
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    42   8e-04
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    42   9e-04
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    42   0.001
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    42   0.001
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    42   0.001
Scas_544.6                                                             42   0.001
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    42   0.001
Kwal_56.24584                                                          42   0.001
Kwal_33.14192                                                          42   0.001
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    42   0.001
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    42   0.001
Scas_613.13*                                                           41   0.001
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    42   0.001
Scas_700.35                                                            42   0.001
Scas_640.16                                                            42   0.001
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      41   0.001
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    42   0.001
Scas_711.15                                                            42   0.001
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    42   0.002
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    41   0.002
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    41   0.002
KLLA0C03938g complement(358851..360632) some similarities with s...    41   0.002
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    41   0.002
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    41   0.002
Scas_477.5                                                             41   0.002
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    41   0.002
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    41   0.002
Kwal_17.2687                                                           41   0.002
Sklu_2401.9 YGR092W, Contig c2401 17788-19521                          41   0.002
Scas_651.3                                                             41   0.002
Scas_693.17                                                            41   0.002
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    41   0.002
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    41   0.002
Kwal_0.155                                                             41   0.002
Scas_721.132                                                           41   0.002
Kwal_33.13112                                                          41   0.002
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    41   0.002
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    41   0.002
Scas_718.72                                                            41   0.002
Scas_721.110                                                           41   0.003
Kwal_14.1416                                                           40   0.003
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                           40   0.003
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    41   0.003
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    40   0.003
Scas_619.5*                                                            40   0.003
Scas_685.24                                                            40   0.003
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    40   0.003
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    40   0.003
Scas_661.27                                                            40   0.004
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    40   0.004
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    40   0.004
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    40   0.004
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    40   0.004
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    40   0.004
YMR216C (SKY1) [4172] chr13 complement(698810..701038) Serine/th...    40   0.004
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    40   0.004
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    40   0.004
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    40   0.005
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    39   0.005
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    40   0.005
Kwal_55.21900                                                          40   0.005
Scas_623.11                                                            39   0.005
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    40   0.005
Kwal_23.5668                                                           40   0.005
Scas_602.11                                                            40   0.006
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    40   0.006
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    39   0.006
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    40   0.006
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          40   0.006
Kwal_47.17252                                                          40   0.007
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    39   0.007
Scas_653.25                                                            39   0.007
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    39   0.007
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    39   0.007
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    39   0.007
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    39   0.007
Kwal_23.3992                                                           39   0.007
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    39   0.007
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    39   0.007
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    39   0.008
Scas_336.1                                                             39   0.008
Kwal_56.23717                                                          39   0.008
Kwal_26.7682                                                           39   0.009
Scas_683.6                                                             39   0.009
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    39   0.010
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    39   0.010
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    39   0.010
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    39   0.010
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    39   0.011
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    39   0.011
Scas_564.7                                                             39   0.011
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    39   0.011
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    39   0.011
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            39   0.012
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    39   0.012
Kwal_55.22001                                                          38   0.013
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    38   0.013
CAGL0F03905g complement(377962..380088) similar to sp|Q03656 Sac...    39   0.013
KLLA0C16577g complement(1451181..1452695) some similarities with...    39   0.013
Scas_635.1                                                             38   0.014
Kwal_23.4276                                                           38   0.014
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    38   0.015
Kwal_26.7552                                                           38   0.016
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    38   0.016
Kwal_56.23841                                                          38   0.016
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    39   0.016
CAGL0K01661g complement(146952..148400) some similarities with t...    38   0.017
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    38   0.017
Scas_677.18                                                            38   0.018
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...    38   0.018
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    38   0.019
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    38   0.020
Scas_568.9*                                                            37   0.020
Scas_584.11                                                            38   0.021
Sklu_1883.2 YKL171W, Contig c1883 1300-4338                            38   0.022
KLLA0D12100g complement(1031728..1033161) some similarities with...    38   0.023
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    38   0.023
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    38   0.025
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    37   0.028
Scas_493.2                                                             38   0.028
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    37   0.029
Kwal_47.17345                                                          37   0.030
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    37   0.032
Scas_610.7                                                             37   0.033
Kwal_47.17868                                                          37   0.034
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    37   0.035
Kwal_56.22476                                                          37   0.036
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    37   0.037
Kwal_33.14167                                                          37   0.037
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    37   0.038
YHR079C (IRE1) [2368] chr8 complement(258245..261592) Protein ki...    37   0.039
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    37   0.040
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    37   0.040
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    37   0.040
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    37   0.041
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    37   0.042
Scas_713.7                                                             37   0.042
Scas_703.47                                                            37   0.044
Kwal_55.20221                                                          37   0.044
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    37   0.049
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    37   0.052
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    37   0.052
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    37   0.055
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    37   0.056
Scas_707.7                                                             36   0.059
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    37   0.059
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         36   0.060
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    37   0.060
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    36   0.061
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    36   0.061
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         36   0.063
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    37   0.064
KLLA0D09328g complement(788565..791705) some similarities with s...    36   0.066
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    36   0.066
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    36   0.066
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    36   0.069
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    36   0.070
CAGL0K11990g complement(1155395..1158370) some similarities with...    36   0.070
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    36   0.073
KLLA0F22297g complement(2083448..2085547) some similarities with...    36   0.073
KLLA0E11979g complement(1060048..1061892) some similarities with...    36   0.074
Scas_721.61                                                            36   0.074
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    36   0.077
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    36   0.078
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    36   0.078
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         36   0.078
Scas_548.6                                                             36   0.080
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    36   0.084
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    36   0.090
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    36   0.093
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    36   0.094
Kwal_27.12559                                                          35   0.10 
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    36   0.11 
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    35   0.11 
Sklu_1870.5 YFL029C, Contig c1870 6101-7144                            35   0.11 
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    35   0.12 
Kwal_47.17263                                                          35   0.12 
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    35   0.13 
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    35   0.13 
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      35   0.13 
Kwal_27.10004                                                          35   0.14 
Scas_568.13                                                            35   0.14 
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    35   0.14 
Scas_573.10                                                            35   0.14 
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    35   0.15 
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    35   0.15 
Kwal_55.20189                                                          35   0.15 
Scas_689.24                                                            35   0.15 
Scas_643.20                                                            35   0.15 
Kwal_23.5576                                                           35   0.16 
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    35   0.16 
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    35   0.17 
Kwal_27.11803                                                          34   0.18 
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    35   0.18 
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    35   0.19 
Scas_710.28                                                            34   0.19 
Scas_695.33                                                            35   0.20 
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    35   0.20 
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    35   0.21 
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    35   0.21 
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    35   0.22 
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            35   0.22 
Scas_692.24                                                            35   0.23 
Kwal_33.13222                                                          33   0.25 
Scas_688.14                                                            34   0.25 
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    34   0.25 
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    34   0.25 
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    34   0.27 
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    34   0.28 
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    34   0.28 
Scas_678.24                                                            34   0.29 
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             34   0.29 

>Scas_654.17
          Length = 523

 Score =  951 bits (2457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/523 (90%), Positives = 473/523 (90%)

Query: 1   MSHHQNSTTANTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMR 60
           MSHHQNSTTANTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMR
Sbjct: 1   MSHHQNSTTANTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMR 60

Query: 61  DDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKIL 120
           DDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKIL
Sbjct: 61  DDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKIL 120

Query: 121 TGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDL 180
           TGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDL
Sbjct: 121 TGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDL 180

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA
Sbjct: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240

Query: 241 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNV 300
           RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNV
Sbjct: 241 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNV 300

Query: 301 YDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGR 360
           YDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGR
Sbjct: 301 YDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGR 360

Query: 361 GWDLAINKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVAGGNPQQRQTNSXXXXXXXXXXX 420
           GWDLAINKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVAGGNPQQRQTNS           
Sbjct: 361 GWDLAINKKPNLHGYGHPNPPNEKSKRHRNKLNAAGVAGGNPQQRQTNSPLHTAHHTPQP 420

Query: 421 XXXXXXXXXXXXENDMQQNEAQLDPXXXXXXXXXXXXXXXXXXXXXXXXXXXTATKQGAN 480
                       ENDMQQNEAQLDP                           TATKQGAN
Sbjct: 421 PQLQPLQQNQHTENDMQQNEAQLDPTSYEAYQQQTQQKYAQQQKKSQLHQQHTATKQGAN 480

Query: 481 INNGKYQHQAQPTAVKQPQRGQQQQDESSDHSAKGFFSKLGCC 523
           INNGKYQHQAQPTAVKQPQRGQQQQDESSDHSAKGFFSKLGCC
Sbjct: 481 INNGKYQHQAQPTAVKQPQRGQQQQDESSDHSAKGFFSKLGCC 523

>YNL154C (YCK2) [4443] chr14 complement(343636..345276) Casein
           kinase I isoform [1641 bp, 546 aa]
          Length = 546

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/399 (84%), Positives = 360/399 (90%), Gaps = 10/399 (2%)

Query: 1   MSHHQNSTTA-NTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMT-------PANQTPAST 52
           MS  Q+  TA N+ +A++N  NT N+ M + SN+RL+NG LP +         N   +S 
Sbjct: 1   MSQVQSPLTATNSGLAVNN--NTMNSQMPNRSNVRLVNGTLPPSLHVSSNLNHNTGNSSA 58

Query: 53  ASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD 112
           +   +  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD
Sbjct: 59  SYSGSQSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD 118

Query: 113 EYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQ 172
           EYRTYKIL GTPG+PQ YYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQ
Sbjct: 119 EYRTYKILAGTPGIPQEYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQ 178

Query: 173 MITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYRE 232
           MITLIEDLHAHDLIYRDIKPDNFL+GRPG  DANK+HLIDFGMAKQYRDPKTKQHIPYRE
Sbjct: 179 MITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDANKVHLIDFGMAKQYRDPKTKQHIPYRE 238

Query: 233 KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 292
           KKSLSGTARYMSINTHLGREQSRRDDMEA+GHVFFYFLRGQLPWQGLKAPNNKQKYEKIG
Sbjct: 239 KKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 298

Query: 293 EKKRTTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYD 352
           EKKR TNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLS LDDLG++ADG+YD
Sbjct: 299 EKKRLTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSVLDDLGETADGQYD 358

Query: 353 WMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSKRHRNK 391
           WMKLNGGRGWDL+INKKPNLHGYGHPNPPNEKSKRHR+K
Sbjct: 359 WMKLNGGRGWDLSINKKPNLHGYGHPNPPNEKSKRHRSK 397

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%)

Query: 478 GANINNGKYQHQAQPTAVKQPQRGQQQQDESSDHSAKGFFSKLGCC 523
           GAN    KY + AQPTA  +       QD +S+ S+KGFFSKLGCC
Sbjct: 501 GANGQTNKYPYNAQPTANDEQNAKNAAQDRNSNKSSKGFFSKLGCC 546

>CAGL0G06138g complement(585585..587204) similar to sp|P23291
           Saccharomyces cerevisiae YHR135c YCK1, start by
           similarity
          Length = 539

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/395 (82%), Positives = 349/395 (88%), Gaps = 16/395 (4%)

Query: 1   MSHHQNS---TTANTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMTPANQTPASTASPPT 57
           MS +QNS   T ANTAMA++NLTN     M + +            P N TP++ +S   
Sbjct: 1   MSRYQNSPAVTAANTAMAVNNLTNGGYPAMNANA------------PYNGTPSNRSSSNM 48

Query: 58  SMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTY 117
           + RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEYRTY
Sbjct: 49  TSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLKDEYRTY 108

Query: 118 KILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLI 177
           KI+ GTP VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC RKFSVKTVVQVAVQMITLI
Sbjct: 109 KIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLI 168

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 237
           EDLHAHDLIYRDIKPDNFL+GRPG  D NKIHLIDFGMAKQYRDPKTKQHIPYRE+KSLS
Sbjct: 169 EDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQHIPYRERKSLS 228

Query: 238 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRT 297
           GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRT
Sbjct: 229 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRT 288

Query: 298 TNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLN 357
           TNVYDL+ G P+QFGRYLEIVR+LSFEETPDY+GYR LLLS LDD+  SADG YDWMKLN
Sbjct: 289 TNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDMNDSADGTYDWMKLN 348

Query: 358 GGRGWDLAINKKPNLHGYGHPNPPNEKSKRHRNKL 392
           GGRGWDL INKKPNLHGYGHPNPPN+K +RH+NK+
Sbjct: 349 GGRGWDLTINKKPNLHGYGHPNPPNDK-RRHKNKM 382

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 489 QAQPTAVKQPQRGQQQ--QDESSDHSAKGFFSKLGCC 523
           QA P   +Q Q+  +Q  QD ++  S KGFF KLGCC
Sbjct: 503 QATPNNRQQFQQHTEQVEQDYTTTSSEKGFFQKLGCC 539

>YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kinase
           I isoform [1617 bp, 538 aa]
          Length = 538

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/385 (82%), Positives = 341/385 (88%), Gaps = 3/385 (0%)

Query: 10  ANTAMAIHNLTNT---TNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIV 66
           A+T +A++NLTN     N  +Q+   L     + P   +     +  S   S RDDSTIV
Sbjct: 6   ASTTLAVNNLTNINGNANFNVQANKQLHHQAVDSPARSSMTATTAANSNSNSSRDDSTIV 65

Query: 67  GLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGV 126
           GLHYKIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQL+DEY+TYKIL GTP +
Sbjct: 66  GLHYKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLRDEYKTYKILNGTPNI 125

Query: 127 PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLI 186
           P AYYFGQEGLHNILVIDLLGPSLEDLFDWC RKFSVKTVVQVAVQMITLIEDLHAHDLI
Sbjct: 126 PYAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQVAVQMITLIEDLHAHDLI 185

Query: 187 YRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 246
           YRDIKPDNFL+GRPG  DAN IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN
Sbjct: 186 YRDIKPDNFLIGRPGQPDANNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 245

Query: 247 THLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQG 306
           THLGREQSRRDDMEALGHVFFYFLRG LPWQGLKAPNNKQKYEKIGEKKR+TNVYDLAQG
Sbjct: 246 THLGREQSRRDDMEALGHVFFYFLRGHLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLAQG 305

Query: 307 LPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAI 366
           LP+QFGRYLEIVR+LSFEE PDYEGYR LLLS LDDLG++ADG+YDWMKLN GRGWDL I
Sbjct: 306 LPVQFGRYLEIVRSLSFEECPDYEGYRKLLLSVLDDLGETADGQYDWMKLNDGRGWDLNI 365

Query: 367 NKKPNLHGYGHPNPPNEKSKRHRNK 391
           NKKPNLHGYGHPNPPNEKS++HRNK
Sbjct: 366 NKKPNLHGYGHPNPPNEKSRKHRNK 390

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 484 GKYQHQAQPTA-VKQPQRGQQQQDESSDHSAKGFFSKLGCC 523
            +YQ Q QP+A ++ P++     + S   S KGFF KLGCC
Sbjct: 498 ARYQPQQQPSAALRTPEQHPNDDNSSLAASHKGFFQKLGCC 538

>KLLA0D11044g complement(942458..944068)
           gi|730472|sp|P40230|RAG8_KLULA Kluyveromyces lactis
           CASEIN KINASE I HOMOLOG RAG8, start by similarity
          Length = 536

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/375 (83%), Positives = 332/375 (88%), Gaps = 5/375 (1%)

Query: 27  MQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFE 86
           MQ + N  +LNG        Q+ AS+    TS RDDSTIVGLHYKIGKKIGEGSFGVLFE
Sbjct: 39  MQPSGN-NVLNGLANGATGLQSSASS----TSTRDDSTIVGLHYKIGKKIGEGSFGVLFE 93

Query: 87  GTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLL 146
           G NMIN +PVAIKFEPRKT+APQLKDEYRTYKIL+G+ G+PQAYYFGQEGLHNILVIDLL
Sbjct: 94  GVNMINNVPVAIKFEPRKTDAPQLKDEYRTYKILSGSEGIPQAYYFGQEGLHNILVIDLL 153

Query: 147 GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN 206
           GPSLEDLFDWC R+FS+KTVV VA+QMITLIE+LH HDLIYRDIKPDNFL+GRP   DAN
Sbjct: 154 GPSLEDLFDWCGRRFSIKTVVHVAIQMITLIEELHDHDLIYRDIKPDNFLIGRPNQPDAN 213

Query: 207 KIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 266
            +HLIDFGMAK YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF
Sbjct: 214 MVHLIDFGMAKLYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 273

Query: 267 FYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQGLPIQFGRYLEIVRNLSFEET 326
           FYFLRGQLPWQGLKA NNK KYEKIGEKKR+TNVYDL+QGLP+QFGRYLEIVRNL FEET
Sbjct: 274 FYFLRGQLPWQGLKAANNKLKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEET 333

Query: 327 PDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSK 386
           PDYEGYR LLLS LD+LGQ  DGEYDWMKLNGGRGWDLAINKKPNLHGYGHP PPNEKSK
Sbjct: 334 PDYEGYRKLLLSVLDELGQKLDGEYDWMKLNGGRGWDLAINKKPNLHGYGHPTPPNEKSK 393

Query: 387 RHRNKLNAAGVAGGN 401
           RHRNK N   +A  N
Sbjct: 394 RHRNKFNQVPLAVNN 408

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 13/16 (81%)

Query: 508 SSDHSAKGFFSKLGCC 523
           +  +S KGFFSKLGCC
Sbjct: 521 ADSNSEKGFFSKLGCC 536

>AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C
           (YCK2) - SH] complement(505602..507245) [1644 bp, 547
           aa]
          Length = 547

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/335 (90%), Positives = 318/335 (94%)

Query: 57  TSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRT 116
            S RDD+TIVGLH+KIGKKIGEGSFGVLFEGTNMING+PVAIKFEPRKTEAPQLKDEYRT
Sbjct: 56  VSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRT 115

Query: 117 YKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITL 176
           YKIL GT GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQMITL
Sbjct: 116 YKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITL 175

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSL 236
           IEDLHAHDLIYRDIKPDNFL+GRP   DANK+HLIDFGMAK YRDPKTKQHIPYREKKSL
Sbjct: 176 IEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLYRDPKTKQHIPYREKKSL 235

Query: 237 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR 296
           SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR
Sbjct: 236 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR 295

Query: 297 TTNVYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
           +TNVYDL+QGLP+QFGRYLEIVRNL FEETPDY+GYR LLLS L++LG   DGEYDWMKL
Sbjct: 296 STNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKLLLSTLEELGLEYDGEYDWMKL 355

Query: 357 NGGRGWDLAINKKPNLHGYGHPNPPNEKSKRHRNK 391
           NGGRGWDL INKKPNLHGYGHPNPPNEK +RHR+K
Sbjct: 356 NGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSK 390

 Score = 35.8 bits (81), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 503 QQQDESSDHSAKGFFSKLGCC 523
           +QQD  S  S KGFFSK+GCC
Sbjct: 527 KQQDVGSVSSGKGFFSKMGCC 547

>Kwal_33.14596
          Length = 500

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/332 (90%), Positives = 317/332 (95%)

Query: 60  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKI 119
           R+DSTIVGLHY+IGKKIGEGSFGVLFEGTNMING+PVAIKFEPRK+EAPQLKDEYRTYKI
Sbjct: 22  REDSTIVGLHYRIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKI 81

Query: 120 LTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIED 179
           L GT G+PQAYYFGQEGLHNILVIDLLGPSLEDLFDWC R+FSVKTVVQVAVQMITLIED
Sbjct: 82  LAGTAGIPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIED 141

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 239
           LH HDLIYRDIKPDNFL+GRPG  D NK+HLIDFGMAKQYRDPKTKQHIPYREKKSLSGT
Sbjct: 142 LHTHDLIYRDIKPDNFLIGRPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGT 201

Query: 240 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 299
           ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR TN
Sbjct: 202 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTN 261

Query: 300 VYDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGG 359
           VYDLAQGLP+QFGRYLE+VR+L+FEETPDYEGYR L LS LDD+   ADGEYDWMKLNGG
Sbjct: 262 VYDLAQGLPVQFGRYLEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGG 321

Query: 360 RGWDLAINKKPNLHGYGHPNPPNEKSKRHRNK 391
           RGWDL INKKPNLHGYGHPNPPN+K++RHR+K
Sbjct: 322 RGWDLNINKKPNLHGYGHPNPPNDKNRRHRSK 353

>Scas_697.12
          Length = 529

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/379 (83%), Positives = 330/379 (87%), Gaps = 20/379 (5%)

Query: 12  TAMAIHNLTNTTNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDD-STIVGLHY 70
           T MA++NLTN                      P + +      P TS  DD STIVGLHY
Sbjct: 8   TPMAVNNLTNIP-------------------APTSLSQQQQQRPSTSTHDDNSTIVGLHY 48

Query: 71  KIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQAY 130
           +IGKKIGEGSFGVLFEG NMING PVAIKFEPRKTEAPQLKDEYRTYKIL GTP +P AY
Sbjct: 49  RIGKKIGEGSFGVLFEGINMINGTPVAIKFEPRKTEAPQLKDEYRTYKILAGTPNIPLAY 108

Query: 131 YFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDI 190
           YFGQEGLHNILVIDLLGPSLEDLFDWCNR+FSVKTVVQVAVQMITLIEDLHA+DLIYRDI
Sbjct: 109 YFGQEGLHNILVIDLLGPSLEDLFDWCNRRFSVKTVVQVAVQMITLIEDLHANDLIYRDI 168

Query: 191 KPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 250
           KPDNFL+GRPG  D N IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG
Sbjct: 169 KPDNFLIGRPGQPDENFIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG 228

Query: 251 REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQGLPIQ 310
           REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKRTTNVYDLAQGLP+Q
Sbjct: 229 REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTNVYDLAQGLPVQ 288

Query: 311 FGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAINKKP 370
           F RYLE+VRNLSFEETPDY GYR LLLS+LDDLGQSADGEYDWMKLNGG+GWDL INKKP
Sbjct: 289 FARYLEVVRNLSFEETPDYRGYRELLLSSLDDLGQSADGEYDWMKLNGGKGWDLNINKKP 348

Query: 371 NLHGYGHPNPPNEKSKRHR 389
           NLHGYGHP PPNEKS+RHR
Sbjct: 349 NLHGYGHPTPPNEKSRRHR 367

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 30/54 (55%), Gaps = 9/54 (16%)

Query: 479 ANINNGKYQHQAQPT----AVKQPQRG-----QQQQDESSDHSAKGFFSKLGCC 523
           AN N  +Y  Q +P        QPQ+G     QQ  D++S  S KGFFSKLGCC
Sbjct: 476 ANPNTNQYASQQEPMNNLHQQAQPQQGKNNQMQQTADDASSESGKGFFSKLGCC 529

>CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces
           cerevisiae YHR135c YCK1 or sp|P23292 Saccharomyces
           cerevisiae YNL154c YCK2, hypothetical start
          Length = 486

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/327 (89%), Positives = 309/327 (94%)

Query: 64  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT 123
           TI GLHY+IGKKIGEGSFGVLFEGTN+ING+PVA+KFEPRKTEAPQLKDEYRTYKIL GT
Sbjct: 35  TIAGLHYQIGKKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGT 94

Query: 124 PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
           PGVPQAYYFGQEGLHNILV+DLLGPSLEDLFDWC R+FS KTVVQVAVQMITLIEDLHAH
Sbjct: 95  PGVPQAYYFGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAH 154

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           DLIYRDIKPDNFLVGRPG  D N IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM
Sbjct: 155 DLIYRDIKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 214

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE+IGEKKRTT+VYDL
Sbjct: 215 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDL 274

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWD 363
           A G P+QF RYLEIVRNL F+ETPDYEGYR LL SALDD+G++ DG+YDWM+LNGGRGWD
Sbjct: 275 ANGYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWD 334

Query: 364 LAINKKPNLHGYGHPNPPNEKSKRHRN 390
           L INKKPNLHGYGHPNPP +KS R+RN
Sbjct: 335 LTINKKPNLHGYGHPNPPGDKSHRNRN 361

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 485 KYQHQAQPTAVKQPQRGQQQQDESSDHSAKGFFSKLGCC 523
           +Y  Q QPT     Q    QQD  S  S KGFFSKLGCC
Sbjct: 449 RYNFQEQPTTT-HGQTKNTQQDMHSSSSEKGFFSKLGCC 486

>Scas_627.4
          Length = 475

 Score =  457 bits (1176), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 212/337 (62%), Positives = 256/337 (75%), Gaps = 18/337 (5%)

Query: 65  IVGLHYKIGKKIGEGSFGVLFEGTNMI---NGLPVAIKFEPRKTEAPQLKDEYRTYKILT 121
           IVG+HY +G KIGEGSFGV+FEG N++   +  PVAIKFEPR ++APQL+DE+R+YKIL 
Sbjct: 10  IVGIHYAVGPKIGEGSFGVIFEGENLLKDASNEPVAIKFEPRHSDAPQLRDEFRSYKILN 69

Query: 122 GTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
              G+P  YYFGQEG+HNIL+IDLLGPSLEDLF+WC R+FS+KT   +A QMI  I+D+H
Sbjct: 70  NCTGIPHVYYFGQEGMHNILIIDLLGPSLEDLFEWCGRRFSIKTTCMIAKQMIRRIKDIH 129

Query: 182 AHDLIYRDIKPDNFLVGR-------------PGHEDANKIHLIDFGMAKQYRDPKTKQHI 228
            HDLIYRDIKPDNFL+ +               H D N I+L+DFGMAKQ+RDP++KQHI
Sbjct: 130 NHDLIYRDIKPDNFLISQYQRIGSNEKCINSNAHADPNLIYLVDFGMAKQFRDPRSKQHI 189

Query: 229 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
           PYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLKA NNK KY
Sbjct: 190 PYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAANNKLKY 249

Query: 289 EKIGEKKRTTNVYDLAQG--LPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQS 346
           EKIG  K+  N  DL     +P QF  YL+  R+L FE+ PDY+    L+   L++L   
Sbjct: 250 EKIGLTKQKLNPDDLLMNNHIPKQFATYLKYARSLKFEQDPDYDYLVSLMDDTLNELNLV 309

Query: 347 ADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNE 383
            DG YDWM LN G+GWD+ INK+ NLHGYG+PNP N+
Sbjct: 310 DDGHYDWMDLNDGKGWDIKINKRTNLHGYGNPNPRNQ 346

>YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I
           isoform, plasma membrane-bound [1575 bp, 524 aa]
          Length = 524

 Score =  452 bits (1163), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 255/358 (71%), Gaps = 35/358 (9%)

Query: 58  SMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGL-----------------PVAIKF 100
           S R    IVG+HY +G KIGEGSFGV+FEG N+++                   PVAIKF
Sbjct: 2   SQRSSQHIVGIHYAVGPKIGEGSFGVIFEGENILHSCQAQTGSKRDSSIIMANEPVAIKF 61

Query: 101 EPRKTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK 160
           EPR ++APQL+DE+R Y+IL G  G+P AYYFGQEG+HNIL+IDLLGPSLEDLF+WC RK
Sbjct: 62  EPRHSDAPQLRDEFRAYRILNGCVGIPHAYYFGQEGMHNILIIDLLGPSLEDLFEWCGRK 121

Query: 161 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGR----------------PGHED 204
           FSVKT   VA QMI  +  +H HDLIYRDIKPDNFL+ +                  + D
Sbjct: 122 FSVKTTCMVAKQMIDRVRAIHDHDLIYRDIKPDNFLISQYQRISPEGKVIKSCASSSNND 181

Query: 205 ANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGH 264
            N I+++DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGH
Sbjct: 182 PNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGH 241

Query: 265 VFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLA--QGLPIQFGRYLEIVRNLS 322
           VFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  DL     +P QF  YL+  R+L 
Sbjct: 242 VFFYFLRGSLPWQGLKAPNNKLKYEKIGMTKQKLNPDDLLLNNAIPYQFATYLKYARSLK 301

Query: 323 FEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNP 380
           F+E PDY+    L+  AL       DG YDWM LNGG+GW++ IN++ NLHGYG+PNP
Sbjct: 302 FDEDPDYDYLISLMDDALRLNDLKDDGHYDWMDLNGGKGWNIKINRRANLHGYGNPNP 359

>ADL053C [1688] [Homologous to ScYER123W (YCK3) - SH]
           (589602..591017) [1416 bp, 471 aa]
          Length = 471

 Score =  449 bits (1154), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/345 (60%), Positives = 257/345 (74%), Gaps = 22/345 (6%)

Query: 60  RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING-----LPVAIKFEPRKTEAPQLKDEY 114
           R    +VG+HY +G KIGEGSFG++FEG NM+ G      PVAIKFEPR+++APQL+DE+
Sbjct: 4   RGSQHVVGIHYAVGPKIGEGSFGIIFEGENMMEGGDAGRRPVAIKFEPRRSDAPQLRDEF 63

Query: 115 RTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMI 174
           R Y+IL G  G+P+AYYFGQEG+HNIL+IDLLGPSLEDLF+WC R+FSVKT   +A QMI
Sbjct: 64  RAYRILNGVRGIPRAYYFGQEGVHNILIIDLLGPSLEDLFEWCGRRFSVKTTCMLAKQMI 123

Query: 175 TLIEDLHAHDLIYRDIKPDNFLVGRPGHE----------------DANKIHLIDFGMAKQ 218
             +  +H  DLIYRDIKPDNFL+     E                DAN I+++DFGMAKQ
Sbjct: 124 ERVRAIHGRDLIYRDIKPDNFLISEFQREVAAGEVVRGCAATAGGDANLIYVVDFGMAKQ 183

Query: 219 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
           YRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQG
Sbjct: 184 YRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQG 243

Query: 279 LKAPNNKQKYEKIGEKKRTTNVYDL-AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLL 337
           LKAPNNK KYEKIG  K+     +L ++ +P+QF  YL+  R+L F+E PDY+    L+ 
Sbjct: 244 LKAPNNKAKYEKIGLTKQKLKPEELISENIPVQFAEYLKYCRSLRFDEEPDYDYLISLMD 303

Query: 338 SALDDLGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPN 382
           S + DL    +  YDWM LN   GW++A+NK+ NLHGYG+P+P N
Sbjct: 304 SVMHDLNIEDNQHYDWMDLNNHTGWNIAVNKRANLHGYGNPHPRN 348

>Kwal_47.17314
          Length = 421

 Score =  442 bits (1137), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 205/342 (59%), Positives = 252/342 (73%), Gaps = 19/342 (5%)

Query: 65  IVGLHYKIGKKIGEGSFGVLFEGTNMIN--GLPVAIKFEPRKTEAPQLKDEYRTYKILTG 122
           IVG+HY +G KIGEGSFGV+FEG N++N    PVAIKFEPR+TEAPQL+DE+R YKIL G
Sbjct: 8   IVGIHYAVGPKIGEGSFGVIFEGENVLNNSSSPVAIKFEPRRTEAPQLRDEFRAYKILNG 67

Query: 123 TPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
             G+P+A+YFGQEG+HN+L+IDLLGPSLEDLF+WC R+FSVKT   +A QMI  ++ +H 
Sbjct: 68  LEGIPKAFYFGQEGMHNVLIIDLLGPSLEDLFEWCGRRFSVKTTCLLAKQMIRRVQSIHQ 127

Query: 183 HDLIYRDIKPDNFLVGR----------------PGHEDANKIHLIDFGMAKQYRDPKTKQ 226
            DLIYRDIKPDNFL+                    H + N ++++DFGMAKQYRDPKTKQ
Sbjct: 128 RDLIYRDIKPDNFLIAEYQRELPNGQLVKNCATSAHGNPNLVYVVDFGMAKQYRDPKTKQ 187

Query: 227 HIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 286
           HIPY+E+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQGLK  N K 
Sbjct: 188 HIPYKERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGFLPWQGLKVANTKL 247

Query: 287 KYEKIGEKKRTTNVYDLAQ-GLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQ 345
           KYEKIG  K+     DL +  +P QF  YL   R+L FEE PDY+    L+  AL + G 
Sbjct: 248 KYEKIGLTKQKVRPEDLLERNIPTQFATYLTYCRSLRFEEEPDYDFLVSLMTQALQERGY 307

Query: 346 SADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNEKSKR 387
             D  YDW+ LN G+GW++ +N++ NLHGYG+P P   ++ R
Sbjct: 308 EEDDHYDWLDLNQGQGWNIFVNRRANLHGYGNPTPKTSQAAR 349

>KLLA0E13563g 1193481..1194902 some similarities with sp|P39962
           Saccharomyces cerevisiae YER123w YCK3 casein kinase,
           isoform 3, hypothetical start
          Length = 473

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 254/347 (73%), Gaps = 20/347 (5%)

Query: 58  SMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING---LPVAIKFEPRKTEAPQLKDEY 114
           S R    +VG+HY +G KIGEGSFG++FEG N++NG    PVAIKFEPR++++PQL+DE+
Sbjct: 2   SKRSSQHVVGIHYAVGPKIGEGSFGIIFEGENILNGGSKNPVAIKFEPRRSDSPQLRDEF 61

Query: 115 RTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMI 174
           R Y+IL    G+P AYYF QEG+HNIL+IDLLGPSLEDLF+WC+RKFSVKT   +A QMI
Sbjct: 62  RAYRILNDVRGIPHAYYFSQEGIHNILIIDLLGPSLEDLFEWCSRKFSVKTTAMLAKQMI 121

Query: 175 TLIEDLHAHDLIYRDIKPDNFLVGRPGHE----------------DANKIHLIDFGMAKQ 218
             +  +H HDLIYRDIKPDNFL+     E                DAN I+++DFGMAKQ
Sbjct: 122 DRVRSIHEHDLIYRDIKPDNFLISEFQRELSDGSVVKSCATSSGGDANLIYVVDFGMAKQ 181

Query: 219 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
           +RDP TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+LGHVFFYFLRG LPWQG
Sbjct: 182 FRDPNTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQG 241

Query: 279 LKAPNNKQKYEKIGEKKRTTNVYDLAQ-GLPIQFGRYLEIVRNLSFEETPDYEGYRMLLL 337
           LKA NNK KYEKIG  K+     DL    +P QF  YL   R+L F++ PDY+    L+ 
Sbjct: 242 LKALNNKAKYEKIGLTKQRLKPTDLLTPEIPKQFAEYLSYCRSLRFDQDPDYDYLISLMT 301

Query: 338 SALDDLGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNPPNEK 384
             + + G   DG YDWM LNGG+GW++ +NK+ NLHGYG+P P N K
Sbjct: 302 QIMQENGYEEDGHYDWMDLNGGQGWNIKVNKRVNLHGYGNPTPRNTK 348

>Sklu_2359.3 YER123W, Contig c2359 7455-8921 reverse complement
          Length = 488

 Score =  444 bits (1141), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 214/366 (58%), Positives = 260/366 (71%), Gaps = 37/366 (10%)

Query: 58  SMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGL--------------------PVA 97
           S R    +VG+HY +G KIGEGSFGV+FEG N++N                      PVA
Sbjct: 2   SKRGSQHVVGIHYAVGPKIGEGSFGVIFEGENILNSNNNNSSNNSSSASTGTANPVDPVA 61

Query: 98  IKFEPRKTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 157
           IKFEPR+++APQL+DE+R Y+IL G  G+P AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 62  IKFEPRRSDAPQLRDEFRAYRILNGITGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 121

Query: 158 NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHE-------------- 203
             +FSVKT   VA QMI  +  +H  DLIYRDIKPDNFL+     E              
Sbjct: 122 GHRFSVKTTCMVAKQMIDRVRSIHQRDLIYRDIKPDNFLISEYQRELPTGQILRSCSSSS 181

Query: 204 --DANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA 261
             D N I+++DFGMAKQYRDPKTKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E+
Sbjct: 182 NGDPNLIYVVDFGMAKQYRDPKTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLES 241

Query: 262 LGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG-EKKRTTNVYDLAQGLPIQFGRYLEIVRN 320
           LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+R +    L+ G+P QF  YL+  RN
Sbjct: 242 LGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGTTKQRLSPEKLLSDGIPEQFATYLKYCRN 301

Query: 321 LSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHPNP 380
           L F+E PDY+    L+  AL+  G   DG YDWM LN G+GW++ +N++ NLHGYG+P P
Sbjct: 302 LKFDEDPDYDYLISLMDEALNTSGSVEDGHYDWMDLNQGQGWNIRVNRRANLHGYGNPTP 361

Query: 381 PNEKSK 386
            ++K+K
Sbjct: 362 RDQKAK 367

>CAGL0K02299g complement(205332..206948) similar to sp|P39962
           Saccharomyces cerevisiae YER123w Casein kinase I,
           hypothetical start
          Length = 538

 Score =  437 bits (1125), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/362 (57%), Positives = 251/362 (69%), Gaps = 46/362 (12%)

Query: 65  IVGLHYKIGKKIGEGSFGVLFEGTNMIN---------------------------GLPVA 97
           +VG+HY +G KIGEGSFGV+FEG N++N                           G PVA
Sbjct: 17  VVGMHYAVGPKIGEGSFGVIFEGQNILNSSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVA 76

Query: 98  IKFEPRKTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC 157
           IKFEPR ++APQL+DE+R Y+IL G+ G+P AYYFGQEG+HN+L+IDLLGPSLEDLF+WC
Sbjct: 77  IKFEPRHSDAPQLRDEFRAYRILNGSKGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWC 136

Query: 158 NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLV-----------------GRP 200
            RKFS+KT   +A QMI  +  +H HDLIYRDIKPDNFL+                  + 
Sbjct: 137 GRKFSIKTTCMLAKQMIERVRIIHDHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQS 196

Query: 201 GHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME 260
              D N I+++DFGMAKQYRDP+TKQHIPYRE+KSLSGTARYMSINTH GREQSRRDD+E
Sbjct: 197 AGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLE 256

Query: 261 ALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYD--LAQGLPIQFGRYLEIV 318
           +LGHVFFYFLRG LPWQGLKAPNNK KYEKIG  K+  N  +  L+  +P QF  YL+  
Sbjct: 257 SLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYT 316

Query: 319 RNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKLNGGRGWDLAINKKPNLHGYGHP 378
           R+L F+E PDY+    L+   L   G   DG YDWM LN G GWD+ +NK+ NLHGYG+ 
Sbjct: 317 RSLKFDEDPDYDYLISLMDGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNA 376

Query: 379 NP 380
            P
Sbjct: 377 QP 378

>KLLA0D03168g 265761..267278 some similarities with sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25 casein kinase I,
           ser/thr/tyr protein kinase, hypothetical start
          Length = 505

 Score =  327 bits (838), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/293 (53%), Positives = 206/293 (70%), Gaps = 6/293 (2%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGKEGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 186 IYRDIKPDNFL--VGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL  VGR G    + +H+IDFG++K+YRD ++  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFRSHNHIPYRENKNLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK    V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCITVEQL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
            QGLP++F  Y+   RNL F+E PDY     L       L    D  +DW  L
Sbjct: 241 CQGLPMEFVEYMRYCRNLRFDERPDYMYLARLFKDLFIKLEYHNDHLFDWTML 293

>Kwal_56.24064
          Length = 475

 Score =  325 bits (832), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 161/297 (54%), Positives = 206/297 (69%), Gaps = 14/297 (4%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  Y+IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 186 IYRDIKPDNFL--VGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL  VGR G    + +H+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   NV  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCINVEQL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGE----YDWMKL 356
             GLP++F  Y+   RNL F+E PDY    + L     DLG   D      +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDY----LYLARLFKDLGIKLDYHNDHLFDWTML 293

>AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH]
           complement(272431..273867) [1437 bp, 478 aa]
          Length = 478

 Score =  325 bits (832), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/293 (53%), Positives = 207/293 (70%), Gaps = 6/293 (2%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK EP +T+ PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRTKHPQLDYESRVYKYLSGGIG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+RKFS+KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSLKTVMMLALQMICRIQYIHGRSF 124

Query: 186 IYRDIKPDNFL--VGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL  VGR G    + +H+IDFG++K++RD +T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKFRDFRTHNHIPYRENKNLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGL+A   +QKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRATTKRQKYDRIMEKKLCISVEQL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
             GLPI+F  Y+   RNL F+E PDY     L       L    D  +DW  L
Sbjct: 241 CVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDLSIKLEYHNDHLFDWTML 293

>CAGL0H03553g complement(328668..330155) highly similar to sp|P29295
           Saccharomyces cerevisiae YPL204w HRR25, start by
           similarity
          Length = 495

 Score =  323 bits (827), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 204/293 (69%), Gaps = 6/293 (2%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+RKFS KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRVQYIHGRSF 124

Query: 186 IYRDIKPDNFL--VGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL  VGR G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
             GLP++F  Y+   RNL F+E PDY     L       L    D  +DW  L
Sbjct: 241 CAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_720.24
          Length = 473

 Score =  321 bits (822), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 204/293 (69%), Gaps = 6/293 (2%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGVG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+RKF+ KTV+ +A+QMI  ++ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTFKTVIMLALQMICRVQYIHGRSF 124

Query: 186 IYRDIKPDNFLVG--RPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL+G  R G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGTGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG++  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYMLVYFCKGSLPWQGLKATTKKQKYDRILEKKLCISVETL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
             GLPI+F  Y+   RNL F+E PDY     L       L    D  +DW  L
Sbjct: 241 CAGLPIEFADYMNYCRNLKFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>Sklu_1892.3 YPL204W, Contig c1892 5770-7194
          Length = 474

 Score =  321 bits (822), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 157/293 (53%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R YK L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYKYLSGGIG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+RKFS KTV+ +A+QMI  I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKTVIMLALQMICRIQYIHGRSF 124

Query: 186 IYRDIKPDNFL--VGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL  VGR G    + +H+IDFG++K+YRD  T  HIPYRE K+L+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFSTHHHIPYRENKNLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   +QKY++I EKK   +V  L
Sbjct: 181 SLNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKRQKYDRIMEKKLCISVEQL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
             GLP++F  Y+   RNL F+E PDY     L       L    D  +DW  L
Sbjct: 241 CAGLPMEFVEYMRYCRNLRFDERPDYLYLARLFKDLSIKLEYHNDHLFDWTML 293

>YPL204W (HRR25) [5244] chr16 (164275..165759) Casein kinase I
           (serine/threonine/tyrosine protein kinase) involved in
           DNA repair and meiosis [1485 bp, 494 aa]
          Length = 494

 Score =  318 bits (816), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/293 (52%), Positives = 203/293 (69%), Gaps = 6/293 (2%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           VG  ++IG+KIG GSFG ++ GTN+I+G  VAIK E  ++  PQL  E R Y+ L+G  G
Sbjct: 5   VGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSRHPQLDYESRVYRYLSGGVG 64

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           +P   +FG+EG +N +VIDLLGPSLEDLF++C+R+FS KTV+ +A+QM   I+ +H    
Sbjct: 65  IPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIHGRSF 124

Query: 186 IYRDIKPDNFL--VGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           I+RDIKPDNFL  VGR G    + +H+IDFG++K+YRD  T +HIPYRE KSL+GTARY 
Sbjct: 125 IHRDIKPDNFLMGVGRRG----STVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA 180

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           S+NTHLG EQSRRDD+E+LG+V  YF +G LPWQGLKA   KQKY++I EKK   +V  L
Sbjct: 181 SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETL 240

Query: 304 AQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMKL 356
             GLP++F  Y+   +NL F+E PDY     L       L    D  +DW  L
Sbjct: 241 CSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTML 293

>Scas_690.12
          Length = 488

 Score =  269 bits (687), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 132/289 (45%), Positives = 191/289 (66%), Gaps = 3/289 (1%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILT-GTP 124
           VG  Y++G++IG GSFG ++ G ++I+G  +AIK E  +T  PQL+ E R Y  ++ G+ 
Sbjct: 5   VGKRYRVGRRIGGGSFGEIYHGIDLISGEEIAIKLESSETRHPQLEYESRVYNFVSDGSM 64

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHD 184
           G+P    F +   ++ LV+DLLGPSLEDLF++C+R FS KT+  +A QMI  +  +H   
Sbjct: 65  GIPNIRMFERGFGYSALVMDLLGPSLEDLFNYCHRSFSYKTIFMLAWQMIARVAYVHGKS 124

Query: 185 LIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 244
            ++RDIKP+NFL+G      AN ++LIDFG++K+YRD  + +H P +  KSL GTARY S
Sbjct: 125 FLHRDIKPENFLLGTG--RRANIVNLIDFGLSKKYRDFNSHRHNPRKTHKSLVGTARYAS 182

Query: 245 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLA 304
           +NTH G EQSRRDD+E+LG+V  YF +G LPWQGL+A   KQKY++I ++K       L 
Sbjct: 183 VNTHFGIEQSRRDDLESLGYVLVYFAKGHLPWQGLRATTKKQKYDRILQRKLCITTDILC 242

Query: 305 QGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDW 353
           +GLP QF  Y+  VR+L +++ PDY     L  +  + L  + D  +DW
Sbjct: 243 EGLPSQFVAYMGYVRSLQYDQRPDYVYLEQLFKNLSEQLNYTNDYLFDW 291

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 112/237 (47%), Gaps = 31/237 (13%)

Query: 63   STIVGLHYKIGKK--IGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEY 114
            S+I  L  +  K+  IG GSFG ++   N+  G  +A+K       +  K   P LK+E 
Sbjct: 1250 SSISNLSIRWQKRSFIGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEM 1309

Query: 115  RTYKILTGTPGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCNRKFSVKTVVQV- 169
            R  +IL   P + Q  Y+G E +H    NI +    G SL  L +  + +   + V QV 
Sbjct: 1310 RVMEILNH-PNIVQ--YYGVE-VHRDKVNIFMEFCEGSSLASLLE--HGRIEDEMVTQVY 1363

Query: 170  AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIP 229
             +Q++  +  LH   +++RDIKP+N L+ R G      I  +DFG AK      +K+   
Sbjct: 1364 TLQLLEGLACLHQSGVVHRDIKPENILLDRNG-----VIKYVDFGAAKLIAKNGSKRISL 1418

Query: 230  YREKKS-----LSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 279
                KS     + GT  YM+  T  G+   +   DD+ +LG V    + G+ PW  L
Sbjct: 1419 DANNKSTGGKDMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWANL 1475

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 101/213 (47%), Gaps = 18/213 (8%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT----EAPQLKDEYRTYKILTGTPG 125
           Y  GK +G G+FGV+ +  N      VAIK   ++     E   L DE    + L     
Sbjct: 56  YIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDELSILQKLDHPNI 115

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMITLIEDLHAH 183
           V    +F  E      ++  L    E LFD   +K  F+    V++ VQM+T +E +H+ 
Sbjct: 116 VKFKDWF--ESREKFYIVTQLATGGE-LFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQ 172

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           ++++RD+KP+N L   P   D +++ + DFG+AKQ     ++  + +R     +G+  Y+
Sbjct: 173 NVVHRDLKPENVLYLDPS--DESQLVISDFGIAKQL---SSESQLIHRA----AGSMGYV 223

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           +          +  D+ +LG + +  L G  P+
Sbjct: 224 APEVLTTSGHGKPCDIWSLGVITYTLLCGYSPF 256

>Scas_618.8
          Length = 427

 Score = 67.8 bits (164), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 106/219 (48%), Gaps = 22/219 (10%)

Query: 63  STIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEYRT 116
           S +    Y+ GK +G GSFGV+ E T   N   VAIK       E  + +   L DE   
Sbjct: 20  SKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTI 79

Query: 117 YKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMI 174
            K L     V    +F  E    I ++  L    E LFD   +K  FS    V++ +Q++
Sbjct: 80  LKKLHHPNIVEFKNWF--ETDDKIYIVTQLATGGE-LFDRIIKKGRFSEDDAVKILIQIL 136

Query: 175 TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKK 234
           + +E +H+ D+++RD+KP+N L      ++ +++ + DFG+AK+    K  + + ++   
Sbjct: 137 SAVEYIHSRDIVHRDLKPENLLY--LTEKEDSELVIADFGIAKEL---KKGEQLIFKAAG 191

Query: 235 SLSGTA-RYMSINTHLGREQSRRDDMEALGHVFFYFLRG 272
           SL   A   ++++ H      +  D+ ++G + +  L G
Sbjct: 192 SLGYVAPEVLTVDGH-----GKPCDIWSIGVITYTLLSG 225

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 108/232 (46%), Gaps = 32/232 (13%)

Query: 66   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVA---IKFEPRKT---EAPQLKDEYRTYKI 119
            V + ++    IG GSFG ++   N+  G  +A   IKF  RKT     P ++DE    ++
Sbjct: 1187 VSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEM 1246

Query: 120  LTGTPGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCNRKFSVKTVVQV-AVQMI 174
            L   P V Q  Y+G E +H    NI +    G SL  L    + +   + V QV ++QM+
Sbjct: 1247 LNH-PNVVQ--YYGVE-VHRDRVNIFMEYCEGGSLASLL--AHGRIEDEMVTQVYSLQML 1300

Query: 175  TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTK-----QHIP 229
              +  LH   + +RDIKP+N L+   G      I  +DFG AK      +K     QH+ 
Sbjct: 1301 EGLAYLHESGVDHRDIKPENILLDFNG-----IIKYVDFGAAKVLASNGSKKLNLEQHM- 1354

Query: 230  YREKKSLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 279
              E + + GT  YMS     G    +   DD+ +LG V    + G+ PW  L
Sbjct: 1355 --EGEKMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 120/272 (44%), Gaps = 49/272 (18%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILT-----GTP 124
           +K G+++G+GS+  +   T   +G   A+K   ++    Q K +Y T + L      GT 
Sbjct: 125 FKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTK 184

Query: 125 GVPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCNRKFSVKTVVQVAVQMITL 176
           G+ + ++  Q+      ++      D LG       L + C R +        A Q+I  
Sbjct: 185 GIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYY--------ASQIIDA 236

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQY-RDPK-TKQHIP---- 229
           ++ LH   +I+RDIKP+N L+      D N K+ L DFG AK    +P  T    P    
Sbjct: 237 VDSLHNIGIIHRDIKPENILL------DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDL 290

Query: 230 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYE 289
           Y + KS  GTA Y+S           R D+ A G + +  L G+ P+   KA N    ++
Sbjct: 291 YAKSKSFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPF---KAANEYLTFQ 347

Query: 290 KIGEKKRTTNVYDLAQGLPIQFGRYLEIVRNL 321
           K+ + +     Y    G P       +IV++L
Sbjct: 348 KVMKIQ-----YAFTAGFP-------QIVKDL 367

>Kwal_56.24059
          Length = 353

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 111/233 (47%), Gaps = 28/233 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILTGT 123
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 43  FQILRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKEQVIRMKQIEHTNDERRMLK-LVDH 100

Query: 124 PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
           P + + +   Q+  +  +V+D + G  L  L    +++F        A ++I  +E LH+
Sbjct: 101 PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHS 159

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           HD+IYRD+KP+N L+ R GH     I + DFG AK+  D  T          +L GT  Y
Sbjct: 160 HDIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 204

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 295
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 205 IAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYD---ATPMKTYEKILQGK 254

>Kwal_23.6325
          Length = 1542

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 111/232 (47%), Gaps = 29/232 (12%)

Query: 66   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVA---IKFEPRKTEA---PQLKDEYRTYKI 119
            V + ++  + +G G+FG +F   N+  G  +A   IK + RK+     P +K+E    ++
Sbjct: 1245 VSIRWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEM 1304

Query: 120  LTGTPGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCNRKFSVKTVVQV-AVQMI 174
            L   P V Q  Y+G E +H    N+ +    G SL  L +  + +   + V Q+ A+QM+
Sbjct: 1305 LNH-PNVVQ--YYGVE-VHRDKVNLFMEYCEGGSLAQLLE--HGRIEDEMVTQIYALQML 1358

Query: 175  TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKK 234
              +  LH   +++RDIKP+N L+   G      I  +DFG A+      TK      E K
Sbjct: 1359 EGLAYLHQSSVVHRDIKPENILLDFNG-----VIKYVDFGAARSLAANGTKAPNVGAEGK 1413

Query: 235  -----SLSGTARYMSINTHLGREQSR--RDDMEALGHVFFYFLRGQLPWQGL 279
                 S+ GT  YMS  +  G ++ +    D+ +LG V    + G+ PW  L
Sbjct: 1414 ADGVNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNL 1465

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 112/233 (48%), Gaps = 28/233 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILTGT 123
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVKMKQVEHTNDERRMLK-LVEH 127

Query: 124 PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
           P + + +   Q+  +  +V+D + G  L  L    +++F        A ++I  +E LHA
Sbjct: 128 PFLIRMWGTFQDARNIFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVILALEYLHA 186

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           H++IYRD+KP+N L+ R GH     I + DFG AK+       Q + +    +L GT  Y
Sbjct: 187 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV------QTVTW----TLCGTPDY 231

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 295
           ++      +  ++  D  +LG + +  L G  P+         + YEKI + K
Sbjct: 232 IAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKILQGK 281

>Scas_660.20
          Length = 957

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 105/231 (45%), Gaps = 21/231 (9%)

Query: 70  YKIGKKIGEGSFGVLFEG-----TNMINGLPVAIKFEP-RKTEAPQLKDEYRTYKILTGT 123
           +   +++G GS+  +++      T  I  + V  K    ++++   +  E  T  +L   
Sbjct: 11  FIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKA 70

Query: 124 --PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDL 180
             PG+ + YY   +  +   V+D L G  L  L     + FS        VQ++  +E +
Sbjct: 71  HHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKM-KTFSEVWSKHFTVQLVDTLEFI 129

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           H+  +I+RD+KP+N L+ R G     K+ + DFG A          +   +   S  GTA
Sbjct: 130 HSQGVIHRDLKPENVLLDRDG-----KLMITDFGAAYTTTAGNNDAN---KSSSSFVGTA 181

Query: 241 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
            Y+S    L  + S   D+ ALG + F F+ G  P++G    N  + +EKI
Sbjct: 182 EYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRG---ENELKTFEKI 229

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 108/250 (43%), Gaps = 25/250 (10%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKILTGT- 123
           +K G+ +G+GS+  +   T + +G   A K   ++    Q K +Y      T + L  + 
Sbjct: 200 FKFGEALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSR 259

Query: 124 -PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDL 180
            PGV + Y+  Q+   N+  +    P+  D      R    S +       Q++  I  L
Sbjct: 260 VPGVIKLYFTFQDEA-NLYFLLEYAPN-GDFLSVMKRFGTLSEECTKYYGAQILDAIHHL 317

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY-RDPKTKQHIPYREKKSLSGT 239
           H   +I+RD+KP+N L+     +   KI L DFG AK   R+ + K +      KS  GT
Sbjct: 318 HKQGIIHRDVKPENILL-----DKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGT 372

Query: 240 ARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTN 299
           A Y+S           R D+ A G + F  + G+ P+   KA N    ++K+   +    
Sbjct: 373 AEYVSPELLNDNYVDSRCDIWAFGCILFQMVAGKPPF---KATNEYLTFQKVMRVQ---- 425

Query: 300 VYDLAQGLPI 309
            Y    G P+
Sbjct: 426 -YAFTAGFPM 434

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 110/229 (48%), Gaps = 28/229 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILTGT 123
           ++I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K++   
Sbjct: 36  FQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVL-KKQQVIRMKQIEHTNDERRMLKVVEH- 93

Query: 124 PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
           P + + +   Q+  +  +V+D + G  L  L    +++F        A ++   +E LHA
Sbjct: 94  PFLIRMWGTFQDARNLFIVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHA 152

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           H++IYRD+KP+N L+ R GH     I + DFG AK+  D  T          +L GT  Y
Sbjct: 153 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGTPDY 197

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           ++      +  ++  D  +LG + F  L G  P+  +      + YEKI
Sbjct: 198 IAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV---TPIKTYEKI 243

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 121/266 (45%), Gaps = 43/266 (16%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILTGTP 124
           +K G+ +G+GS+  +   T+  +G   A+K     +  R+ +   +  E  T + L  + 
Sbjct: 182 FKFGEILGDGSYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNNSR 241

Query: 125 GVPQAYYFGQEGLHNILVI------DLLG--PSLEDLFDWCNRKFSVKTVVQVAVQMITL 176
           GV + Y+  Q+      ++      D L        L + C R +          QM+  
Sbjct: 242 GVIKLYFTFQDEASLYFLLEYAPNGDFLSVMKKFGSLNEECCRYY--------GAQMLDA 293

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY-RDPKTKQHIPYREKKS 235
           I+ +H + +++RDIKP+N L+     ++  K+ L DFG AK   RD K+  ++  ++ +S
Sbjct: 294 IDFIHKNGVVHRDIKPENILL-----DEHMKVKLTDFGTAKLLDRDEKSGYNL-LKKSRS 347

Query: 236 LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 295
             GTA Y+S         + + D+ A G + +  + G+ P+   KA N    ++K+ + +
Sbjct: 348 FVGTAEYVSPELLNDNCVNYKCDIWAFGCILYQMIAGKPPF---KATNEYLTFQKVMKVQ 404

Query: 296 RTTNVYDLAQGLPIQFGRYLEIVRNL 321
                Y    G P+       ++R+L
Sbjct: 405 -----YAFTAGFPL-------VIRDL 418

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 99/230 (43%), Gaps = 22/230 (9%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILT-------G 122
           +   +++G GS+  +++  +   G   AIK   +K    + K +Y T +  T        
Sbjct: 10  FSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLLAHGN 69

Query: 123 TPGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
            PG+ + YY   +  +   V+D   G  L  L     R F+         Q+I  +E +H
Sbjct: 70  HPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGR-FNEAWTKHFMCQLIDALEYIH 128

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
              +++RD+KP+N L+   G     K+ + DFG+A                  S  GTA 
Sbjct: 129 GCKVVHRDLKPENLLLSSEG-----KLMITDFGVASNLAATDN-----LSSTSSFVGTAE 178

Query: 242 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           Y+S    L  + +   D+ A+G + + F +G  P++G    N    +EKI
Sbjct: 179 YVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRG---ENELAAFEKI 225

>Kwal_33.13846
          Length = 375

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGTP 124
           + I + +G GSFG +    +  NG   A+K   ++T     +     DE R   +++  P
Sbjct: 65  FHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRMLSVVSH-P 123

Query: 125 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            + + +   Q+  H  +++D + G  L  L     R F        A ++   +E LHA 
Sbjct: 124 FIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALEYLHAQ 182

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           D+IYRD+KP+N L+ + GH     + + DFG AK   D      + Y    +L GT  Y+
Sbjct: 183 DIIYRDLKPENVLLDKNGH-----VKITDFGFAKFVPD------VTY----TLCGTPDYI 227

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           +      +  ++  D  + G + F  L G  P+      N  + YE I
Sbjct: 228 APEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYD---SNTMKTYENI 272

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 109/243 (44%), Gaps = 36/243 (14%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMI---NGLP---VAIKFEPRKTEAPQLKDEYRTYKILT-- 121
           +   +++G GS+  +++  +     +GLP    AIK   +K    + K +Y T +  T  
Sbjct: 10  FIFKEQLGHGSYSTVYKALDKARNNSGLPQHFYAIKVCSKKHIIRENKVKYVTIEKNTLN 69

Query: 122 -----GTPGVPQAYY--FGQEGLHNILVIDLLGPSLEDL-----FDWCNRKFSVKTVVQV 169
                  PG+ + YY    QE L+ +L     G  L  L     FD    K         
Sbjct: 70  LLAQGNNPGIVKLYYTFHDQENLYFVLDYAPGGELLHLLQRYGTFDEVWSK-------HF 122

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIP 229
             Q++ ++E +H+  +I+RD+KP+N L+ + G     ++ + DFG A       T     
Sbjct: 123 MCQLVDVVEYIHSKGVIHRDLKPENVLLSKDG-----RLMVTDFGAASVVTTDGTSSDNS 177

Query: 230 YREK-KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
             E+  S  GTA Y+S    L  +     D+ ALG + + F++G  P++G    N  Q +
Sbjct: 178 VSERAASFVGTAEYVSPELLLNNQCFFSSDIWALGCILYQFMQGSPPFRG---ENELQTF 234

Query: 289 EKI 291
           EKI
Sbjct: 235 EKI 237

>Kwal_26.7355
          Length = 1446

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 105/227 (46%), Gaps = 37/227 (16%)

Query: 73   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 118
            G+ IG+GSFG +F G N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1149 GEMIGKGSFGSVFLGLNVTTGEMIAVK----QVEVPRYGSQDETTLSVLEALRSEVATLK 1204

Query: 119  ILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIE 178
             L  T  V    +  +  ++++ +  + G S+  L      KF    +  +AVQ++  + 
Sbjct: 1205 DLDHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLIRLYG-KFDENLIRFLAVQVLRGLS 1263

Query: 179  DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLI-DFGMAKQYRDPKTKQHIPYREKKSLS 237
             LH+  +++RD+K DN L+      D + I  I DFG++K+        +I      ++ 
Sbjct: 1264 YLHSKKILHRDMKADNLLL------DVDGICKISDFGISKK------SNNIYSNSDMTMR 1311

Query: 238  GTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
            GT  +M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1312 GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1356

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 103/228 (45%), Gaps = 26/228 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEP-----RKTEAPQLKDEYRTYKILTGTP 124
           ++I + +G GSFG +    ++ NG   AIK        R  +     DE R  K L   P
Sbjct: 62  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLK-LVEHP 120

Query: 125 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            + + +   Q+  +  +V+D + G  L  L    +++F        A ++   +E LH+H
Sbjct: 121 FLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLALEYLHSH 179

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           ++IYRD+KP+N L+ R GH     I + DFG AK+                +L GT  Y+
Sbjct: 180 NIIYRDLKPENILLDRNGH-----IKITDFGFAKEV----------ITVTWTLCGTPDYI 224

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           +      +  ++  D  +LG + F  L G  P+  +      + YEKI
Sbjct: 225 APEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTP---MKTYEKI 269

>Kwal_56.22693
          Length = 984

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 133/306 (43%), Gaps = 44/306 (14%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILTGTP 124
           ++ G+ +G+GS+  +    +  +G   A+K     +  R+ +   +  E  T + L    
Sbjct: 158 FRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGR 217

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKF---SVKTVVQVAVQMITLIEDLH 181
           GV + Y+  Q+      +++   P+ +  F    +KF   S +  V  + Q++  I+ LH
Sbjct: 218 GVIKLYFTFQDEASLYFLLEY-APNGD--FLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREK-KSLSGTA 240
              +++RDIKP+N L+ +       K+ L DFG A+     +T Q     E+ KS  GTA
Sbjct: 275 HKGIVHRDIKPENILLDK-----DMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTA 329

Query: 241 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNV 300
            Y+S           + D+ A G + F  + G+ P+   KA N    ++K+ + +     
Sbjct: 330 EYVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKVMKVQ----- 381

Query: 301 YDLAQGLPIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEYDWMK---LN 357
           Y    G P+       ++R+L           ++L+ S    L  S   ++ + K    N
Sbjct: 382 YAFTAGFPL-------VIRDLI---------KKILVKSPEQRLDASQIKKHHFFKDVNFN 425

Query: 358 GGRGWD 363
            G  WD
Sbjct: 426 DGSVWD 431

>Kwal_0.96
          Length = 427

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 99/215 (46%), Gaps = 20/215 (9%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------TEAPQLKDEYRTYKILTGT 123
           Y  GK +G GSFGV+ +   + +G  VAIK   +K       E   L DE    + L   
Sbjct: 46  YIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELSILQKLDHP 105

Query: 124 PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLH 181
             V    +F  E      ++  L    E LFD   +  KF+ +  V++  Q++  +E LH
Sbjct: 106 NIVKFKDWF--ESKDKFYIVTQLATGGE-LFDRILKQGKFTEEDAVRIVYQILKAVEYLH 162

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
           + ++++RD+KP+N L      +  +++ L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLYLTEAAD--SQLVLGDFGIAKELKNDDELIH-------KAAGSMG 213

Query: 242 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           Y++          +  D+ +LG V +  L G  P+
Sbjct: 214 YVAPEVVTTSGHGKPCDIWSLGVVTYTLLCGYSPF 248

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 104/229 (45%), Gaps = 41/229 (17%)

Query: 73   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 118
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              LK E  T K
Sbjct: 1154 GEMIGKGSFGAVYLSLNITTGEMMAVK----QVEVPKYGTQNELVKDMVEALKSEVATLK 1209

Query: 119  ILTGTPGVPQAYYFGQE---GLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMIT 175
             L     V    Y G E    ++++ +  + G S+  L     R F  K +  +  Q+++
Sbjct: 1210 DLDHLNIV---QYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGR-FDEKLIRHLNTQVLS 1265

Query: 176  LIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKS 235
             ++ LH+  +++RD+K DN L+   G        + DFG++K+ ++  +   +  R    
Sbjct: 1266 GLKYLHSKGILHRDMKADNLLLDEDGI-----CKISDFGISKKSKNIYSNSDMTMR---- 1316

Query: 236  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
              GT  +M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1317 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1361

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 98/215 (45%), Gaps = 20/215 (9%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------TEAPQLKDEYRTYKILTGT 123
           Y  GK +G GSFGV+ +   +  G  VA+K   +K       +   L DE    + L   
Sbjct: 46  YIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYDELMILQKLNHP 105

Query: 124 PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMITLIEDLH 181
             V    +F  E      ++  L    E LFD   +K  F+    V++ VQ++  +E LH
Sbjct: 106 NIVKFKDWF--ESKEKFYIVTQLATGGE-LFDRILQKGKFTEVDAVKIVVQILKAVEYLH 162

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
           + ++++RD+KP+N L       D +++ L DFG+AK+ ++     H         +G+  
Sbjct: 163 SRNIVHRDLKPENLLY--LDKSDNSQLVLGDFGIAKELKNDGDLIH-------KAAGSMG 213

Query: 242 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           Y++          +  D+ ++G + +  L G  P+
Sbjct: 214 YVAPEVLTSNGHGKPCDIWSIGVITYTLLCGYSPF 248

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 125/300 (41%), Gaps = 48/300 (16%)

Query: 10  ANTAMAIHNLTNTTNTPMQSASNLRLLN----------GNLPMTPANQTPASTASPPTSM 59
           AN  M + + +   N    SA+N+RL N          G L ++  +  P+     P S+
Sbjct: 341 ANQDMHLDSFSLPLNLKFDSAANIRLYNHQWVSLETGLGRLNIS-VDYKPSKNK--PLSI 397

Query: 60  RDDSTIVGLHYKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEY 114
            D        + + K IG+GSFG + +     TN I  L    K +   K+E      E 
Sbjct: 398 DD--------FDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAER 449

Query: 115 RTYKILTGTPGVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAV 171
                +     VP  + F   E L+ +L     G    +LF    +  +F +        
Sbjct: 450 TVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGG----ELFYHLQKEGRFDLSRARFYTA 505

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYR 231
           +++  +E LH+ ++IYRD+KP+N L+   GH     I L DFG+ K     + K +    
Sbjct: 506 ELLCALETLHSLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMQDQDKTN---- 556

Query: 232 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
              +  GT  Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 557 ---TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 610

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 98/230 (42%), Gaps = 27/230 (11%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTP 124
           + + K IG+GSFG + +     T  I  L    K +   K+E      E      +    
Sbjct: 370 FDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPF 429

Query: 125 GVPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLH 181
            VP  + F  QE L+ +L     G    +LF    R  +F +      A +++  ++ LH
Sbjct: 430 IVPLKFSFQSQEKLYLVLACINGG----ELFYHLQREGRFDLSRSRFYAAELLCALDTLH 485

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
             D+IYRD+KP+N L+   GH     I L DFG+ K     + K         +  GT  
Sbjct: 486 KMDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDEDKTD-------TFCGTPE 533

Query: 242 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 534 YLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVP---KMYKKI 580

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 114/255 (44%), Gaps = 21/255 (8%)

Query: 4   HQNSTTANTAMAIHNLTNTTNTPMQSASNLRLLNG--NLPMTPANQTPASTASPPTSMRD 61
           ++NS   +   +I N   T N+P  + SNL + N   NL  + ++  P S     TS   
Sbjct: 714 NENSYNQHEHNSITNTLQTINSPTFNHSNLSVSNSHVNLSNSVSSNQPLSPLLLATSQMK 773

Query: 62  DSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRT 116
             T     Y I K I +G++G ++     + G   AIK   +     K +   +K E   
Sbjct: 774 PLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAI 833

Query: 117 YKILTGTPGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDW--CNRKFSVKTVVQVAVQM 173
             + +  P V + Y   Q   +  LV++ L G  L  L     C      + V Q   ++
Sbjct: 834 MMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGC---LPDEWVKQYLSEI 890

Query: 174 ITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREK 233
           I  +ED+H + +I+ D+KP+N L+   GH     + L DFG+++     K  +HIP  + 
Sbjct: 891 IIGVEDMHNNGIIHHDLKPENLLIDVSGH-----LKLTDFGLSRAGL-VKRHRHIP--KP 942

Query: 234 KSLSGTARYMSINTH 248
            SLS      +I++H
Sbjct: 943 ISLSNADTRSNIDSH 957

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 126/300 (42%), Gaps = 55/300 (18%)

Query: 45  ANQTPASTASPPTSMRDDSTI-VGLH-YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEP 102
           A Q    + +P T  R+   I  G+  +K G+ +G+G++  +   T   +G   A+K   
Sbjct: 155 AAQIVKESVNPKTGEREKKIIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLN 214

Query: 103 RKTEAPQLKDEY-----RTYKILTGTPGVPQAYYFGQE--GLHNIL----------VIDL 145
           ++    Q K +Y        + L  + G+ + ++  Q+   L+ +L          V+  
Sbjct: 215 KEYLIKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKK 274

Query: 146 LGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDA 205
            G   ED    C R +S         Q+I  I+ LH+  +I+RDIKP+N L+ +      
Sbjct: 275 YGSLSED----CTRYYSA--------QIIDGIKYLHSKGIIHRDIKPENILLDKDM---- 318

Query: 206 NKIHLIDFGMAKQYRDPKTKQHIP----YREKKSLSGTARYMSINTHLGREQSRRDDMEA 261
            K+ + DFG AK        +  P        KS  GTA Y+S           R D+ A
Sbjct: 319 -KVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSYVDARCDIWA 377

Query: 262 LGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQGLPIQFGRYLEIVRNL 321
            G + F  + G+ P+   KA N    ++K+ + +     Y    G P+       +VR+L
Sbjct: 378 FGCMVFQMIAGKPPF---KATNEYLTFQKVMKVQ-----YAFTAGFPV-------VVRDL 422

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 99/212 (46%), Gaps = 17/212 (8%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGT---PG 125
           ++IGK +G+G FG ++   +   GL  A+K  E ++     ++ ++R    + G+     
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKHKN 159

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
           + Q Y F  +     L+++ +       F   N   +         QM   ++ +H+ ++
Sbjct: 160 LTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSKNI 219

Query: 186 IYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI 245
           ++RDIKP+N L+G       N I L DFG +    D +        ++K+L GT  Y+S 
Sbjct: 220 LHRDIKPENILIGF-----NNTIKLTDFGWSVYNEDGQ--------KRKTLCGTIDYLSP 266

Query: 246 NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
                RE + + D+ ALG + +  L G  P++
Sbjct: 267 ELIKSREYNNKVDVWALGVLTYELLVGSPPFE 298

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 103/234 (44%), Gaps = 26/234 (11%)

Query: 64  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYK 118
           +IV  +++I + +G GSFG +    +  NG   A+K        R  +     DE     
Sbjct: 81  SIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLS 140

Query: 119 ILTGTPGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLI 177
           I+T  P + + +   Q+     +++D + G  L  L     R F        A ++   +
Sbjct: 141 IVTH-PFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLAL 198

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 237
           E LH+ D+IYRD+KP+N L+ + GH     I + DFG AK   D      + Y    +L 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLC 243

Query: 238 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           GT  Y++      +  ++  D  + G + +  L G  P+      N  + YEKI
Sbjct: 244 GTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYD---SNTMKTYEKI 294

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 119/275 (43%), Gaps = 34/275 (12%)

Query: 36  LNGNLPMTPANQTPASTASPPTSMRDDSTIVGLHYKI-GKKIGEGSFGVLFEGTNMINGL 94
           +  NL  T    +P  T+S  +SM  + T +   + I  + +G+G+F  + +      G 
Sbjct: 163 IRSNLKNTSKIASPGLTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGK 222

Query: 95  PVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVPQAYYFGQEGLHNILVIDLLGPSLED 152
             A+K   ++     +    R  ++L     P + +   F ++     +V++ +     D
Sbjct: 223 TFAVKIISKRKVIGNMDGVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGG--D 280

Query: 153 LFDWCNRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL 210
           L D+     +V      +++ Q++T I+ +H+  + +RD+KPDN L+ +   +D   + +
Sbjct: 281 LMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQ---DDPVLVKI 337

Query: 211 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR-------------EQSRRD 257
            DFG+AK   +            K+  GT  Y++     G+             E S   
Sbjct: 338 TDFGLAKVQGNGSF--------MKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLV 389

Query: 258 DMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 292
           DM ++G + +  L G LP+ G       Q Y++IG
Sbjct: 390 DMWSMGCLVYVILTGHLPFSG---STQDQLYKQIG 421

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 107/251 (42%), Gaps = 35/251 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------LKDEYRTYKILT 121
           YK+G+ I  GSF V+    +   G  VA+K+  +  + P+        + +EY   + L 
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHNEYAILRRLG 66

Query: 122 GTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVV----QVAVQMITLI 177
               + Q   F ++    + V++    +  DL+D+        T+         Q+ + I
Sbjct: 67  THRNICQLLDFYEDADTYVFVLEYC--AYGDLYDFIKAIRERPTMRINFHSFLFQLCSAI 124

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 237
              H+ D+ +RDIKP+N L+     +D  ++ L DFG+++          I    K    
Sbjct: 125 SYCHSKDVSHRDIKPENVLM-----DDRGQVKLTDFGLSQ----------IGSVSKDYCI 169

Query: 238 GTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLK--APNNKQKYEK-IG 292
           GT +Y++  T L RE   +   D  +LG   F  + G  P++     AP     +++ I 
Sbjct: 170 GTEKYLAPETFL-REYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFIR 228

Query: 293 EKKRTTNVYDL 303
           +  R    Y L
Sbjct: 229 DPHRFVESYYL 239

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 101/228 (44%), Gaps = 26/228 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGTP 124
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R   I++  P
Sbjct: 152 FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSH-P 210

Query: 125 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            + + +   Q+  H  +V+D + G  L  L     R F        A ++   +E LH+ 
Sbjct: 211 FIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALEYLHSK 269

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           ++IYRD+KP+N L+ + GH     I + DFG AK   D      + Y    +L GT  Y+
Sbjct: 270 EIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------VTY----TLCGTPDYI 314

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 315 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---ANTMKTYEHI 359

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 104/229 (45%), Gaps = 28/229 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILTGT 123
           + I + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 51  FHIMRTLGTGSFGRVHLVRSVHNGRYYAIKV-LKKAQVVKMKQIEHTNDERRMLK-LVEH 108

Query: 124 PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
           P + + +   Q+  +  +V+D + G  L  L    +++F        A ++   +E LH 
Sbjct: 109 PFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLR-KSQRFPNPVAKFYAAEVTLALEYLHF 167

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           H++IYRD+KP+N L+ R GH     I + DFG AK+                +L GT  Y
Sbjct: 168 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEVETVTW----------TLCGTPDY 212

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           ++      +  ++  D  +LG + +  L G  P+         + YEKI
Sbjct: 213 IAPEVIATKPYNKSVDWWSLGVLIYEMLAGYTPFYD---TTPMKTYEKI 258

>Scas_502.2
          Length = 1116

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 114/265 (43%), Gaps = 40/265 (15%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILTGTP 124
           +K G+ +G+G++  +   T+  +G   A+K     +  R+ +   +  E    + L  + 
Sbjct: 174 FKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSR 233

Query: 125 GVPQAYYFGQEGLHNILVI------DLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIE 178
            + + ++  Q+      ++      DLL  SL   F   N +           Q+I  I+
Sbjct: 234 SIIRLFFTFQDEASLYFLLEYAPNGDLL--SLMKKFGSLNEE----CCCYYGAQIIDAIK 287

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK--QYRDPKTKQHIPYREKKSL 236
            +H+  +I+RDIKP+N L+ +       K+ + DFG AK    + P T   +  R  KS 
Sbjct: 288 FMHSKGIIHRDIKPENILLDKDM-----KVKITDFGTAKILDNKPPGTSYDLLTRS-KSF 341

Query: 237 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKR 296
            GTA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+ + + 
Sbjct: 342 VGTAEYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPF---KATNEYLTFQKVMKVQ- 397

Query: 297 TTNVYDLAQGLPIQFGRYLEIVRNL 321
               Y    G P        +VR+L
Sbjct: 398 ----YAFTAGFPT-------VVRDL 411

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 120/276 (43%), Gaps = 45/276 (16%)

Query: 73   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 118
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQNEAILSTVEALRSEVSTLK 1233

Query: 119  ILTGTPGVPQAYYFGQEGLHNILVIDL---LGPSLEDLFDWCNRKFSVKTVVQVAVQMIT 175
             L     V    Y G E  +NI  + L    G S+  L     R F    +  +  Q++ 
Sbjct: 1234 DLDHLNIV---QYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLK 1289

Query: 176  LIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKS 235
             +  LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R    
Sbjct: 1290 GLAYLHSKGILHRDMKADNLLLDQDGI-----CKISDFGISRKSKDIYSNSDMTMR---- 1340

Query: 236  LSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 292
              GT  +M+   ++T  G   S + D+ +LG +      G+ PW  L+         KIG
Sbjct: 1341 --GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV---VAAMFKIG 1393

Query: 293  EKKRTTNVYDLAQGLPIQFGR-YLEIVRNLSFEETP 327
            + K    + +    L  Q GR +L+    ++ E+ P
Sbjct: 1394 KSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRP 1429

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 99/213 (46%), Gaps = 19/213 (8%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGT---PG 125
           ++IGK +G+G FG ++   ++ +G   A+K  E +      ++ ++R    +  +   P 
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHPN 168

Query: 126 VPQAY-YFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHD 184
           + Q Y YF  E    +L+  L+   L          F+         QM   ++ +H  +
Sbjct: 169 LTQLYGYFHDEKRVYLLMEYLVNGELYKHLK-GRSHFNDVVASYYVYQMADALDYMHERN 227

Query: 185 LIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS 244
           +++RDIKP+N ++G       N I L DFG +     PK  +      +K+L GT  Y+S
Sbjct: 228 ILHRDIKPENIIIGF-----NNTIKLTDFGWS--VITPKGSK------RKTLCGTVDYLS 274

Query: 245 INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
                 RE + + D+ ALG + +  L G  P++
Sbjct: 275 PELIRSREYNEKVDVWALGVLTYELLVGSPPFE 307

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 111/270 (41%), Gaps = 47/270 (17%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRKTEAPQLKDEYRTYKILTGTP 124
           +K G  IG+G++  +   T++      A K     +  R+ +   +  E    + L  +P
Sbjct: 179 FKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSP 238

Query: 125 GVPQAY---------YFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMIT 175
            V + +         YF  E   N   + L+      L + C R +        A Q+I 
Sbjct: 239 SVVRLFSTFQDESSLYFLLEYAPNGDFLSLMK-KYGSLDETCARYY--------AAQIID 289

Query: 176 LIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYRE--- 232
            I+ LH++ +I+RDIKP+N L+     +   KI L DFG AK           P  +   
Sbjct: 290 AIDYLHSNGIIHRDIKPENILL-----DGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLST 344

Query: 233 -KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
             KS  GTA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 345 RSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPF---KATNEYLTFQKV 401

Query: 292 GEKKRTTNVYDLAQGLPIQFGRYLEIVRNL 321
            + +     Y    G P+       I+R+L
Sbjct: 402 MKVQ-----YAFTPGFPL-------IIRDL 419

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 116/278 (41%), Gaps = 32/278 (11%)

Query: 24  NTPMQSASNLRLLNGNLPMTPAN--QTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSF 81
           N  + SASN+RL N +     +   +   S    P++ +  S      + + K IG+GSF
Sbjct: 337 NLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSID---DFDLLKVIGKGSF 393

Query: 82  GVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVPQAYYF-GQE 135
           G + +     TN I  L    K +   K+E      E      +     VP  + F   E
Sbjct: 394 GKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSSE 453

Query: 136 GLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPD 193
            L+ +L     G    +LF    R  +F +        +++  +E LH  D+IYRD+KP+
Sbjct: 454 KLYLVLAFINGG----ELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPE 509

Query: 194 NFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQ 253
           N L+   GH     I L DFG+ K     + K         +  GT  Y++    LG+  
Sbjct: 510 NILLDYQGH-----IALCDFGLCKLNMKDQEKT-------TTFCGTPEYLAPELLLGQGY 557

Query: 254 SRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 558 TKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 592

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 105/244 (43%), Gaps = 27/244 (11%)

Query: 55  PPTSMRDDSTIVGLH-YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAP 108
           P    RD S    L  ++I + +G GSFG +    +  NG   A+K   + T     +  
Sbjct: 72  PMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVE 131

Query: 109 QLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVV 167
              DE R   I++  P + + +   Q+     +V+D + G  L  L     R F      
Sbjct: 132 HTNDERRMLSIVSH-PFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQR-FPNPVAK 189

Query: 168 QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQH 227
             A ++   +E LH+ D+IYRD+KP+N L+ + GH     I + DFG AK   D      
Sbjct: 190 FYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------ 238

Query: 228 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQK 287
           + Y    +L GT  Y++      +  ++  D  + G + +  L G  P+      N  + 
Sbjct: 239 VTY----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYN---SNTMKT 291

Query: 288 YEKI 291
           YE I
Sbjct: 292 YENI 295

>Kwal_26.7635
          Length = 691

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 99/229 (43%), Gaps = 25/229 (10%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTP 124
           +++ K IG+GSFG + +     TN +  L    K +   K+E      E      +    
Sbjct: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLHA 182
            VP  + F       I++  + G    +LF    R  +FS+        +++  +E LH 
Sbjct: 418 IVPLKFTFQSPDKLYIVLAFING---GELFYHLQREGRFSLSRARLYTAELLCALETLHN 474

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
            D+IYRD+KP+N L+   GH     I L DFG+ K     + K +       +  GT  Y
Sbjct: 475 LDVIYRDLKPENILLDHQGH-----IALCDFGLCKLNMKGQDKTN-------TFCGTPEY 522

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           ++    LG+  S+  D   LG + +  + G  P+     P   + Y+KI
Sbjct: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP---KMYKKI 568

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 104/230 (45%), Gaps = 26/230 (11%)

Query: 74  KKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILT-------GTPGV 126
           +++G GS+  ++      +    AIK   ++    + K +Y T +  T         PG+
Sbjct: 14  EELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLLGQANHPGI 73

Query: 127 PQAYY--FGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            + YY    QE L+   V+DL  G  L  L     R FS         Q++  +E +H+ 
Sbjct: 74  IKLYYTFHDQENLY--FVMDLAPGGELLQLLR-RQRVFSEAWARHYMCQLVDTVEYIHSM 130

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY--RDPKTKQHIPYREKKSLSGTAR 241
            +I+RD+KP+N L+ + G     ++ + DFG A      D  +    P     S  GTA 
Sbjct: 131 GVIHRDLKPENVLLDKEG-----RLMIADFGAAYTVGQSDAGSDGDKP---ATSFVGTAE 182

Query: 242 YMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           Y+S    L  +     D+ ALG + + FL+G  P++G    N  + +E+I
Sbjct: 183 YVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFRG---QNEMETFEQI 229

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 104/237 (43%), Gaps = 34/237 (14%)

Query: 66   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEYRTYKI 119
            V + ++    IG G+FG ++   N+ NG  +A+K          K   P +K+E    ++
Sbjct: 1030 VSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEM 1089

Query: 120  LTGTPGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCNRKFSVKTVVQV-AVQMI 174
            L   P + Q  Y+G E +H    NI +    G SL  L D  + +   + V QV   +++
Sbjct: 1090 LNH-PNIVQ--YYGVE-VHRDKVNIFMEYCEGGSLASLLD--HGRIEDEMVTQVYTFELL 1143

Query: 175  TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQH------- 227
              +  LH   +++RDIKP+N L+   G      I  +DFG A+     +T+         
Sbjct: 1144 EGLAYLHQSGVVHRDIKPENILLDFNGI-----IKYVDFGTARTVVGSRTRTVRNAAVQD 1198

Query: 228  --IPYREKKSLSGTARYMSINTHLGREQSRR---DDMEALGHVFFYFLRGQLPWQGL 279
              +  +    + GT  YM+  T  G     +   DD+ ALG V      G+ PW  L
Sbjct: 1199 FGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 101/231 (43%), Gaps = 27/231 (11%)

Query: 57  TSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK-TEAPQLKD--- 112
           TS R +   VG  +K+GK +G+GS G +    NM  G   AIK  P+K  ++ Q+K    
Sbjct: 61  TSKRRNRDTVG-PWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPY 119

Query: 113 ----EYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSV--KTV 166
               E    K+++  P V   Y   +      LV++ +     +LFD+   K  +     
Sbjct: 120 GIEREIIIMKLISH-PNVMGLYEVWENKSELYLVLEYVEGG--ELFDYLVSKGKLPESEA 176

Query: 167 VQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQ 226
           +    Q++  +   H  ++ +RD+KP+N L+ +        I + DFGMA      K  +
Sbjct: 177 IHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRS----IKIADFGMAALETSDKLLE 232

Query: 227 HIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 276
                   +  G+  Y S    LGR+      D+ + G + F  L G LP+
Sbjct: 233 --------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPF 275

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 106/250 (42%), Gaps = 52/250 (20%)

Query: 68  LH-YKIGKKIGEGSFGVLFE--GTNMINGLPVAIKFEPRK----------------TEAP 108
           LH YK+  KIGEG+F  +F+  G N  +  PVAIK   +K                +   
Sbjct: 118 LHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGISSDAILKGNDRIQGSSRK 177

Query: 109 QLKDEYRTYKILT-GTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKT 165
           ++ +E   +K+++   P   +   F +   +  LV +L+     ++FD   +   FS   
Sbjct: 178 KVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG--EIFDRIVQLTCFSEDL 235

Query: 166 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLV---------GRPGHED----------AN 206
              V  Q+   I+ +H   +++RD+KP+N L          G    ED            
Sbjct: 236 ARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDMQKEDEFTLGVGGGGIG 295

Query: 207 KIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 266
            + L+DFG+AK+ R+            K+  GT  Y++      +  S + DM ++G V 
Sbjct: 296 LVKLMDFGLAKKLRN---------NTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVL 346

Query: 267 FYFLRGQLPW 276
           F  L G  P+
Sbjct: 347 FTLLCGYPPF 356

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 99/234 (42%), Gaps = 35/234 (14%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTP 124
           + + K IG+GSFG + +     TN I  L    K +   K+E      E      +    
Sbjct: 389 FDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPF 448

Query: 125 GVPQAYYF-GQEGLHNILVIDLLGPSL------EDLFDWCNRKFSVKTVVQVAVQMITLI 177
            VP  + F   E L+ +L   + G  L      E  FD    +F          +++  +
Sbjct: 449 IVPLKFSFQSPEKLYLVLAF-INGGELFFHLQKEGRFDLSRARF-------YTAELLCAL 500

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 237
           E LH+ ++IYRD+KP+N L+   GH     I L DFG+ K     + K +       +  
Sbjct: 501 ETLHSLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKTN-------TFC 548

Query: 238 GTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           GT  Y++    LG+  S+  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 549 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 599

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 105/233 (45%), Gaps = 23/233 (9%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKILTGTP 124
           +K G+ +G+GS+  +   T++ +    A+K   ++    Q K +Y      T + L  T 
Sbjct: 155 FKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTK 214

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSV--KTVVQVAVQMITLIEDLHA 182
           G+   Y+  Q+      +++   P+  DL     +  SV  K     A Q+I  +  +H 
Sbjct: 215 GIISLYFTFQDESSLYFLLEY-APN-GDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 183 HDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIPY---REKKSLSG 238
             +I+RD+KP+N L+      D + K+ L DFG A+   D  ++  + Y       S  G
Sbjct: 273 KGVIHRDLKPENILL------DVDMKVKLTDFGTAR-LLDSTSEDDLKYDLLTRSNSFVG 325

Query: 239 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           TA Y+S           R D+ A G + F  + G+ P+   KA N    ++K+
Sbjct: 326 TAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPF---KANNEYLTFQKV 375

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 14/178 (7%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKILTGT--P 124
           Y  GK +G G+FGV+ +  N   G  VA+K   +K       QL+  Y    IL     P
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHP 96

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMITLIEDLHA 182
            +  A+    E      +I  L    E LFD   +K  F+ +  V++ V++++ ++ +H+
Sbjct: 97  NIV-AFKDWFESKDKFYIITQLAKGGE-LFDRILKKGKFTEEDAVRILVEILSAVKYMHS 154

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
            ++++RD+KP+N L       D + + + DFG+AK+    K+ + + Y+   SL   A
Sbjct: 155 QNIVHRDLKPENLLY--IDKSDESPLVVADFGIAKRL---KSDEELLYKPAGSLGYVA 207

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 106/248 (42%), Gaps = 42/248 (16%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPV-AIKFEPRKTEAPQLKDEYRTYKILTGT----- 123
           +   +++G GS+  +F+  +  +   + AIK   +K    + K +Y T +  T       
Sbjct: 11  FIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQK 70

Query: 124 --PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLF-------DWCNRKFSVKTVVQVAVQM 173
              G+ + YY   +  +   V+D   G  L  L        D   R F+         Q+
Sbjct: 71  HHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTA--------QL 122

Query: 174 ITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREK 233
           I  +E +H+H +I+RD+KP+N L+ R G     ++ + DFG A       +     +   
Sbjct: 123 IDALEFIHSHGIIHRDLKPENVLLDRDG-----RLMITDFGAAATIDPSLSGDSAKFNSD 177

Query: 234 K----------SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPN 283
                      S  GTA Y+S    L  +     D+ ALG + + F++GQ P++G    N
Sbjct: 178 SNGSKDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRG---EN 234

Query: 284 NKQKYEKI 291
             + +EKI
Sbjct: 235 ELKTFEKI 242

>Scas_690.13
          Length = 354

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 109/233 (46%), Gaps = 28/233 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------DEYRTYKILTGT 123
           +++ + +G GSFG +    ++ NG   AIK   +K +  ++K      DE R  K L   
Sbjct: 44  FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVL-KKQQVVRMKQIEHTNDERRMLK-LVEH 101

Query: 124 PGVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
           P + + +   Q+  +  +V+D + G  L  L    +++F        A ++   +E LH+
Sbjct: 102 PFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLR-KSQRFPNPVAKFYAAEVTLGLEYLHS 160

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           H++IYRD+KP+N L+ R GH     I + DFG AK+  D  T          +L G   Y
Sbjct: 161 HNIIYRDLKPENILLDRNGH-----IKITDFGFAKEV-DTVT---------WTLCGPPDY 205

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKK 295
           ++      +  ++  D  +LG + F  L G  P+         + YEKI + K
Sbjct: 206 IAPEVIATKPYNKSVDWWSLGVLIFEMLAGYTPFYD---TTPMKTYEKILQGK 255

>Kwal_47.18307
          Length = 621

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 11/123 (8%)

Query: 169 VAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHI 228
           +  Q++  ++ +H+  +I+RD+KP+N L+ + G     ++ + DFG A    D K +   
Sbjct: 117 ITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEG-----RVVITDFGAACTAADRKFENT- 170

Query: 229 PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
             +   S  GTA Y+S    L  +     D+ ALG + +   +G+ P++G    N  Q +
Sbjct: 171 --KRTASFVGTAEYVSPELLLHSQCGFSSDIWALGCIIYQLNQGKPPFRG---ENELQTF 225

Query: 289 EKI 291
           EKI
Sbjct: 226 EKI 228

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 101/221 (45%), Gaps = 19/221 (8%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           V   +K  + IG G FGV+++G N+  G   AIK     +++ +++D  R  + L     
Sbjct: 19  VSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 78

Query: 126 VPQ-AYYFG---QEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
           +     Y+G   ++    I++    G SL  L      K   K +  +  +++  ++ +H
Sbjct: 79  ISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPG--KIDEKYIGVIMRELLVALKCIH 136

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
             ++I+RDIK  N L+   G+     + L DFG+A Q      +       +++++GT  
Sbjct: 137 KDNVIHRDIKAANVLITNEGN-----VKLCDFGVAAQVNQTSLR-------RQTMAGTPY 184

Query: 242 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 185 WMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEA 225

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 81/158 (51%), Gaps = 22/158 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           Y++ KKIG G +  +F+G +++N +P  IK  +P K     +K  YR  K+LT   G P 
Sbjct: 51  YEVIKKIGRGKYSEVFKGKSVLNDIPCVIKVLKPVK-----MKKIYRELKVLTNLTGGPN 105

Query: 129 AYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCNRKFSVKTVVQVAVQMITLIEDLH 181
                  GL +I+      +  L+   ++++ F      F++        Q++T ++  H
Sbjct: 106 II-----GLLDIVQDPGSKIPALIFEEVKNVDFRTLYPSFTLSDTQFYFTQLLTALDYCH 160

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           +  +++RD+KP N ++      +  K+ LID+G+A+ Y
Sbjct: 161 SMGIMHRDVKPQNVMID----PNERKLRLIDWGLAEFY 194

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 106/239 (44%), Gaps = 32/239 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPV-AIKFEPRKTEAPQLKDEY--------RTYKIL 120
           +K G  +G+GS+  +F  T+  +     A+K   ++    Q K +Y        +  K +
Sbjct: 118 FKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNLKSV 177

Query: 121 TGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSV---KTVVQVAVQMITLI 177
           TG   +  ++ F  E   N+  +    P+ +  F    +KF     +  +  + Q+I  I
Sbjct: 178 TGVINL--SFTFQDEA--NLYFLLEYAPNGD--FLSLIKKFGTLNEECTIYYSAQIIDAI 231

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIPY----RE 232
             +H+H +I+RDIKP+N L+      D N KI L DFG AK  +    K   P+      
Sbjct: 232 GSMHSHGIIHRDIKPENILL------DGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTR 285

Query: 233 KKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
             S  GTA Y+S           + D+ A G + +  + G+ P+   KA N    ++K+
Sbjct: 286 SSSFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPF---KATNEYLTFQKV 341

>Scas_689.25*
          Length = 409

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 95/214 (44%), Gaps = 25/214 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGTP 124
           + I +  G GSFG +    ++ NG   A+K   ++T     +     DE R   + +   
Sbjct: 99  FNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERRMLSV-SVHA 157

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLHA 182
            + + +   Q+  H  +++D +     +LF    R  +F        A ++   ++ LH+
Sbjct: 158 FIVRLWGTFQDSEHLFMIMDYVEGG--ELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHS 215

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
            D+IYRD+KP+N L+ R GH     I + DFG AK   D      + Y    +L GT  Y
Sbjct: 216 LDIIYRDLKPENLLLDRNGH-----IKVTDFGFAKYVPD------VTY----TLCGTPDY 260

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           ++      +  ++  D  + G + +  L G  P+
Sbjct: 261 IAPEVISAKPYNKSVDWWSFGILIYEMLSGHTPF 294

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 81/166 (48%), Gaps = 9/166 (5%)

Query: 62  DSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------TEAPQLKDEYR 115
           +S +   +Y  GK +G G+FGV+ +         VA+K   +K       +   L DE  
Sbjct: 37  ESYVSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELS 96

Query: 116 TYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMIT 175
             ++L     V    +F  +    I+    +G  L D       KF+ +  V + +Q+++
Sbjct: 97  ILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRI-LAKGKFTERDAVSITMQILS 155

Query: 176 LIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
            ++ +H+ ++++RD+KP+N L       D +++ + DFG+AKQ +D
Sbjct: 156 AVDYMHSKNVVHRDLKPENVLY--IDKSDDSQLVIADFGIAKQLQD 199

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 88/178 (49%), Gaps = 17/178 (9%)

Query: 51  STASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-- 108
           ST + P S   D   +G +Y+I K +GEGSFG +    +   G  VA+K   +K  A   
Sbjct: 37  STLNNPKSSLADGAHIG-NYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSD 95

Query: 109 ---QLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSV 163
              +++ E  +Y  L   P + + Y   +     I+VI+  G    +LFD+  +  K S 
Sbjct: 96  MQGRIEREI-SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSE 151

Query: 164 KTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
           +   +   Q+I+ +E  H H +++RD+KP+N L+     ++   + + DFG++    D
Sbjct: 152 QEARRFFQQIISAVEYCHRHKIVHRDLKPENLLL-----DEHLNVKIADFGLSNIMTD 204

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 108/265 (40%), Gaps = 63/265 (23%)

Query: 57  TSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-- 114
           +S R     VG  +K+GK +G+GS G +    N+ NG   AIK  P++T   +++D+   
Sbjct: 81  SSKRKSRDTVG-PWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMK 139

Query: 115 ----------------RTYKILTGTPGVPQAYYFGQEGLHNILVIDLLG-PSLEDLFD-W 156
                           R   I  GT      Y   +E    I+++ L+  P++  L + W
Sbjct: 140 TAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIERE----IVIMKLISHPNVMGLLEVW 195

Query: 157 CNR-----------------------KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPD 193
            N+                       K S    V    Q+I  +   H+ ++ +RD+KP+
Sbjct: 196 ENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPE 255

Query: 194 NFLVGRPGHEDANK-IHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE 252
           N L+ +      NK I + DFGMA           +P +  ++  G+  Y S    +G+ 
Sbjct: 256 NLLLDK-----KNKVIKIADFGMA--------ALELPNKLLETSCGSPHYASPEIVMGKP 302

Query: 253 -QSRRDDMEALGHVFFYFLRGQLPW 276
                 D+ + G + F  L G LP+
Sbjct: 303 YHGGPSDVWSCGIILFALLTGHLPF 327

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 109/249 (43%), Gaps = 37/249 (14%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGL-PVAIKFEPRKTEAPQLKDEYRTYKILT------- 121
           +   +++G GS+  +++  +  +   P AIK   ++    + K +Y T +  T       
Sbjct: 11  FIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEKNTLNLLARG 70

Query: 122 GTPGVPQAYY--FGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIED 179
             PG+ + YY    +E L+ +L     G  L  L       F+       A Q++  +E 
Sbjct: 71  NHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGT--FTDSWAKHFAAQLVDTLEF 128

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMA---KQYRDPKT----------KQ 226
           +HA  +I+RD+KP+N L+ + G      + + DFG A     + D             K 
Sbjct: 129 MHARGVIHRDLKPENVLLSKEG-----ILMITDFGAAATQNNFSDKDNTRSNANEGIPKD 183

Query: 227 HIPYR----EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282
            +P      E  S  GTA Y+S    L  + S   D+ ALG + + F++G  P++G    
Sbjct: 184 DVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRG---E 240

Query: 283 NNKQKYEKI 291
           N  + +EKI
Sbjct: 241 NELKTFEKI 249

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 100/223 (44%), Gaps = 32/223 (14%)

Query: 29  SASNLRLLNGNLPMTP----ANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVL 84
           S +N  L + N+P++P     NQT     SP  S++D        Y I K I +G++G +
Sbjct: 760 SINNAMLTSPNMPLSPLLLATNQT---VKSPTPSIKD--------YDILKPISKGAYGSV 808

Query: 85  FEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHN 139
           +     + G   AIK   +     K +   +K E     + +  P V + +   Q   + 
Sbjct: 809 YLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSDKPYVARLFASFQNKDNL 868

Query: 140 ILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVG 198
            LV++ L G  L  L          +   Q   +++  + D+H + +I+ D+KP+N L+ 
Sbjct: 869 FLVMEYLPGGDLATLIKMMGY-LPDQWAKQYLTEIVVGVNDMHQNGIIHHDLKPENLLID 927

Query: 199 RPGHEDANKIHLIDFGMAKQYRDPKTKQH--IPYREKKSLSGT 239
             GH     + L DFG++   R    ++H  +P++   S+S T
Sbjct: 928 NAGH-----VKLTDFGLS---RAGLIRRHKFVPHKSSLSISST 962

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 87/178 (48%), Gaps = 17/178 (9%)

Query: 51  STASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-- 108
           S  S   S   D + VG +Y+I K +GEGSFG +    ++  G  VA+K   +K  A   
Sbjct: 21  SYVSNKVSSLADGSRVG-NYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSD 79

Query: 109 ---QLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC--NRKFSV 163
              +++ E  +Y  L   P + + Y   +     I+VI+  G    +LFD+     K S 
Sbjct: 80  MQGRIEREI-SYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRNKMSE 135

Query: 164 KTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
           +   +   Q+I+ +E  H H +++RD+KP+N L+     ++   + + DFG++    D
Sbjct: 136 QEARRFFQQIISAVEYCHRHKIVHRDLKPENLLL-----DEHLNVKIADFGLSNIMTD 188

>Kwal_26.7788
          Length = 1267

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 95/217 (43%), Gaps = 26/217 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ-------LKDEYRTYKILTG 122
           +K+GK +G+GS G +    NM  G   AIK  P KT++ +       ++ E    K+++ 
Sbjct: 58  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVP-KTKSSRTGSLPYGIEREIIIMKLISH 116

Query: 123 TPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDW--CNRKFSVKTVVQVAVQMITLIEDL 180
            P V   Y   +  L   LV++ +     +LFD+     +   K  +    Q+I      
Sbjct: 117 -PNVMGLYEVWENKLELFLVLEYVDGG--ELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           H  ++ +RD+KP+N L+ +       +I + DFGMA      K  +        +  G+ 
Sbjct: 174 HGFNICHRDLKPENLLLDKKN----KRIKIADFGMAALQTSNKLLE--------TSCGSP 221

Query: 241 RYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 276
            Y S    +G+       D+ + G + F  L G LP+
Sbjct: 222 HYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPF 258

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 29/240 (12%)

Query: 50  ASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK----- 104
           +STA   T  R +   VG  +K+GK +G+GS G +    NM +G   AIK  P++     
Sbjct: 42  SSTAHTKTGKRKNRDTVG-PWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHN 100

Query: 105 ----TEAPQ-LKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDW--C 157
               T  P  ++ E    K++T  P +   Y   +      LV++ +     +LFD+   
Sbjct: 101 QKQVTALPYGIEREIIIMKLITH-PNIMALYEVWENKSELYLVLEYVEGG--ELFDYLIA 157

Query: 158 NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
             K   +  +    Q++  +   H  ++ +RD+KP+N L+ +        + + DFGMA 
Sbjct: 158 RGKLPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKN----KTVKIADFGMA- 212

Query: 218 QYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 276
                        R  ++  G+  Y S    +G++      D+ + G + F  L G LP+
Sbjct: 213 -------ALETTNRLLETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPF 265

>Scas_720.94
          Length = 1683

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 112/253 (44%), Gaps = 49/253 (19%)

Query: 63   STIVGLHYKIGKK--IGEGSFGVLFEGTNMINGLPVA---IKFEPRKTEA---PQLKDEY 114
            S+I  L  +  K+  IG G+FG ++   N+ NG  +A   IK +  KT     P +K+E 
Sbjct: 1352 SSISNLSIRWQKRNFIGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEM 1411

Query: 115  RTYKILTGTPGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCNRKFSVKTVVQV- 169
               ++L   P + Q  Y+G E +H    NI +    G S+  L +  + +   + V QV 
Sbjct: 1412 TVLEMLNH-PNIVQ--YYGVE-VHRDKVNIFMEYCEGGSMASLLE--HGRIEDEMVTQVY 1465

Query: 170  AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIP 229
             ++++  +  LH   +++RDIKP+N L+   G      I  +DFG A++     TK  + 
Sbjct: 1466 TLELLEGLAYLHQAGVVHRDIKPENILLDFNG-----IIKYVDFGAARKIAKNGTK--VT 1518

Query: 230  YREKKS--------------------LSGTARYM---SINTHLGREQSRRDDMEALGHVF 266
                KS                    + GT  YM   SI  +  + +   DD+ + G V 
Sbjct: 1519 NINSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVV 1578

Query: 267  FYFLRGQLPWQGL 279
               + G+ PW  L
Sbjct: 1579 LEMITGRRPWANL 1591

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 101/237 (42%), Gaps = 33/237 (13%)

Query: 57  TSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRT 116
           +S  D    +   +K  + IG G FG++++G ++      AIK     +   +++D  R 
Sbjct: 3   SSNEDKEKDISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVEDVQRE 62

Query: 117 YKILTGTPGVPQ-AYYFGQEGLHNILVIDLLGPSLEDLFDWCN----------RKFSVKT 165
            + L     +P    Y+G           L G SL  + ++C            K   K 
Sbjct: 63  IQFLASLKQIPNITRYYGSY---------LRGTSLWIIMEYCAGGSLRSLLRPGKIDEKY 113

Query: 166 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTK 225
           +  +  +++  ++ +H  ++I+RDIK  N L+   G     ++ L DFG+A Q      +
Sbjct: 114 IGVIMRELLVALKVIHKDNVIHRDIKAANVLITNEG-----QVKLCDFGVAAQLNQTSLR 168

Query: 226 QHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
                  +++++GT  +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 169 -------RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA 218

>Scas_711.25
          Length = 1515

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 100/221 (45%), Gaps = 35/221 (15%)

Query: 73   GKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ--------------LKDEYRTYK 118
            G+ IG+GSFG ++   N+  G  +A+K    + E P+              L+ E  T K
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVK----QVEVPKYSSQDEAIISTVEALRSEVSTLK 1272

Query: 119  ILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIE 178
             L     V    +  ++ ++++ +  + G S+  L     R F    +  +  Q++  + 
Sbjct: 1273 DLDHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIRHLNTQVLRGLA 1331

Query: 179  DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 238
             LH+  +++RD+K DN L+ + G        + DFG++++ +D  +   +  R      G
Sbjct: 1332 YLHSRGILHRDMKADNLLLDQDG-----VCKISDFGISRKSKDIYSNSDMTMR------G 1380

Query: 239  TARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
            T  +M+   ++T  G   S + D+ +LG +      G+ PW
Sbjct: 1381 TVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPW 1419

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 100/220 (45%), Gaps = 26/220 (11%)

Query: 70  YKIGKKIGEGSFGVLFEG---TNMINGLP--VAIKFEPRKTEAPQLKDEYRTYKILTGTP 124
           Y IG  +GEG FG +  G    +  N +P  VAIK   R T       E + Y+ +    
Sbjct: 46  YIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALK 105

Query: 125 GV--PQAYYFGQEGLHNILVIDLLGPSLE--DLFDWCNRKFSVK--TVVQVAVQMITLIE 178
            +  P   Y  +E L N   I ++   +   + + +  RK  +K  +  ++  Q+I+ + 
Sbjct: 106 HLTHPNIIYL-EEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVN 164

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 238
            +H   L++RD+K +N L+ +  HE+   + + DFG   ++ +            K+  G
Sbjct: 165 YMHYKGLVHRDLKLENLLLDK--HEN---LVITDFGFVNEFFEDNELM-------KTSCG 212

Query: 239 TARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 276
           +  Y +    +  +  ++R+ D+ + G + +  L G LPW
Sbjct: 213 SPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPW 252

>Scas_717.69
          Length = 674

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 118/291 (40%), Gaps = 30/291 (10%)

Query: 10  ANTAMAIHNLTNTTNTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIVGLH 69
           +N  + + +L    N    SA+N+RL N +  +T  N       S       +  +    
Sbjct: 286 SNQDVHLDSLQIPINLKFDSAANIRLYNHHW-VTLENTLGRINISVDYKPSKNKRLTIDD 344

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTP 124
           + + K IG+GSFG + +     T  I  L    K +   K+E      E RT       P
Sbjct: 345 FDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAE-RTVLARVNCP 403

Query: 125 G-VPQAYYF-GQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDL 180
             VP  + F   E L+ +L     G    +LF    +  +F +        +++  +E L
Sbjct: 404 FIVPLKFSFQSPEKLYLVLACINGG----ELFYHLQKEGRFELSRARFYTAELLCALETL 459

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           H  D+IYRD+KP+N L+   GH     I L DFG+ K     + K         +  GT 
Sbjct: 460 HNLDVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDQDKT-------DTFCGTP 507

Query: 241 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
            Y++    L +  S+  D   LG + +  L G  P+     P   + Y KI
Sbjct: 508 EYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVP---KMYRKI 555

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 14/139 (10%)

Query: 165 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKT 224
           TV   A ++   ++ LH+  ++YRD+KP+N L+ + GH     + L DFG++K      +
Sbjct: 271 TVAFYAAEISCALKFLHSKGVVYRDLKPENCLLNQNGH-----LVLTDFGLSKSSASNAS 325

Query: 225 KQHI-------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
           ++ +          E  S+ GT  Y +    LG+  +   D  +LG + +  L G+ P+ 
Sbjct: 326 QEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLGCLLYDMLTGKPPYT 385

Query: 278 GL--KAPNNKQKYEKIGEK 294
           G   K   NK K +K G K
Sbjct: 386 GANHKVIANKIKNDKQGPK 404

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 73   GKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEA----PQLKDEYRTYKILTG 122
            G+ IG+GSFG ++   N+  G  +A+K      F  +   A      LK E  T K L  
Sbjct: 1041 GEIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNH 1100

Query: 123  TPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
               V    +  + G++++ +  + G S+  L     R F  + +  +  Q++  +  LH+
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLIRMYGR-FDDQLIRHLTKQVLEGLAYLHS 1159

Query: 183  HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
              +++RD+K DN L+   G        + DFG++++        +I      ++ GT  +
Sbjct: 1160 KGILHRDMKADNLLLDNDG-----VCKISDFGISRK------SNNIYSNSDMTMRGTVFW 1208

Query: 243  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
            M+   ++T  G   S + D+ +LG V      G+ PW   + 
Sbjct: 1209 MAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEV 1248

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 121/284 (42%), Gaps = 27/284 (9%)

Query: 4   HQNSTTANTAMAIHNLTNTTNTPMQSAS-NLRLLNGNLPMTPANQTPASTASPPTSMRDD 62
           HQ ST A+      +L  TT++P+ + S +L + N +       Q   S     T +   
Sbjct: 299 HQESTVADDCAISSSLKETTSSPVSTGSFSLMIENEDSDRDQIIQALYSNIEASTDL--- 355

Query: 63  STIVGLHYK-IGKKIGEGSFGVLFEGTNMINGLPVAIKF----EPRKTEAPQLKDEYRTY 117
              V   Y+ +   +GEGS G +     +++    A+K     + R++E   +K+    Y
Sbjct: 356 ---VSRKYRDLDVVLGEGSGGKVKLVQRVLDNKVFALKEYRSKKKRESERKYIKNIISEY 412

Query: 118 KILTG--TPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC-NRKFSVKTVVQVAVQMI 174
            I +    P + +      E      +  +L     DLF    + K   + +  +  Q+I
Sbjct: 413 CIASTLKNPNICETLEILYEKGK---IFQILEYCEYDLFSLVMSEKMHYEEICCLFKQLI 469

Query: 175 TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKK 234
             ++ LH   L +RD+K DN +V R G      + LIDFG +  +  P + Q I   E  
Sbjct: 470 NGVKYLHDIGLSHRDLKLDNCVVTRRG-----ILKLIDFGASSVFHYPLSSQMI---EAN 521

Query: 235 SLSGTARYMSINTHLGREQS-RRDDMEALGHVFFYFLRGQLPWQ 277
            + G+  Y+S       E   R  D+ ++G +FF  +  + PW+
Sbjct: 522 GIVGSDPYLSPEVFYFNEYDPRALDVWSVGIIFFCMITRRFPWK 565

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 63/141 (44%), Gaps = 22/141 (15%)

Query: 151 EDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL 210
           E +FD    +F        A +++  ++ LH  D++YRD+KP+N L+   GH     I L
Sbjct: 469 EGIFDISRARF-------YASELLLALDSLHKMDVVYRDLKPENILLDSQGH-----IAL 516

Query: 211 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFL 270
            DFG+ K       K         +  GT  Y++    LG+  ++  D   LG + +  L
Sbjct: 517 CDFGLCKLNMKDNEKT-------STFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEML 569

Query: 271 RGQLPWQGLKAPNNKQKYEKI 291
            G  P+      N  + Y+KI
Sbjct: 570 TGLPPYYD---ENVSEMYKKI 587

>Kwal_14.1273
          Length = 415

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 110/273 (40%), Gaps = 41/273 (15%)

Query: 75  KIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-------APQLKDEYRTYKIL-TGTPGV 126
           KI  GSF  ++   +      VA+K   + +E       A  +  E    ++L TG P V
Sbjct: 7   KIQSGSFSTVYRAYDTERARDVALKILKKPSEPAMASKLATLVGSELEVLRVLGTGHPNV 66

Query: 127 PQAYYFGQEGLHNILVIDLLGPSLEDLFD----WCNRKFSVKTV----VQVAVQMITLIE 178
                F +     + V++       DL+D    W  ++ S + V     +V +Q+ + IE
Sbjct: 67  CALLDFYERETCYVFVMEYAARG--DLYDVIRGW--KRHSAERVPVELARVVLQLCSAIE 122

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSG 238
             H+  + +RDIKP+N L+     + A  + L D+G++ + R     +           G
Sbjct: 123 YAHSCGIAHRDIKPENVLL-----DSAGNVKLADWGLSTRMRVSCDTR----------IG 167

Query: 239 TARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG---LKAPNNKQKYEKIGEKK 295
           T +Y++   +     +   D  +LG    + + G  P++     K+PNN      +    
Sbjct: 168 TEKYLAPEAYASPHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPH 227

Query: 296 RTTNVYDLAQGLPIQFGRYLEIVRNLSFEETPD 328
           R  + Y     LP++  R  +    LS     D
Sbjct: 228 RFISEYYF---LPLRAARSAKPAEWLSLPHVSD 257

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 17/151 (11%)

Query: 74  KKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVP 127
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  P V 
Sbjct: 356 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 413

Query: 128 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 414 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 471

Query: 186 IYRDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
           I+RDIKPDN L+   GH     I L DFG++
Sbjct: 472 IHRDIKPDNILIDIRGH-----IKLSDFGLS 497

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 12/200 (6%)

Query: 24  NTPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGV 83
           ++P    S+L    G+LP   A + P S     T+     T     Y I K I +G++G 
Sbjct: 636 SSPFMVGSDLLSPEGHLPSATAPKPPLSPLLLATNQAKAPTPSIKDYDIIKPISKGAYGS 695

Query: 84  LFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLH 138
           ++     I G   AIK   +     K +   +K E     + +  P V + Y   Q   +
Sbjct: 696 VYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMVQSEKPYVAKLYATFQNKEN 755

Query: 139 NILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLV 197
             LV++ L G  L  L          K   Q   ++I  ++D+H   +I+ D+KPDN L+
Sbjct: 756 LFLVMEYLSGGDLATLIKMMG-NLPDKWAKQYITEVIIGVDDMHMSGIIHHDLKPDNLLI 814

Query: 198 GRPGHEDANKIHLIDFGMAK 217
              GH     + L DFG+++
Sbjct: 815 DSNGH-----VKLTDFGLSR 829

>Scas_721.124
          Length = 684

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 96/235 (40%), Gaps = 37/235 (15%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTP 124
           + + K IG+GSFG + +     T  I  L    K +   K+E      E      +    
Sbjct: 351 FDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCPF 410

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSL------EDLFDWCNRKFSVKTVVQVAVQMITLIE 178
            VP  + F       +++  + G  L      E  FD    +F        A +++  +E
Sbjct: 411 IVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRF-------YAAELLCALE 463

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK--QYRDPKTKQHIPYREKKSL 236
            LH  ++IYRD+KP+N L+   GH     I L DFG+ K     D KT          + 
Sbjct: 464 TLHNLNVIYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDDDKT---------DTF 509

Query: 237 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
            GT  Y++    LG+  ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 510 CGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 561

>Scas_660.28
          Length = 623

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 16/160 (10%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILTGT 123
           +Y+I K +GEGSFG +    +M  G  VA+K   +K  A      +++ E  +Y  L   
Sbjct: 45  NYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRH 103

Query: 124 PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLH 181
           P + + Y   +     I+V++  G    +LFD+  +  K S     +   Q+I+ +E  H
Sbjct: 104 PHIIKLYDVIKSKDEIIMVMEYAG---NELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
            H +++RD+KP+N L+     ++   + + DFG++    D
Sbjct: 161 RHKIVHRDLKPENLLL-----DEHLNVKIADFGLSNIMTD 195

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGTP 124
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE     I++  P
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSH-P 203

Query: 125 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            + + +   Q+     +++D + G  L  L     R F        A ++   +E LH+ 
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALEYLHSK 262

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
            +IYRD+KP+N L+ + GH     I L DFG AK   D      + Y    +L GT  Y+
Sbjct: 263 GIIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD------VTY----TLCGTPDYI 307

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 308 APEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYD---SNTIKTYENI 352

>Scas_673.20*
          Length = 758

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 97/220 (44%), Gaps = 36/220 (16%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-----FEPRK----TEAPQLKDEYRTYKI 119
            Y+  K+IGEG+ G+++    +   + VAIK      +PR     TE   LK EY+   I
Sbjct: 480 RYRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLKIQPRLQMIWTEMLVLK-EYQHPNI 538

Query: 120 LTGTPGVPQAYYFGQEGLHNILVIDLL---GPSLEDLFDWCNRKFSVKTVVQVAVQMITL 176
           +          +     LH+ L I +    G SL D+  +     + + +  +  + +  
Sbjct: 539 IN---------FINSYLLHDTLWIVMEYMDGGSLADIVSFFTP--TEEQMATICRETLFG 587

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSL 236
           +  LH+  +++RDIK DN L+   G      I + DFG   Q  +  TK       + ++
Sbjct: 588 LNFLHSRGIVHRDIKSDNILLSMNGD-----IKITDFGFCGQLTESNTK-------RTTM 635

Query: 237 SGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
            GT  +M+      +E   + D+ +LG +    + G+ P+
Sbjct: 636 VGTPYWMAPEVIASKEYGPKVDVWSLGIMIIEMIEGEPPY 675

>Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement
          Length = 808

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 71/155 (45%), Gaps = 17/155 (10%)

Query: 70  YKIGKKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT-- 123
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  
Sbjct: 401 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 458

Query: 124 PGVPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
           P V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 459 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 516

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
               I+RDIKPDN L+   GH     + L DFG++
Sbjct: 517 KLGFIHRDIKPDNILIDIRGH-----VKLSDFGLS 546

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 20/135 (14%)

Query: 160 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQ 218
           +FS         +++  +E LH +D++YRD+KP+N L+      DAN  I L DFG++K 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKA 562

Query: 219 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQ 277
               +T          +  GT  Y++    L     ++  D  +LG + F    G   W 
Sbjct: 563 DLKDRT---------NTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WS 610

Query: 278 GLKAPNNKQKYEKIG 292
              A NN++ Y+KI 
Sbjct: 611 PFFAENNQKMYQKIA 625

>Kwal_55.21545
          Length = 865

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 98/221 (44%), Gaps = 19/221 (8%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           V   +K  + IG G FGV+++G         AIK     +   +++D  +  + L+    
Sbjct: 15  VSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQ 74

Query: 126 VPQAYYFGQEGLHN----ILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
           VP   ++    L++    +++    G SL  L      K   + +  +  +++T +  +H
Sbjct: 75  VPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPG--KIGEQYIGVIMRELLTALMHIH 132

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
              +I+RDIK  N L+   GH     I L DFG+A Q    K +       +++++GT  
Sbjct: 133 KDGVIHRDIKAANVLITNDGH-----IKLCDFGVAAQLSQTKIR-------RQTMAGTPY 180

Query: 242 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 181 WMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 221

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 12/147 (8%)

Query: 165 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ-YRDPK 223
           TV   A ++   +  LH   ++YRD+KP+N L+ + GH     + L DFG++K+   D  
Sbjct: 253 TVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGH-----LVLTDFGLSKKSANDSA 307

Query: 224 TKQHIP--YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
             +  P       S+ GT  Y +    LG+  S+  D  +LG + +  L G+ P+ G   
Sbjct: 308 VDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYTG--- 364

Query: 282 PNNKQKYEKIGEKKRTTNV-YDLAQGL 307
            N+K    KI + K+   + + L++G+
Sbjct: 365 SNHKVIINKIQQNKQGPKIPFYLSEGM 391

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 17/151 (11%)

Query: 74  KKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVP 127
           K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  P V 
Sbjct: 314 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 371

Query: 128 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 372 SLYYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIHKLGF 429

Query: 186 IYRDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
           I+RDIKPDN L+   GH     I L DFG++
Sbjct: 430 IHRDIKPDNILIDIRGH-----IKLSDFGLS 455

>Scas_651.18
          Length = 371

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 98/228 (42%), Gaps = 26/228 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGTP 124
           ++I + +G GSFG +    +  NG   A+K   + T     +     DE R    +   P
Sbjct: 59  FQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDE-RLMLSVVSHP 117

Query: 125 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            + + +   Q+     +++D + G  L  L     R F        A ++   +E LH+ 
Sbjct: 118 FLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQR-FPNPVAKFYAAEVCLALEYLHSM 176

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYM 243
           D+IYRD+KP+N L+ + GH     I + DFG AK   D      I Y    +L GT  Y+
Sbjct: 177 DIIYRDLKPENILLDKNGH-----IKITDFGFAKYVPD------ITY----TLCGTPDYI 221

Query: 244 SINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           +      +  ++  D  + G + +  L G  P+      N  + YE I
Sbjct: 222 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD---SNTMKTYENI 266

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 68/149 (45%), Gaps = 17/149 (11%)

Query: 76  IGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVPQA 129
           IG+G+FG    V  + T  I  +   +K E  K +  QL        +L GT  P +   
Sbjct: 376 IGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGTDSPWIVSL 433

Query: 130 YYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIY 187
           YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I+
Sbjct: 434 YYSFQDAQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGFIH 491

Query: 188 RDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
           RDIKPDN L+   GH     I L DFG++
Sbjct: 492 RDIKPDNILIDIRGH-----IKLSDFGLS 515

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 82/185 (44%), Gaps = 21/185 (11%)

Query: 39  NLPMTPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAI 98
           N P++P    P +  S   S+RD        Y + K I +G++G ++     + G   AI
Sbjct: 680 NQPLSPL-LLPTTGKSIIPSIRD--------YDVIKPISKGAYGSVYLAKKRVTGEYFAI 730

Query: 99  KFEPR-----KTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLL-GPSLED 152
           K   +     K +   +K E     + +  P V + Y   Q   +  LV+  L G  +  
Sbjct: 731 KVLKKSDMIAKNQVTNVKSERAIMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMAT 790

Query: 153 LFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLID 212
           L          K   Q   ++I+ ++D+H + +I+ D+KPDN L+   GH     I L D
Sbjct: 791 LIKMMGN-LPEKWAKQYICEVISGVDDMHQNGIIHHDLKPDNLLIDSLGH-----IKLTD 844

Query: 213 FGMAK 217
           FG+++
Sbjct: 845 FGLSR 849

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 99/216 (45%), Gaps = 20/216 (9%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKILTGTPG 125
           +Y  G+ +G GSFGV+ +   +     VAIK   +K       QL+  Y    IL     
Sbjct: 46  NYIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSH 105

Query: 126 VPQAYYFGQ--EGLHNILVIDLLGPSLEDLFD--WCNRKFSVKTVVQVAVQMITLIEDLH 181
            P    F    E      ++  L    E LFD      KF+    V++ VQ++  +E +H
Sbjct: 106 -PNIVSFKDWFESKDKFYIVTQLATGGE-LFDRILSRGKFTEVDAVEIIVQILGAVEYMH 163

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA- 240
           + ++++RD+KP+N L       + + + + DFG+AKQ    K ++ + Y+   SL   A 
Sbjct: 164 SKNVVHRDLKPENVLY--VDKSENSPLVIADFGIAKQL---KGEEDLIYKAAGSLGYVAP 218

Query: 241 RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
             ++ + H      +  D+ ++G + +  L G  P+
Sbjct: 219 EVLTQDGH-----GKPCDIWSIGVITYTLLCGYSPF 249

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 10/135 (7%)

Query: 165 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ--YRDP 222
           TV   A ++   ++ LH+  ++YRD+KP+N L+   GH     + L DFG++K+  + D 
Sbjct: 282 TVAFYAAELSCALKFLHSKGIVYRDLKPENCLLNERGH-----LVLTDFGLSKKSVFDDA 336

Query: 223 KTKQHIP-YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL-- 279
            T +      +  S+ GT  Y +     G   ++  D  +LG + +  L G+ P+ G+  
Sbjct: 337 ATPEEGENVNQLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNH 396

Query: 280 KAPNNKQKYEKIGEK 294
           K   NK K EK G +
Sbjct: 397 KIILNKIKQEKTGAR 411

>Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement
          Length = 374

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 76/159 (47%), Gaps = 22/159 (13%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVP 127
           +Y+I  KIG G +  +F G +++N     IK  +P K     +K  YR  KILT   G P
Sbjct: 85  NYEIVNKIGRGKYSEVFRGKSIVNDQACVIKVLKPVK-----MKKIYRELKILTNLSGGP 139

Query: 128 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCNRKFSVKTVVQVAVQMITLIEDL 180
                   GL +I+      +  L+   + ++ F      F++  +     Q++  +E  
Sbjct: 140 NVI-----GLLDIVQDPGSKIPALIFEEVRNVDFRTLYPTFTLSDIQYYFTQLLIALEYC 194

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           H+  +++RD+KP N ++         K+ LID+G+A+ Y
Sbjct: 195 HSMGIMHRDVKPQNVMID----PTERKLRLIDWGLAEFY 229

>Kwal_33.14554
          Length = 714

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 71/155 (45%), Gaps = 17/155 (10%)

Query: 70  YKIGKKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT-- 123
           ++  K IG+G+FG    V  + T  I  +   +K E  K +  QL        +L G+  
Sbjct: 303 FQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDS 360

Query: 124 PGVPQAYYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
           P V   YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEAIH 418

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
               I+RDIKPDN L+   GH     I L DFG++
Sbjct: 419 KLGFIHRDIKPDNILIDIRGH-----IKLSDFGLS 448

>YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine
           protein kinase of unknown function [1110 bp, 369 aa]
          Length = 369

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 96/222 (43%), Gaps = 32/222 (14%)

Query: 74  KKIGEGSFGVLFEGTNMINGLPVAIKFEPR-KTEAPQLKDEYRTYKILTGT---PGVPQA 129
           + I  G+F  +++  +  +   VA+K  P+ KT    +K+EY   KIL+     P +   
Sbjct: 6   RSIQSGTFSTVYKAWSTTHNRYVALKITPKYKTSEANMKNEYDVMKILSSCNPHPNICSM 65

Query: 130 YYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFS-----VKTVVQVAVQMI-----TLIED 179
             F  +  + I+V++       DL+D+ +   S       +++Q+ +Q I     + I  
Sbjct: 66  LDFYTDDSYYIMVLEYC--ECGDLYDFLDIAKSQGSPSSPSLIQIDMQKIIKQLCSAISF 123

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIP----YREKKS 235
            H+  + +RDIKP+N L+   G      I L D+G A Q   PK+         YR  ++
Sbjct: 124 AHSLGIAHRDIKPENILLTING-----DIKLADWGHAIQ--SPKSNDFQIGTDNYRAPET 176

Query: 236 LSGTARYMSINTHLGREQ-----SRRDDMEALGHVFFYFLRG 272
            SG         +  R       + + D  +LG   FY + G
Sbjct: 177 FSGRVSNSCFKKNFDRSSAPLYNTYQADYWSLGATIFYLMFG 218

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 111/272 (40%), Gaps = 59/272 (21%)

Query: 49  PASTASPPT--SMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK-- 104
           P ST S  T  S R     VG  +K+GK +G+GS G +    NM  G   AIK  P+K  
Sbjct: 59  PDSTVSVATKSSKRKSRDTVG-PWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKA 117

Query: 105 ----TEAPQLKDEYRTYKILT--GTPGVP--------QAYYFGQEGLHNILVIDLLGPS- 149
               +    + + Y +  + +   +P +         Q   +G E    I+++ L+  + 
Sbjct: 118 FVHCSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIE--REIVIMKLISHTN 175

Query: 150 -----------------LE-----DLFDW--CNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
                            LE     +LFD+     K   +  +    Q++  +   H+ ++
Sbjct: 176 VMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNI 235

Query: 186 IYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI 245
            +RD+KP+N L+ +       +I + DFGMA           +P +  K+  G+  Y S 
Sbjct: 236 CHRDLKPENLLLDKKNR----RIKIADFGMA--------ALELPNKLLKTSCGSPHYASP 283

Query: 246 NTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 276
              +GR       D+ + G V F  L G LP+
Sbjct: 284 EIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

>Kwal_14.1159
          Length = 1521

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 71/154 (46%), Gaps = 12/154 (7%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILTGTP 124
           Y + K I +G++G +F     I G   AIK   +     K +   +K E     + +  P
Sbjct: 677 YDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSNKP 736

Query: 125 GVPQAYYFGQEGLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAH 183
            V + Y   Q   +  LV++ L G  L  L          + V Q   ++I  +ED+H  
Sbjct: 737 YVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMG-SLPDQWVKQYISEVIYGVEDMHQS 795

Query: 184 DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
            +I+ D+KPDN L+ + GH     + L DFG+++
Sbjct: 796 GIIHHDLKPDNLLIDQRGH-----LKLTDFGLSR 824

>Scas_703.5
          Length = 749

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 106/236 (44%), Gaps = 35/236 (14%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPV-AIKFEPRKTEAPQLKDEYRTYKILTGT- 123
           +++ + +G+G+FG +++     T  I  + V + K   +K E      E R   + T T 
Sbjct: 344 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGE-RNILVTTATK 402

Query: 124 --PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK---FSVKTVVQVAVQMITLIE 178
             P +    +  Q      LV D +  S  +LF W  +K   F+ +       +++  +E
Sbjct: 403 ASPFIVGLKFSFQTPTDLYLVTDFM--SGGELF-WHLQKEGRFTEERAKFYIAELVLALE 459

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 237
            LH +D++YRD+KP+N L+      DAN  I L DFG++K     +T          +  
Sbjct: 460 YLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT---------NTFC 504

Query: 238 GTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 292
           GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 505 GTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 557

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 99/237 (41%), Gaps = 41/237 (17%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTP 124
           + + K IG+GSFG + +     T  +  L    K +   K+E      E RT       P
Sbjct: 347 FDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAE-RTVLARVDCP 405

Query: 125 G-VPQAYYF-GQEGLHNILVIDLLGPSL------EDLFDWCNRKFSVKTVVQVAVQMITL 176
             VP  + F   E L+ +L   + G  L      E  FD    +F          +++  
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAF-INGGELFYHLQKEGRFDLSRARF-------YTAELLCA 457

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK--QYRDPKTKQHIPYREKK 234
           +++LH  D++YRD+KP+N L+   GH     I L DFG+ K     D KT          
Sbjct: 458 LDNLHKLDVVYRDLKPENILLDYQGH-----IALCDFGLCKLNMKDDDKT---------D 503

Query: 235 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           +  GT  Y++    LG   ++  D   LG + +  L G  P+     P   + Y+KI
Sbjct: 504 TFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVP---KMYKKI 557

>Kwal_47.18233
          Length = 598

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILTGTP 124
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   P
Sbjct: 31  YQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 89

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLHA 182
            + + Y   +     ++VI+  G    +LFD+  +  K S     +   Q+I+ +E  H 
Sbjct: 90  HIIKLYDVVKSKDEIVMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 146

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
           H +++RD+KP+N L+     ++   + + DFG++    D
Sbjct: 147 HKIVHRDLKPENLLL-----DEHLNVKIADFGLSNIMTD 180

>Scas_707.3
          Length = 1598

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 88/199 (44%), Gaps = 22/199 (11%)

Query: 25  TPMQSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVL 84
           TP Q  S+L     N P++P       T +   +++D        Y I K I +G++G +
Sbjct: 664 TPEQHPSSLSF--SNQPLSPLLLATNQTKNLTPTIKD--------YTILKPISKGAYGSV 713

Query: 85  FEGTNMINGLPVAIKFEPR-----KTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGLHN 139
           +     I G   AIK   +     K +   +K E     + +  P V + +   Q   + 
Sbjct: 714 YLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAIMMVQSDKPYVARLFATFQNKENL 773

Query: 140 ILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVG 198
            LV++ L G  L  L          + V Q   ++I  ++D+H + +I+ D+KPDN L+ 
Sbjct: 774 FLVMEYLPGGDLATLIKMMGY-LPDQWVKQYLTEIIVGVDDMHRNWIIHHDLKPDNLLID 832

Query: 199 RPGHEDANKIHLIDFGMAK 217
             GH     + L DFG+++
Sbjct: 833 NLGH-----VKLTDFGLSR 846

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 98/214 (45%), Gaps = 18/214 (8%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT---EAPQLKDEYRTYKIL--TGTP 124
           Y  GK +G G+FGV+ +   + +G  VA+K   +K    ++ QL+  Y    IL     P
Sbjct: 46  YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNHP 105

Query: 125 GVP--QAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
            +   + ++  +E  + +  +   G   + + +    KF     V +  Q++  ++ LH 
Sbjct: 106 NIVRFKDWFESKEKFYIVTQLATGGELFDRILE--KGKFCEVDAVFIVKQILQGVQYLHQ 163

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
            ++++RD+KP+N L       D + + + DFG+AK+ +D     H         +G+  Y
Sbjct: 164 RNIVHRDLKPENILY--LNKSDDSPLVIGDFGIAKELKDDNELIH-------KAAGSMGY 214

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           ++          +  D+ ++G + +  L G  P+
Sbjct: 215 VAPEVLTSSGHGKPCDIWSIGVITYTLLCGYSPF 248

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 105/236 (44%), Gaps = 35/236 (14%)

Query: 70  YKIGKKIGEGSFGVLFE----GTNMINGLPV-AIKFEPRKTEAPQLKDEYRTYKILTGTP 124
           +++ + +G+G+FG +++     T  I  + V + K   +K E      E R   + T + 
Sbjct: 304 FEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGE-RNILVRTASK 362

Query: 125 GVPQAY---YFGQEGLHNILVIDLLGPSLEDLFDWCNRK---FSVKTVVQVAVQMITLIE 178
             P      +  Q      LV D L  S  +LF W  +K   F+ +       +++  +E
Sbjct: 363 SCPFIVGLKFSFQTPTDLYLVTDFL--SGGELF-WHLQKEGRFTEERAKFYIAELVLALE 419

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIPYREKKSLS 237
            LH +D++YRD+KP+N L+      DAN  I L DFG++K     +T          +  
Sbjct: 420 YLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT---------NTFC 464

Query: 238 GTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIG 292
           GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y+KI 
Sbjct: 465 GTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMYQKIA 517

>Scas_613.5
          Length = 517

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 102/232 (43%), Gaps = 35/232 (15%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYR-TYKILTGT--PG 125
           Y +GK +G G +  + EG N + G  VA+K F P++ +  +   ++R    IL     P 
Sbjct: 204 YVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHHPN 263

Query: 126 VPQAYYF-----GQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV--QMITLIE 178
           +     F      +  +   LV+D +     +LF+   +K  ++     A+  Q++  ++
Sbjct: 264 IVNLLDFFIEPVSKSQIQKYLVLDKIDDG--ELFERIVKKTCLRQDETKAIFNQILMGLK 321

Query: 179 DLHAHDLIYRDIKPDNFLVGR------------PGHEDANKIH--LIDFGMAKQYRDPKT 224
            LH  ++I+RDIKP+N L+              P  ED   I   + DFG+AK   +   
Sbjct: 322 HLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGE--- 378

Query: 225 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
                 +   +L GT  Y++      +  + + DM + G + +  L G  P+
Sbjct: 379 -----MQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPF 425

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 133/308 (43%), Gaps = 56/308 (18%)

Query: 70  YKIGKKIGEGSFGVLFEG--------TNMINGLP--VAIKFEPRKTEAPQLKDEYRTYKI 119
           Y +G  +GEG FG +  G        +N     P  VAIK   R + +   + E + Y+ 
Sbjct: 41  YILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVKIYRE 100

Query: 120 LTGTPGVPQAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCNRKFSVKTV--VQVAV 171
           +     +        +E L N   I ++   LE     + + +  +K  +K +   ++  
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIV---LEYACGGEFYKYIQKKRRLKEMNACRLFS 157

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANK-IHLIDFGMAKQYRDPKTKQHIPY 230
           Q+I+ +  +H+  L++RD+K +N L+      D N+ + + DFG   ++    ++  +  
Sbjct: 158 QLISGVHYIHSKGLVHRDLKLENLLL------DKNENLVITDFGFVNEF---CSRNEL-- 206

Query: 231 REKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
              K+  G+  Y +    +  E  ++R+ D+ + G + +  L G LPW     PNN +  
Sbjct: 207 --MKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDD--DPNNPEGS 262

Query: 289 EKIGEKKRTTNVYDLAQGLPIQFGRY-LEIVRNLSFEETPDYEGYRMLLLSALDDLGQSA 347
           + IG       +Y+     P++F  Y L I R+L           RML+      +    
Sbjct: 263 D-IGR------LYNYINSTPLKFPDYILPIPRDL---------LRRMLVSDPKKRINLKQ 306

Query: 348 DGEYDWMK 355
             +++W+K
Sbjct: 307 IKKHEWLK 314

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 97/222 (43%), Gaps = 27/222 (12%)

Query: 73   GKKIGEGSFGVLFEGTNMINGLPVAIK----------FEPRKTEAPQLKDEYRTYKILTG 122
            G+ IG+GSFG ++ G N+  G  +A+K           E     A  L  E  T K L  
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDH 1186

Query: 123  TPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
               V    +  +  ++++ +  + G S+  L       F  + +  +  Q++  +  LH 
Sbjct: 1187 LNIVQYLGFENKNCIYSLFLEYVAGGSVGSLIRLYGH-FDEQLIRFLTTQVLEGLAYLHL 1245

Query: 183  HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
              +++RD+K DN L+   G        + DFG++++        +I    + ++ GT  +
Sbjct: 1246 RGILHRDMKADNLLLDNDG-----VCKISDFGISRK------SNNIYSNSEMTMRGTVFW 1294

Query: 243  MS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
            M+   ++T  G   S + D+ +LG V      G+ PW  L+ 
Sbjct: 1295 MAPEMVDTTQG--YSAKVDIWSLGCVVLEMFAGKRPWSNLEV 1334

>Kwal_47.16761
          Length = 744

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 171 VQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIP 229
            +++  +E LH +D++YRD+KP+N L+      DAN  I L DFG++K     +T     
Sbjct: 442 AELVLALEYLHENDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 490

Query: 230 YREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
                +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 491 ----NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFFAEDNQKMY 543

Query: 289 EKIG 292
           +KI 
Sbjct: 544 QKIA 547

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILTGTP 124
           Y++ K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   P
Sbjct: 39  YQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 97

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLHA 182
            + + Y   +     I+VI+  G    +LFD+  +  K S     +   Q+I+ +E  H 
Sbjct: 98  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMSENEARRFFQQIISAVEYCHR 154

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
           H +++RD+KP+N L+     ++   + + DFG++    D
Sbjct: 155 HKIVHRDLKPENLLL-----DEHLNVKIADFGLSNIMTD 188

>Scas_654.12
          Length = 737

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 74  KKIGEGSFG----VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVP 127
           K IG+G+FG    V    T  I  +   +K E  K +  QL        +L G+  P V 
Sbjct: 323 KVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD--QLAHVKAERDVLAGSDSPWVV 380

Query: 128 QAYYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
             YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    
Sbjct: 381 SLYYSFQDTQYLYLIMEFLPGGDLMTMLIRW--QLFTEDVTRFYMAECILAIETIHKLGF 438

Query: 186 IYRDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
           I+RDIKPDN L+   GH     I L DFG++
Sbjct: 439 IHRDIKPDNILIDIRGH-----IKLSDFGLS 464

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 171 VQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIP 229
            +++  +E LH +D++YRD+KP+N L+      DAN  I L DFG++K     +T     
Sbjct: 448 AELVLALEHLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 496

Query: 230 YREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
                +  GT  Y++    L     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 497 ----NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG---WSPFYAEDNQKMY 549

Query: 289 EKIG 292
           +KI 
Sbjct: 550 QKIA 553

>ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH]
           complement(1062595..1063614) [1020 bp, 339 aa]
          Length = 339

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 76/158 (48%), Gaps = 22/158 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           Y+I  KIG G +  +F G +++N  P  IK  +P K     +K  YR  KILT   G P 
Sbjct: 50  YEIINKIGRGKYSEVFRGKSIVNDHPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 129 AYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCNRKFSVKTVVQVAVQMITLIEDLH 181
                  GL +I+      +  L+   ++++ F      F++        Q++  ++  H
Sbjct: 105 II-----GLLDIVQDPGSKIPALIFEEVKNVEFRTLYPAFTLSDTQHYFKQLLIALDYCH 159

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           +  +++RD+KP N ++         K+ LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMID----PTERKLRLIDWGLAEFY 193

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 77/158 (48%), Gaps = 22/158 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KILT   G P 
Sbjct: 50  YEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 129 AYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCNRKFSVKTVVQVAVQMITLIEDLH 181
                  GL +I+      +  L+   +++  F      F+++ +     Q++  ++  H
Sbjct: 105 VI-----GLLDIVQDQASKIPALIFEEVKNADFRTLYPSFTLQDLQYYFTQLLIALDYCH 159

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           +  +++RD+KP N ++  P  +   K+ LID+G+A+ Y
Sbjct: 160 SMGIMHRDVKPQNVMID-PAQK---KLRLIDWGLAEFY 193

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 125/310 (40%), Gaps = 46/310 (14%)

Query: 34  RLLNGNLPMTPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING 93
           R  NGNLP  PA   PAS   P T +    ++   + +I  ++GEG++G +++  N+   
Sbjct: 89  RYNNGNLPAPPAG--PASLRVPATIITHTHSVESSYQRI-TQVGEGTYGKVYKCRNIYTN 145

Query: 94  LPVAIKFEPRKTEAPQLK-DEYRTYKIL-----TGTPGVPQAYYFGQEGLHNILVIDLLG 147
             VA+K    +TE         R  K+L          + +     Q+ ++  ++ +   
Sbjct: 146 KLVALKKLRLETERDGFPITSIREIKLLQHCQHENVSTIAEIMCEAQKTVY--MIFEYAD 203

Query: 148 PSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANK 207
             L  L       FS      +  Q++  +E LH   +++RDIK  N L+   G+     
Sbjct: 204 NDLSGLLMNKEIHFSDANCKHLFRQLLKGMEYLHECRILHRDIKGSNILIDNRGN----- 258

Query: 208 IHLIDFGMAKQYR-DPKTKQHIP---YREKKSLSGTARY-----------MSINTHL--- 249
           + + DFG+A++ + +P     +    YR  + L GT RY           + +   L   
Sbjct: 259 LKITDFGLARKMKQEPDYTNRVITLWYRPPELLLGTTRYGTEVDMWGCGCLLVELFLKAA 318

Query: 250 -----GREQSRRDDMEALGHVFFYFLRG--QLPWQGLKAPNNKQKY-----EKIGEKKRT 297
                   +  R   + LG        G   +PW  +  P  K+ Y     EK+     T
Sbjct: 319 FFQGTNELEQLRCIFQVLGTPTIEQWPGLFDMPWWFMMIPQQKENYPSRFDEKVSGVLPT 378

Query: 298 TNVYDLAQGL 307
            +  DLA+GL
Sbjct: 379 QSCRDLARGL 388

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 115/258 (44%), Gaps = 30/258 (11%)

Query: 34  RLLNGNLPMTPANQTPASTASPPTSMRD-------DSTIVGLHYKIGKKIGEGSFGVLFE 86
           RL   N    P   +P S  SP +  R+       ++ +    +++G+K+G+G FG ++ 
Sbjct: 57  RLFLKNQERKPLGVSPLSNLSPNSLGRNSLEKSTYNNKLSLKDFEVGRKLGKGKFGKVYC 116

Query: 87  GTNMINGLPVAIKFEPRKTEAPQ---LKDEYRTYKILTGT--PGVPQAY--YFGQEGLHN 139
             +  +G   A+K    K E  Q   LK   R   I  G   P + + Y  +  ++ ++ 
Sbjct: 117 VRHKKSGFICALK-AIEKNEILQFNLLKQLKREVDIQLGMDHPNIIKLYAHFHDEKRVYL 175

Query: 140 ILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGR 199
           ++   + G   + L +  N  F+         Q+   +  +H   +I+RD+KP+N L+G 
Sbjct: 176 LMEHSINGELYKSLKN--NGPFNDVLASHYIYQIADALHYMHKKRIIHRDVKPENVLIGF 233

Query: 200 PGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDM 259
                 N + L DFG +    +P+  +      +K+L GT  Y+S      RE   + D+
Sbjct: 234 -----DNVVKLADFGWS--ILNPEGSK------RKTLCGTIDYLSPEMITPREYDEQVDV 280

Query: 260 EALGHVFFYFLRGQLPWQ 277
            ALG + +  + G  P++
Sbjct: 281 WALGVLAYELVVGVPPFE 298

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 69/150 (46%), Gaps = 15/150 (10%)

Query: 74  KKIGEGSFG----VLFEGTNMINGLPVAIKFEP-RKTEAPQLKDEYRTYKILTGTPGVPQ 128
           K IG+G+FG    V  + T  I  +   +K E   K +   +K E R     + +P V  
Sbjct: 307 KVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAE-RDVLAGSDSPWVVS 365

Query: 129 AYYFGQEGLHNILVIDLL--GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLI 186
            YY  Q+  +  L+++ L  G  +  L  W  + F+         + I  IE +H    I
Sbjct: 366 LYYSFQDSQYLYLIMEFLPGGDLMTMLIRW--QIFTEDVTRFYMAECILAIEVIHKLGFI 423

Query: 187 YRDIKPDNFLVGRPGHEDANKIHLIDFGMA 216
           +RDIKPDN L+   GH     I L DFG++
Sbjct: 424 HRDIKPDNILIDIRGH-----IKLSDFGLS 448

>Scas_580.6
          Length = 1015

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 98/221 (44%), Gaps = 19/221 (8%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           V   ++  + IG G FG++++G ++      AIK     ++  +++D  R  + L+    
Sbjct: 33  VNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 126 VPQ-AYYFGQEGLHNILVIDL---LGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
           +P    Y+G       L I +    G SL  L      K   K +  +  +++  ++ +H
Sbjct: 93  IPNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPG--KIDEKYIGVIMRELLVALKYIH 150

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
             ++I+RDIK  N L+   G      + L DFG+A Q      +       +++++GT  
Sbjct: 151 KDNVIHRDIKAANVLITNEG-----SVKLCDFGVAAQLNQSTLR-------RQTMAGTPY 198

Query: 242 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 199 WMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEA 239

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 12/123 (9%)

Query: 160 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           +FS+        +++  ++ LH  D+IYRD+KP+N L+   GH     I L DFG+ K  
Sbjct: 438 RFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGH-----IALCDFGLCKLN 492

Query: 220 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 279
                K         +  GT  Y++    LG+  ++  D   LG + +  + G  P+   
Sbjct: 493 MKDNDKT-------DTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDE 545

Query: 280 KAP 282
             P
Sbjct: 546 NVP 548

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 19/216 (8%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQ-----LKDEYRTYKILTGTP 124
           Y   + +G GSFGV+     + +   VA+K   ++          + DE    + L    
Sbjct: 65  YLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPN 124

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWC--NRKFSVKTVVQVAVQMITLIEDLHA 182
            V    +F  E      ++  L    E LFD    + K++ +  V + VQ++  +E LH+
Sbjct: 125 IVKFKDWFETES--KFYIVTQLASGGE-LFDRIMHDGKYTEEDAVNIVVQILKAVEYLHS 181

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
            ++I+RD+KP+N L      +  ++I L DFG+A+Q  +      + YR     +G+  Y
Sbjct: 182 QNIIHRDLKPENLLYLDKSKD--SRIVLADFGIARQLEND---DDVIYRP----AGSLGY 232

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
           ++          +  D+ ++G + +  L G  P++ 
Sbjct: 233 VAPEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKA 268

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 15/107 (14%)

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIP 229
           A ++   +E LH+ D+IYRD+KP+N L+ + GH     I L DFG AK   D      + 
Sbjct: 180 AAEVCLALEYLHSKDIIYRDLKPENILLDKNGH-----IKLTDFGFAKYVPD------VT 228

Query: 230 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           Y    +L GT  Y++      +  ++  D  + G + +  L G  P+
Sbjct: 229 Y----TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPF 271

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 76/159 (47%), Gaps = 22/159 (13%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVP 127
           +Y+I  KIG G +  +F G  ++N     IK  +P K     +K  YR  KILT   G P
Sbjct: 49  NYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVK-----MKKIYRELKILTNLTGGP 103

Query: 128 QAYYFGQEGLHNIL------VIDLLGPSLEDL-FDWCNRKFSVKTVVQVAVQMITLIEDL 180
                   GL++I+      +  L+   ++++ F      F +  +     Q++  ++  
Sbjct: 104 NVV-----GLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYC 158

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           H+  +++RD+KP N ++         K+ LID+G+A+ Y
Sbjct: 159 HSMGIMHRDVKPQNVMID----PTERKLRLIDWGLAEFY 193

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 116/266 (43%), Gaps = 61/266 (22%)

Query: 36  LNGNLPMTPANQTPASTASPPTSM--RDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMING 93
           +NG  PM   N    S   PP ++  + + +I G HY++ + +G+GS+G +    + +N 
Sbjct: 41  MNGIAPM---NLIEKSVVHPPRTIYTKANFSIPG-HYEVLQMLGKGSYGTVVSAIDNLNA 96

Query: 94  -LPVAIKFEPRKTEAPQ----LKDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGP 148
             P+ I  + + T   Q    LK   R  K +         Y+ G + + +++ ++++  
Sbjct: 97  NYPIRIAIK-KITNIFQREVLLKRAIRELKFM--------HYFKGHKNIVSLINLEIVNE 147

Query: 149 -------SLEDLFDW-------CNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 194
                    ++L D+        N +FS   +     Q++  ++ +H+ D+I+RD+KP N
Sbjct: 148 KPYDGLYCYQELIDYDLARVIHSNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGN 207

Query: 195 FLVGRPGHEDANKIHLIDFGMAK----QYRDPKTKQHIP-------YREKKSLSGTARYM 243
            L    G     ++ + DFG+A+     + + KT  HI        YR  + +    RY 
Sbjct: 208 ILCSISG-----QLKICDFGLARGISPLFTNTKTSNHITNYVATRWYRAPELILSHKRY- 261

Query: 244 SINTHLGREQSRRDDMEALGHVFFYF 269
                     ++  DM A+G +   F
Sbjct: 262 ----------NKSIDMWAIGCILAEF 277

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 84/200 (42%), Gaps = 37/200 (18%)

Query: 112 DEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV 171
           D ++ Y +L   PG    Y+  ++G  + + +      +      C  KF          
Sbjct: 235 DHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAAEIS-----CALKF---------- 279

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK----QYRDPKTKQH 227
                   LH+  ++YRD+KP+N L+   GH     + L DFG++K    Q   P   + 
Sbjct: 280 --------LHSKGIVYRDLKPENCLLDDKGH-----LVLTDFGLSKRGVNQADSPLGGEQ 326

Query: 228 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQK 287
           +   E  S+ GT  Y +     G+  ++  D  +LG + +  L G+ P+ G    N+K  
Sbjct: 327 V--EELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTG---ANHKVI 381

Query: 288 YEKIGEKKRTTNVYDLAQGL 307
             KI + K     + L+ G+
Sbjct: 382 LSKIKQDKGIKIPHYLSDGM 401

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 172 QMITLIEDLHAH-DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPY 230
           Q+++ I  LH    + +RDIKP+N L+ + G+     + L DFG+A Q+R       +  
Sbjct: 124 QLVSAINYLHVECGVAHRDIKPENILLDKNGN-----LKLADFGLASQFRRKDGTLRVSM 178

Query: 231 REKKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQ 277
            ++    G+  YM+       E   + R D+ ++G + F  L GQ PW+
Sbjct: 179 DQR----GSPPYMAPEVLYSEEGYYADRTDIWSIGILLFVLLTGQTPWE 223

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 79/159 (49%), Gaps = 16/159 (10%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAP-----QLKDEYRTYKILTGTP 124
           Y+I K +GEGSFG +    ++  G  VA+K   +K  A      +++ E  +Y  L   P
Sbjct: 35  YQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREI-SYLRLLRHP 93

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--KFSVKTVVQVAVQMITLIEDLHA 182
            + + Y   +     I+VI+  G    +LFD+  +  K   +   +   Q+I+ ++  H 
Sbjct: 94  HIIKLYDVIKSKDEIIMVIEYAG---NELFDYIVQRDKMPEQEARRFFQQIISAVDYCHR 150

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD 221
           H +++RD+KP+N L+     ++   + + DFG++    D
Sbjct: 151 HKIVHRDLKPENLLL-----DEHLNVKIADFGLSNIMTD 184

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 171 VQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQYRDPKTKQHIP 229
            +++  +E LH +D++YRD+KP+N L+      DAN  I L DFG++K     +T     
Sbjct: 433 AELVLALEYLHDNDIVYRDLKPENILL------DANGNIALCDFGLSKADLKDRT----- 481

Query: 230 YREKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
                +  GT  Y++    +     ++  D  +LG + F    G   W    A +N++ Y
Sbjct: 482 ----NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG---WSPFFASDNQKMY 534

Query: 289 EKIG 292
           +KI 
Sbjct: 535 QKIA 538

>YKL171W (YKL171W) [3100] chr11 (127480..130266) Serine/threonine
           protein kinase of unknown function [2787 bp, 928 aa]
          Length = 928

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 91/188 (48%), Gaps = 16/188 (8%)

Query: 46  NQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEP 102
           N  P S ++  ++  DD  +  L +++GK IG G++G++ E  ++  G+   IK   F+ 
Sbjct: 425 NSNPLSGSAGGSARPDDKGMEILGHRLGKIIGFGAWGIIRECFDIETGVGRVIKIVKFKG 484

Query: 103 RKTEAPQLKDEYRTYKILTGTPGVP---------QAYYFGQEGLHNILVIDLLGPSLEDL 153
            +     +  E   ++ L     +P          A Y   E +++  + DL+     D 
Sbjct: 485 HQNIKKHVLREVAIWRTLKHNRILPLLDWKLDDNYAMYCLTERINDGTLYDLVIS--WDE 542

Query: 154 FDWCNRKFS--VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLI 211
           F      F+   +  + +++Q+++ ++ +H+  +++ DIK +N L+ + G +   K+ L 
Sbjct: 543 FKRSKIPFAERCRLTIFLSLQLLSALKYMHSKTIVHGDIKLENCLLQKEGKKSDWKVFLC 602

Query: 212 DFGMAKQY 219
           DFGM+  +
Sbjct: 603 DFGMSCHF 610

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 67/139 (48%), Gaps = 10/139 (7%)

Query: 152 DLFDWC-NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL 210
           DLF    + K S + +     Q++T +E LH+  L +RD+K DN ++   G      + L
Sbjct: 508 DLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVINNQG-----IVKL 562

Query: 211 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 269
           IDFG A+ +  P +K  I   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 563 IDFGAAEVFSYPHSKTLI---ESSGIVGSDPYLAPEVCIFTKYDPRPVDIWSVAILFACM 619

Query: 270 LRGQLPWQGLKAPNNKQKY 288
           +  + PW+  K  +N  K+
Sbjct: 620 VLKKFPWKIPKLKDNSFKF 638

>Kwal_26.8796
          Length = 796

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 94/215 (43%), Gaps = 25/215 (11%)

Query: 76  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVPQAYYFG 133
           +G+G+F  + +      G   A+K   ++     +    R  ++L     P +     F 
Sbjct: 194 VGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMDGVARELEVLQRLDHPRIVSLKGFY 253

Query: 134 QEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIK 191
           ++   + LV++ +  S  DL D+     SV      ++  Q++  ++ +H+  + +RD+K
Sbjct: 254 EDKDSHYLVMEFV--SGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHRDLK 311

Query: 192 PDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR 251
           PDN L+ R   +D   + + DFG+AK   +            K+  GT  Y++     G+
Sbjct: 312 PDNILIER---DDPVLVKITDFGLAKIQGNGTF--------MKTFCGTLAYVAPEVISGK 360

Query: 252 EQSRRD--------DMEALGHVFFYFLRGQLPWQG 278
               ++        DM ++G + +  L G LP+ G
Sbjct: 361 NSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSG 395

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 102/238 (42%), Gaps = 35/238 (14%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           Y +GK +G G + ++ E  N   G  VA+K F P++ +  +   ++R    +      P 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPN 252

Query: 129 AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV--QMITLIE 178
                        +  +   LV++ +     +LFD   +K S+      A+  Q++T ++
Sbjct: 253 IVNLLDSFVEPISKTQIQKYLVLEKIDDG--ELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 179 DLHAHDLIYRDIKPDNFLVGR------------PGHEDANKIH--LIDFGMAKQYRDPKT 224
            LH+ ++I+RDIKP+N L+              P  ED   I   + DFG+AK   + + 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 370

Query: 225 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282
                     +L GT  Y++    + +  + + D+ + G + +  L G  P+     P
Sbjct: 371 TN--------TLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 420

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 93/236 (39%), Gaps = 61/236 (25%)

Query: 71  KIGKKIGEGSFGVLFEG-TNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQA 129
           ++G  IGEGSFG +        + + VA+KF    T A                 G+ Q 
Sbjct: 15  ELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAES---------------GLSQK 59

Query: 130 YYFGQEGLH-------NIL-VIDL------LGPSLE-----DLFDWCNRKFSVK-TVVQV 169
               +  LH       N+L VID       L   LE     DLFD       V   V Q 
Sbjct: 60  DVSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQF 119

Query: 170 AVQ-MITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHI 228
             Q +I  +  LH   + +RDIKP+N L+ + G+     + L DFG+A Q+R       +
Sbjct: 120 YFQQLIRALNYLHDVGVAHRDIKPENILLDKKGN-----LKLADFGLASQFRRKDGTLRV 174

Query: 229 --------PYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
                   PY   + LS    Y +I            D+ + G + F  L G++PW
Sbjct: 175 STDQRGSPPYMAPEILSSQGYYANIT-----------DIWSAGVLLFVLLTGEIPW 219

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 108/253 (42%), Gaps = 50/253 (19%)

Query: 66   VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK------FEPRKTEAPQLKDEYRTYKI 119
            V + ++    IG G+FG ++   ++ NG  +A+K       +  +   P +K+E    +I
Sbjct: 1262 VSMRWQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEI 1321

Query: 120  LTGTPGVPQAYYFGQEGLH----NILVIDLLGPSLEDLFDWCNRKFSVKTVVQV-AVQMI 174
            L   P +    Y+G E +H    NI +    G SL  L +  + +   + V QV  +Q++
Sbjct: 1322 LNH-PNI--VSYYGVE-VHRDKVNIFMEYCEGGSLAALLE--HGRIEDEMVTQVYTLQLL 1375

Query: 175  TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTK--------- 225
              +  LH   +++RD+KP+N L+   G      I  +DFG AK+  +  T+         
Sbjct: 1376 EGLAYLHESGIVHRDVKPENILLDFNG-----VIKYVDFGAAKKIANNGTRLASMNKIEN 1430

Query: 226  --------QHIPYREKK--------SLSGTARYM---SINTHLGREQSRRDDMEALGHVF 266
                     H+   +           + GT  YM   SI     + +   DD+ +LG V 
Sbjct: 1431 ADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVV 1490

Query: 267  FYFLRGQLPWQGL 279
               + G+ PW  L
Sbjct: 1491 LEMITGRRPWANL 1503

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 18/145 (12%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYR 231
           Q+   ++ +H  ++I+RDIKP+N L+G       N I L DFG +    +P      P  
Sbjct: 210 QIANALDYMHKKNIIHRDIKPENILIGF-----NNVIKLTDFGWS--IINP------PEN 256

Query: 232 EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
            +K++ GT  Y+S      RE     D  ALG + F  L G  P++          Y++I
Sbjct: 257 RRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFE---EEMKDTTYKRI 313

Query: 292 G--EKKRTTNVYDLAQGLPIQFGRY 314
              + K  +N+   AQ L ++  +Y
Sbjct: 314 AALDIKMPSNISQDAQDLILKLLKY 338

>CAGL0M08316g 829069..831963 weakly similar to sp|P36003
           Saccharomyces cerevisiae YKL171w, hypothetical start
          Length = 964

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 113/245 (46%), Gaps = 29/245 (11%)

Query: 19  LTNTTNTPMQSASNLRLLNGNLP---MTPANQTPASTASPPTSMRDDSTIVGLHYKIGKK 75
           +TN+ +       ++R  +G+L    ++  + + AS AS      DD  +  + +K+GK 
Sbjct: 433 ITNSKSASSIQKPSMRSRHGSLASQFLSSFSPSVASMASSGGFRPDDKGLFIMGHKLGKV 492

Query: 76  IGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQLKDEYRTYKILTGTPGVP----- 127
           IG G++G++ E  ++ +G   A+K   F+  +     +  E   +K +     +P     
Sbjct: 493 IGFGAWGMIRECVDIQSGAQRAMKIVRFKDNQKVKRNVIREVNVWKEMHHMYILPLLDWK 552

Query: 128 ----QAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFS-------VKTVVQVAVQMITL 176
                A Y   E + +  + DL+         W +RK +       +K  + + +Q+I+ 
Sbjct: 553 LISDYAMYCLTERVKDGTLYDLV-------LSWEDRKNNQIPVDERIKLTMFLMLQLISA 605

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSL 236
           ++ +H++  ++ DIK +N L+ +        I L DFGM+ ++   +++      E+K+ 
Sbjct: 606 LKYMHSNSTVHGDIKLENCLLKKGRQHKNWTIFLCDFGMSCRFGSYRSRYDTLIDEEKNN 665

Query: 237 SGTAR 241
           SG  R
Sbjct: 666 SGIIR 670

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 90/205 (43%), Gaps = 20/205 (9%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P       +         
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHGQRIVALKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 126 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWC--NRKFSVKTVVQVAVQMITLIEDLHA 182
           + + Y       H + LV + L   L+   +    ++    K + +  +Q+   I   HA
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLELDLKRYMESVPKDQPLGDKIIKKFMMQLCKGIAYCHA 126

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           H +I+RD+KP N L+ R G+     + L DFG+A+ +        +P R       T  Y
Sbjct: 127 HRIIHRDLKPQNLLINRNGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLWY 174

Query: 243 MSINTHLGREQ-SRRDDMEALGHVF 266
            +    LG +Q S   D+ ++G +F
Sbjct: 175 RAPEVLLGGKQYSTGVDVWSIGCIF 199

>Kwal_33.14434
          Length = 759

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 66/138 (47%), Gaps = 10/138 (7%)

Query: 152 DLFDWC-NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL 210
           DLF    + K S + +     Q++T ++ LH+  L +RD+K DN ++ + G      + L
Sbjct: 489 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAHRDLKLDNCVINKHG-----VVKL 543

Query: 211 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 269
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ ++  +F   
Sbjct: 544 IDFGAAAVFSYPFSKTLV---ESSGIVGSDPYLAPEVCIFSKYDPRPVDVWSVAIIFACM 600

Query: 270 LRGQLPWQGLKAPNNKQK 287
           +  + PW+  K  +N  K
Sbjct: 601 VLKKFPWKIPKLKDNSFK 618

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 97/221 (43%), Gaps = 27/221 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQLKDEYRTYKILTGTPGV 126
           +K  + IG G FGV+++  ++      AIK    +  + E   ++ E +    L  TP +
Sbjct: 16  FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNI 75

Query: 127 PQAYYFGQEGLHNILVIDL---LGPSLEDLFD--WCNRKFSVKTVVQVAVQMITLIEDLH 181
              +Y+G   +   L + +    G SL  L        K+    + ++ V +I++    H
Sbjct: 76  --THYYGSYLIDTKLWVIMEYCAGGSLRTLLRPGIIEEKYIGVIMREILVALISI----H 129

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
             ++I+RDIK  N L+   G      + L DFG+A Q      K       +++++GT  
Sbjct: 130 RDNVIHRDIKAANILIANNG-----SVKLCDFGVAAQLSQSMLK-------RQTMAGTPY 177

Query: 242 YMSINTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
           +M+    + G     + D+ +LG   +    G  P+  ++A
Sbjct: 178 WMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEA 218

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 74/159 (46%), Gaps = 17/159 (10%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---------FEPRKTEAPQLKDEYRTYK- 118
           HYK+   IGEG++G++    +   G  VAIK         F  R     +L   + +++ 
Sbjct: 12  HYKLVDLIGEGAYGIVCSAIHKPTGTKVAIKKIQPFTRPMFVTRTLRELKLLKFFHSHEN 71

Query: 119 ILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIE 178
           I++    V    Y   E ++  LV +L+   L+ +    N   S   +     Q++  ++
Sbjct: 72  IISVLDIVRPTSYQDFEAVY--LVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALK 129

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
            LH+  +I+RD+KP N L+       +  + L DFG+++
Sbjct: 130 SLHSAQVIHRDLKPSNLLLN-----SSCDLKLCDFGLSR 163

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 91/217 (41%), Gaps = 22/217 (10%)

Query: 67  GLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGV 126
            + Y++ + IG GS+GV+++ TN      VAIK E    +  +L D      +L     +
Sbjct: 19  SVQYQLRQIIGRGSYGVVYKATNKKTAQEVAIK-EVNYQDDDELVDIMSEIDLLKNLNHI 77

Query: 127 PQAYYFG----QEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
               Y G    Q  L+ IL     G SL++L    NR  S         Q +  +  LH 
Sbjct: 78  NIVKYHGFIQKQHNLYIILEYCAKG-SLKNLISR-NRPMSEHEAKPYVRQTLNGLNYLHE 135

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
             +I+RDIK  N L+     +  N + L DFG++ +  +             +L+G+  +
Sbjct: 136 QGVIHRDIKAANILL-----DSENVVKLADFGVSTKVNNTAM----------TLAGSLNW 180

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 279
           M+      R  S   D+ +LG      L G  P+  L
Sbjct: 181 MAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNL 217

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 96/223 (43%), Gaps = 45/223 (20%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-------------FEPRKTEAPQLKDEYR 115
           +Y+I K++GEGSFG ++  T+ +    V +K             F  R+ E P +   Y 
Sbjct: 36  NYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYHRQFEYPFITKLYE 95

Query: 116 TYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMIT 175
              I+T T       Y     L++ L++    P      D   R F+         Q+++
Sbjct: 96  V--IVTETRVWMALEYCPGNELYDYLLLKQRIP-----LDETRRLFA---------QIVS 139

Query: 176 LIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKS 235
            +   H+   ++RD+K +N L+ + G+       L DFG     R+  TK  +     ++
Sbjct: 140 AVFYAHSLQCVHRDLKLENILLDKNGY-----AMLTDFGFT---RECATKTQL-----ET 186

Query: 236 LSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 276
           + GT  YM+    + RE     + D  +LG + +  L G +P+
Sbjct: 187 VCGTTVYMAPEL-IKREAYDGYKVDTWSLGIILYTMLHGYMPF 228

>Scas_616.10
          Length = 1461

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 102/264 (38%), Gaps = 59/264 (22%)

Query: 57  TSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRK------------ 104
           +S R     VG  +K+GK +G+GS G +    N+  G   AIK  P+K            
Sbjct: 89  SSKRKSRDTVG-PWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNV 147

Query: 105 ----------------TEAPQL-----KDEYRTYKI--------LTGTPGVPQAYYFGQE 135
                             +P +     K++   Y I        L   P V   Y   + 
Sbjct: 148 SFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWEN 207

Query: 136 GLHNILVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPD 193
                LV++ +     +LFD+   K   S K  V    Q+I  +   H+ ++ +RD+KP+
Sbjct: 208 KSELYLVLEYVDGG--ELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPE 265

Query: 194 NFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE- 252
           N L+ +        I + DFGMA           +P +  ++  G+  Y S    +G+  
Sbjct: 266 NLLLDKKNKS----IKIADFGMA--------ALELPNKLLQTSCGSPHYASPEIVMGKSY 313

Query: 253 QSRRDDMEALGHVFFYFLRGQLPW 276
                D+ + G + F  L G LP+
Sbjct: 314 HGGPSDVWSCGIILFALLTGHLPF 337

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 100/228 (43%), Gaps = 37/228 (16%)

Query: 70  YKIGKKIGEGSFGVLFEG-TNMINGLP---------VAIKFEPRKTEAPQLKDEYRTYKI 119
           Y +G  +GEG FG +  G T   +  P         VAIK   R T     + E + Y+ 
Sbjct: 44  YIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYRE 103

Query: 120 LTGT-----PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVK--TVVQVAVQ 172
           +        P V +     Q   +  +V++    S  + + +  RK  +K  T  ++  Q
Sbjct: 104 INALKHLTHPNVVRLEEVLQNSKYIGIVLEYA--SGGEFYKYIQRKRRLKESTACRLFAQ 161

Query: 173 MITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANK-IHLIDFGMAKQYRDPKTKQHIPYR 231
           +I+ +  +H+ +L++RD+K +N L+      D N+ + + DFG   ++        +P  
Sbjct: 162 LISGVTYMHSKNLVHRDLKLENLLL------DKNENLVITDFGFVNEF--------LPDN 207

Query: 232 E-KKSLSGTARYMSINTHLGREQ--SRRDDMEALGHVFFYFLRGQLPW 276
           E  K+  G+  Y +    +      +R+ D+ + G + +  L G LPW
Sbjct: 208 EYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPW 255

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 104/239 (43%), Gaps = 35/239 (14%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRT-YKILTG---- 122
            Y  GK++G G + ++ E  N I G  VA+K F P+K +  +   ++R   KIL G    
Sbjct: 154 RYIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHE 213

Query: 123 -TPGVPQAYY--FGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV--QMITLI 177
               + + +     +  +   LV++ +     +LFD   RK  +      A+  Q++  +
Sbjct: 214 NIVKLLERFVEPLSKSQVQTYLVLEKIQDG--ELFDKIVRKTKLHQDETRALFKQILAGL 271

Query: 178 EDLHAHDLIYRDIKPDNFLVGR------------PGHEDANKI--HLIDFGMAKQYRDPK 223
           + LH  ++I+RDIKP+N L+              P  ED   I   + DFG+AK   +  
Sbjct: 272 KYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGE-- 329

Query: 224 TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282
                  +   +L GT  Y++         + + D+ + G + +  L G  P+    AP
Sbjct: 330 ------MQFTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAP 382

>Kwal_56.24091
          Length = 381

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%), Gaps = 13/117 (11%)

Query: 161 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYR 220
           F+  T      QM   +  +H+ ++++RDIKP+N L+G       N + L DFG +    
Sbjct: 218 FNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF-----QNTLKLTDFGWS---- 268

Query: 221 DPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
                 ++   ++K+L GT  Y+S      RE   + D+ ALG + +  L G  P++
Sbjct: 269 ----VSNVGNSKRKTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPFE 321

>Kwal_26.8709
          Length = 829

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 98/227 (43%), Gaps = 39/227 (17%)

Query: 70  YKIGKKIGEGSFGVLFEG----TNMINGLP--VAIKFEPRKTEAPQLKDEYRTYKILTGT 123
           Y +G  +GEG FG +  G    +N    +P  VAIK   R T     + E + Y+ +   
Sbjct: 40  YIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYREINAL 99

Query: 124 PGV--PQAYYFGQEGLHNILVIDLLGPSLE-----DLFDWCNRKFSVKT--VVQVAVQMI 174
             +  P      +E L N   I ++   LE     + + +  +K  +K     ++  Q+I
Sbjct: 100 KHLNHPNIVRL-EEVLQNSKYIGIV---LEYASGGEFYKYIQKKRRLKEGPACRLFAQLI 155

Query: 175 TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLI-DFGMAKQYRDP----KTKQHIP 229
           + +  +H+  L++RD+K +N L+      D N+  LI DFG   ++       KT    P
Sbjct: 156 SGVYYMHSKGLVHRDLKLENLLL------DKNENLLITDFGFVNEFLPENELMKTSCGSP 209

Query: 230 YREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
                 L  TAR           ++R+ D+ + G + +  L G LPW
Sbjct: 210 CYAAPELVVTARPY---------EARKADVWSCGVILYAMLAGYLPW 247

>Scas_700.54
          Length = 698

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 109/245 (44%), Gaps = 31/245 (12%)

Query: 62  DSTIVGLHYKIG---KKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYK 118
           +ST+ G+        + +G+G+F  + +      G   A+K   ++     ++   R  +
Sbjct: 212 ESTLTGIFKDFSIQDEVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSRELE 271

Query: 119 ILTGT--PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSV--KTVVQVAVQMI 174
           +L     P + +   F ++     +V++ +     DL D+     +V  +   +++ Q++
Sbjct: 272 VLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGG--DLMDFVAAHGAVGEEAGKEISRQIL 329

Query: 175 TLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKK 234
             ++ +H+  + +RD+KPDN L+ +   +D   + + DFG+AK   +            K
Sbjct: 330 EAVKYIHSKGISHRDLKPDNILIEQ---DDPVLVKITDFGLAKVQGNGSF--------MK 378

Query: 235 SLSGTARYMSINTHLGR--------EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQ 286
           +  GT  Y++     G+        E S   DM ++G + +  L G LP+ G      +Q
Sbjct: 379 TFCGTLAYVAPEVIGGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPFSG---STQEQ 435

Query: 287 KYEKI 291
            Y++I
Sbjct: 436 LYKQI 440

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 92/207 (44%), Gaps = 24/207 (11%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILTGT-- 123
           YK  +K+GEG++GV+++  ++ +G  +     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGNRIVALKKIRLESEDEGVPS--TAIREISLLKELRD 64

Query: 124 PGVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMITLIEDL 180
             + + Y       H + LV + L   L+   +   ++     K + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPLGNKIIKKFMMQLCKGIAYC 124

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           HAH +++RD+KP N L+ R G+     + L DFG+A+ +        +P R       T 
Sbjct: 125 HAHRILHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 172

Query: 241 RYMSINTHLGREQ-SRRDDMEALGHVF 266
            Y +    LG +Q S   D+ ++G +F
Sbjct: 173 WYRAPEVLLGGKQYSTGVDIWSIGCIF 199

>Kwal_23.6458
          Length = 868

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 52/121 (42%), Gaps = 19/121 (15%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPK-------- 223
           +++  IE LH    IYRD+KP+N L+ + GH     I L DF ++ Q +D K        
Sbjct: 572 EVVAAIEYLHLMGFIYRDLKPENILLHKSGH-----IMLSDFDLSVQAKDTKNPVVKGSA 626

Query: 224 ------TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
                 TK         S  GT  Y++     G   +   D   LG + +  L G  P++
Sbjct: 627 QSSLLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYK 686

Query: 278 G 278
           G
Sbjct: 687 G 687

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 59/120 (49%), Gaps = 12/120 (10%)

Query: 161 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLV----GRPGHEDANKIHLIDFGMA 216
            + + +V +A  + T ++ LH+  +I+RD+KP N L+     R   +   K  + DFG +
Sbjct: 211 LTTRQIVSIANDIATGLKQLHSLRIIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES 270

Query: 217 KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           + Y           R+    +GT  +++     G + S + D+ A G + ++ + GQLP+
Sbjct: 271 QLYGQ--------LRDATGSTGTVEFVAPELTKGAQFSFKSDIYAFGMILYFVIMGQLPF 322

>Kwal_27.11919
          Length = 209

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 93/211 (44%), Gaps = 32/211 (15%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILTGTP- 124
           YK  +K+GEG++GV+++  ++ +G  V     I+ E      P      R   +L     
Sbjct: 7   YKRLEKVGEGTYGVVYKALDLRHGQRVVALKKIRLESEDEGVPS--TAIREISLLKELKD 64

Query: 125 -GVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCNRK--FSVKTVVQVAVQMITLIEDL 180
             + + Y       H + LV + L   L+   +   ++       + +  +Q+   I   
Sbjct: 65  DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPKEQPLGDNIIKKFMMQLCKGIAYC 124

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP-KTKQH----IPYREKKS 235
           H+H +++RD+KP N L+ R G+     + L DFG+A+ +  P +   H    + YR  + 
Sbjct: 125 HSHRILHRDLKPQNLLINRDGN-----MKLADFGLARAFGVPLRAYTHEIVTLWYRAPEV 179

Query: 236 LSGTARYMSINTHLGREQSRRDDMEALGHVF 266
           L G           G++ S   D+ ++G +F
Sbjct: 180 LLG-----------GKQYSTGVDIWSIGCIF 199

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 103/255 (40%), Gaps = 51/255 (20%)

Query: 61  DDSTIVGLHYKI--------GKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQ 109
           DD  IV L  K+        G +IG GSFG ++ G N   G  +A+K    EP    A  
Sbjct: 398 DDDNIVSLPTKVVTPKSWLKGARIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASS 457

Query: 110 LKDEYRTY-------KILTGTP--------------------GVPQAYYFGQEGLH-NIL 141
             D+ +++       K LT  P                     +   Y   QEG + NI 
Sbjct: 458 --DDKKSHPSSNAVVKKLTDPPQDGGRASSTKMNLLKELHHENIVTYYGSSQEGGNLNIF 515

Query: 142 VIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPG 201
           +  + G S+  + +     F    V     Q +  +  LH  ++I+RDIK  N L+   G
Sbjct: 516 LEYVPGGSVSSMLNSYG-PFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKG 574

Query: 202 HEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEA 261
                 + + DFG++K+      KQ+    ++ SL G+  +M+         + + D+ +
Sbjct: 575 -----SVKITDFGISKKLSPLNKKQN----KRASLQGSVYWMAPEVVKQVVTTEKADIWS 625

Query: 262 LGHVFFYFLRGQLPW 276
           +G V      G+ P+
Sbjct: 626 VGCVVVEMFTGKHPF 640

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 94/217 (43%), Gaps = 19/217 (8%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQA 129
           +K  + IG G FGV+++  +       A+K         +++D  +  + L     VP  
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDEVEDVQKEIQFLASLKQVPNI 84

Query: 130 YYFGQEGLHN----ILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDL 185
             +    L++    +++    G SL  L      K   K +  +  +++  +  +H  ++
Sbjct: 85  TRYYGSYLYDTKLWVIMEYCAGGSLRTLLR--PGKIDEKYLGVIVRKLLIALVYIHKDNV 142

Query: 186 IYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSI 245
           I+RDIK  N L+   GH     + L DFG+A Q      K       +++++GT  +M+ 
Sbjct: 143 IHRDIKAANVLITNEGH-----VKLCDFGVAAQLTAANHK-------RQTMAGTPYWMAP 190

Query: 246 NTHL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKA 281
              + G   + + D+ +LG   +    G  P+  ++A
Sbjct: 191 EVIMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEA 227

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 79/180 (43%), Gaps = 37/180 (20%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLP----VAIKFEPR---------KTEAPQLKDEYRT 116
           Y+I  KIGEG+F  +F+   + N L     VAIK  P+         KT   Q  +E   
Sbjct: 67  YRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNELNI 126

Query: 117 YKILT--GTPGV---------PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKT 165
           +  LT    P V          + YYF QE +         G     +  +    FS   
Sbjct: 127 HLKLTKANVPNVVKLLEFQVSKKYYYFIQEYIEG-------GEIFNQIVKYT--YFSEDL 177

Query: 166 VVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTK 225
              V  Q+ T ++ LH +++I+RDIKP+N L+  P  ++   IH   +   ++  DPKTK
Sbjct: 178 TRHVIRQVATAVKGLHENNIIHRDIKPEN-LIFEPIIKEQT-IH--RYQKLRKSDDPKTK 233

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 98/237 (41%), Gaps = 31/237 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPR-KTEAPQLKDEYRTYKILT---GTPG 125
           YK    I  GSF  +++G N      VA+K  P+ K     + +EY   K+L+   G P 
Sbjct: 8   YKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKFSQRGMANEYNVGKLLSKDEGCPF 67

Query: 126 VPQAYYFGQEGLHNILVIDLLGP-SLEDLFDWCNRK--FSVKTVVQVAVQMITL-----I 177
           +     F ++  +  LV +        D  +   +K   +  +++++  Q + L     I
Sbjct: 68  ICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAI 127

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHI---PYREKK 234
           +  H+  + +RDIKP+N L+   G      I L D+G A          +I    YR  +
Sbjct: 128 KYAHSMGIAHRDIKPENILINYHG-----DIKLADWGHAIS-ASSSNDNNIGTDNYRGPE 181

Query: 235 SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
           + S    Y   NT+       R D  ++G    Y L    P++     N K  Y+++
Sbjct: 182 TFSAKVSY---NTY-------RSDYWSMGVTLLYLLFSHCPFRCSNIKNEKIVYKRL 228

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 103/243 (42%), Gaps = 45/243 (18%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGT----- 123
           Y  GK++G G + ++ E  N   G  VA+K F P++ +     D+ RT K    T     
Sbjct: 101 YLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQND-----DDKRTKKFTEETKILLS 155

Query: 124 ---PGVPQAYY-----FGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV--QM 173
              P + +          +  +   LV++ +     +LF+   RK +++     A+  Q+
Sbjct: 156 IQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDG--ELFERIVRKNNLREDETKALFRQL 213

Query: 174 ITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL--------------IDFGMAKQY 219
           +  ++ LH+ ++I+RDIKP+N L+         +I L               DFG+AK  
Sbjct: 214 LNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT 273

Query: 220 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 279
            + K           +L GT  Y++    +    + R DM + G + +  L G  P+   
Sbjct: 274 GEMKFTN--------TLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQ 325

Query: 280 KAP 282
            AP
Sbjct: 326 LAP 328

>Scas_648.17
          Length = 340

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 73/155 (47%), Gaps = 16/155 (10%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKI---LTGTPG 125
           Y+I  KIG G +  +F G  + N  P  IK  +P K     +K  YR  KI   LTG P 
Sbjct: 50  YEIITKIGRGKYSEVFSGECVNNETPCVIKVLKPVK-----MKKIYRELKILTNLTGGPN 104

Query: 126 VPQAYYFGQEGLHNILVIDLLGPSLEDL-FDWCNRKFSVKTVVQVAVQMITLIEDLHAHD 184
           V +     Q+    I    L+   ++++ F      F++  +     Q++  +   H+  
Sbjct: 105 VIELLDIVQDPGSKIPA--LIFEEVKNMDFRQLYPTFTLPDIQFYFTQLLIALNYCHSMG 162

Query: 185 LIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           +++RD+KP N ++         K+ LID+G+A+ Y
Sbjct: 163 IMHRDVKPQNVMID----PKERKLRLIDWGLAEFY 193

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 99/234 (42%), Gaps = 34/234 (14%)

Query: 76  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVPQAYYFG 133
           +G G+F  + +      G   A+K   ++     +    R  ++L     P +     F 
Sbjct: 194 VGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFY 253

Query: 134 QEGLHNILVIDLLGPSLEDLFDWCNRKFSV--KTVVQVAVQMITLIEDLHAHDLIYRDIK 191
           ++  +  +V++ +     DL D+     +V  +   +++ Q++  I+ +H+  + +RD+K
Sbjct: 254 EDEANYYMVMEFISGG--DLMDFVAAHGAVGEEAGREISRQILEAIQYIHSKGISHRDLK 311

Query: 192 PDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG- 250
           PDN L+ +   +D   + + DFG+AK   +            K+  GT  Y++     G 
Sbjct: 312 PDNILIEQ---DDPVLVKITDFGLAKVQGNGSI--------MKTFCGTLAYVAPEVIGGF 360

Query: 251 -------------REQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKI 291
                         E S   DM ++G + F  L G LP+ G      +Q YE+I
Sbjct: 361 TGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPFSG---STQEQLYEQI 411

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 20/126 (15%)

Query: 152 DLFDW-----CNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN 206
           DLF +     C    S    + +  Q++  ++ LH+  +++RD+K DN L+  P  E  +
Sbjct: 243 DLFSYLAKKDCLAPISETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTP--EPCS 300

Query: 207 KIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS------INTHLGREQSRRDDME 260
           +I L DFG+AK     + + H       ++ GT  Y +      ++ +  R  SR   ME
Sbjct: 301 RIVLADFGIAKDLPSTRVRMH-------TIVGTPEYCAPEVGFRVDRNSYRNFSRTASME 353

Query: 261 ALGHVF 266
             G+ F
Sbjct: 354 QQGYDF 359

>ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH]
           complement(205175..205199,205252..206147) [921 bp, 306
           aa]
          Length = 306

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 76/167 (45%), Gaps = 20/167 (11%)

Query: 65  IVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-----EYRTYKI 119
           +  ++Y   KK+GEG++ V++ G    +G  +AIK    + +  Q KD       R  K 
Sbjct: 1   MTAVNYTKEKKVGEGTYAVVYLGHRQTDGRQIAIK----EIKTSQFKDGLDMSAIREVKY 56

Query: 120 LTGT--PGVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMIT 175
           L       V +    +  QE L+  LV++ L   LE L    +  F+   +    +  + 
Sbjct: 57  LQEIRHANVIELVDLFMAQENLN--LVLEFLPADLEMLIKDSSLLFTQADIKSWLLMTLR 114

Query: 176 LIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP 222
            +   H   +++RD+KP+N L+   G     ++ + DFG+A+    P
Sbjct: 115 GVHHCHRSFILHRDLKPNNLLLAPDG-----QLKIADFGLARTLAAP 156

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 14/130 (10%)

Query: 147 GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN 206
           G SL D+   C    +   +  V+ + +  +  LH+  +I+RDIK DN L+   G+    
Sbjct: 762 GGSLTDVVTHC--ILTEGQIAAVSRETLRGLHFLHSKGVIHRDIKSDNILLSMDGN---- 815

Query: 207 KIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 266
            I L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ +LG + 
Sbjct: 816 -IKLTDFGFCAQINETNLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 867

Query: 267 FYFLRGQLPW 276
              + G+ P+
Sbjct: 868 IEMIEGEPPY 877

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 110/264 (41%), Gaps = 35/264 (13%)

Query: 44  PANQTPASTASPPTSMRDDSTIVGLHYKIGKKI-GEGSFGVLFEGTNMINGLPVAIKFEP 102
           PA  T   T SP    R   T +   + I  ++ G+G+F  + +      G   A+K   
Sbjct: 194 PAKHTTLRTQSP----RAPLTGIFKDFSINDEVVGQGAFATVKKAVERNTGKTFAVKIIN 249

Query: 103 RKTEAPQLKDEYRTYKIL--TGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRK 160
           ++     +    R  ++L     P +     F ++     L+++ +  S  DL D+    
Sbjct: 250 KRKVMGNVDGVTRELEVLRRLNHPRIVSLKGFYEDDESYYLLMEFV--SGGDLMDFVAAH 307

Query: 161 FSVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ 218
            SV      ++  Q++  +  +H   + +RD+KPDN L+ +   +D   + + DFG+AK 
Sbjct: 308 GSVGEDAGREITRQILEAVRYIHEQGISHRDLKPDNILIEQ---DDPVLVKITDFGLAK- 363

Query: 219 YRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE----------QSRRDDMEALGHVFFY 268
            +D  T         K+  GT  Y++     G+            S   DM ++G + + 
Sbjct: 364 IQDNTTFM-------KTFCGTLAYVAPEVIGGKNPEGNGANGNLYSSLVDMWSIGCLVYV 416

Query: 269 FLRGQLPWQGLKAPNNKQKYEKIG 292
            L G LP+ G      +Q Y++I 
Sbjct: 417 ILTGHLPFSG---STQEQLYKQIA 437

>Scas_593.14d
          Length = 495

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 74/154 (48%), Gaps = 19/154 (12%)

Query: 165 TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ-----Y 219
           TV   A ++   ++ LH   ++YRD+KP+N L+   GH     + L DFG++K+      
Sbjct: 249 TVAFYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGH-----LVLTDFGLSKKSVTQNS 303

Query: 220 RDPK--TKQHIPYREKK---SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQL 274
            +P   T  + P  +     S+ GT  Y +     G   ++  D  +LG + +  L G+ 
Sbjct: 304 ANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKP 363

Query: 275 PWQGLKAPNNKQKYEKIGEKKRTTNV-YDLAQGL 307
           P+ G    N+K    KI + K+   + Y L++G+
Sbjct: 364 PYTG---ANHKVILNKIQKDKQGPKIPYYLSEGM 394

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 136 GLHNILVIDLL-GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDN 194
           GL   +V++ + G  L D+  +C    +   +  V  +++  +E LH+  +++RDIK DN
Sbjct: 634 GLDLWVVMEYMEGGCLTDVVTYC--VLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDN 691

Query: 195 FLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS 254
            L+   G      I L DFG   Q  D   K       + ++ GT  +M+      +E  
Sbjct: 692 VLLSMNG-----DIKLTDFGFCAQVNDTVIK-------RTTMVGTPYWMAPEIVSRKEYG 739

Query: 255 RRDDMEALGHVFFYFLRGQLPW 276
            + D+ +LG +    + G+ P+
Sbjct: 740 PKVDIWSLGIMIIEMIEGEPPY 761

>Kwal_33.13984
          Length = 649

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 81/184 (44%), Gaps = 28/184 (15%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILTGT--PGV 126
           Y +   +G+G+FG + +  N++    +A+K    K+E   Q   E +  ++L G   P  
Sbjct: 278 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSKSEYLNQSITEAKILELLNGKIDPQG 337

Query: 127 PQAYYFGQEGL----HNILVIDLLGPSLEDLFDWCNRKF---SVKTVVQVAVQMITLIED 179
              +    E      H  LV +LL  +L +L      +F   S+  +   A Q++  +  
Sbjct: 338 EHHFLRMHETFVHKNHLCLVFELLSSNLYELLK--QNQFHGLSISLIRTFARQLLDSLCV 395

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ-------------YRDPKTKQ 226
           L  H LI+ D+KP+N L+      D  ++ +IDFG A +             YR P+   
Sbjct: 396 LKEHKLIHCDLKPENILLVS---LDRPELKVIDFGSACEETRTLYTYIQSRFYRAPEVIL 452

Query: 227 HIPY 230
            IPY
Sbjct: 453 GIPY 456

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 113/256 (44%), Gaps = 30/256 (11%)

Query: 40  LPMTPANQTPASTASPPTSMRDDST-IVGLH--YKIGKKI-GEGSFGVLFEGTNMINGLP 95
           L M     +PAS++     +    T + G+H  Y I   I G+G+F  + +      G  
Sbjct: 158 LNMMKDVTSPASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKT 217

Query: 96  VAIKFEPRKTEAPQLKDEYRTYKILTGT--PGVPQAYYFGQEGLHNILVIDLLGPSLEDL 153
            A+K   ++    +     R   +L     P + +   F ++  +  ++++ +     DL
Sbjct: 218 FAVKIIHKRKVMDKFDGVKRELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGG--DL 275

Query: 154 FDWCNRKFSVKTVV--QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLI 211
            D+     +V      ++  Q++  ++ +H   + +RD+KPDN ++ +   +D   I + 
Sbjct: 276 MDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDLKPDNIMIEQ---DDPVLIKIT 332

Query: 212 DFGMAKQYRDPKTKQHIPYREKKSLSGTARYMS---INTHLGREQSRRD------DMEAL 262
           DFG+AK  ++  T  +       +  GT  Y++   I+     +++ RD      DM ++
Sbjct: 333 DFGLAK-VQNQNTFLN-------TFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSI 384

Query: 263 GHVFFYFLRGQLPWQG 278
           G + +  L G LP+ G
Sbjct: 385 GCLVYVILTGHLPFSG 400

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 91/207 (43%), Gaps = 22/207 (10%)

Query: 75  KIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKIL----TGTPGVPQAY 130
           KIG+G+ G ++    +   + VAIK   +     Q K E    +IL    +  P +    
Sbjct: 625 KIGQGASGGVYTAYEIGTNVSVAIK---QMNLEKQPKKELIINEILVMKGSKHPNIVNFI 681

Query: 131 -YFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRD 189
             +  +G   +++  + G SL D+   C    +   +  V  + ++ +E LH+  +++RD
Sbjct: 682 DSYVLKGDLWVIMEYMEGGSLTDVVTHC--ILTEGQIGAVCRETLSGLEFLHSKGVLHRD 739

Query: 190 IKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL 249
           IK DN L+   G      I L DFG   Q  +   K       + ++ GT  +M+     
Sbjct: 740 IKSDNILLSMEGD-----IKLTDFGFCAQINELNLK-------RTTMVGTPYWMAPEVVS 787

Query: 250 GREQSRRDDMEALGHVFFYFLRGQLPW 276
            +E   + D+ +LG +    + G+ P+
Sbjct: 788 RKEYGPKVDIWSLGIMIIEMIEGEPPY 814

>Scas_720.103
          Length = 804

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 25/129 (19%)

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRD-------- 221
           A +++  +E LH    IYRD+KP+N L+ + GH     I L DF ++   +D        
Sbjct: 511 ASEVLAALEYLHLLGFIYRDLKPENILLHKSGH-----IMLSDFDLSVHAKDSKNPIFMK 565

Query: 222 ----PKTKQHIPYREK--------KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 269
               P T  ++    K         S  GT  Y++     G   +   D   LG + F  
Sbjct: 566 DGILPTTNSNLIVDTKICSEGFRTNSFVGTEEYIAPEVIRGNGHTVAVDWWTLGILIFEM 625

Query: 270 LRGQLPWQG 278
           L G+ P++G
Sbjct: 626 LFGKTPFKG 634

>Scas_655.2
          Length = 800

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 152 DLFDWC-NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL 210
           DLF    + K S + +     Q++T ++ LH+  L +RD+K DN ++   G      + L
Sbjct: 528 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKG-----IVKL 582

Query: 211 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 269
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 583 IDFGAAVVFSYPFSKTLV---EASGIVGSDPYLAPEVCIFSKYDPRPVDIWSTAIIFACM 639

Query: 270 LRGQLPWQGLKAPNNKQK 287
           +  + PW+  K  +N  K
Sbjct: 640 ILKKFPWKIPKLRDNSFK 657

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 84/200 (42%), Gaps = 26/200 (13%)

Query: 124 PGVPQAYY-FGQEGLHNILVIDLLGPSLEDLFDW-----CNRKFSVKTVVQVAVQMITLI 177
           P + + Y+ F     H  +  DL+     DLF +     C    S    + +  Q++  +
Sbjct: 221 PNIIKVYHTFCDRNNHLYIFQDLIPGG--DLFSYLAKGDCLTSMSETESLLIVFQILQAL 278

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQH---------- 227
             LH  D+++RD+K DN L+  P  E   +I L DFG+AK     K + H          
Sbjct: 279 NYLHDQDIVHRDLKLDNILLCTP--EPCTRIVLADFGIAKDLNSNKERMHTVVGTPEYCA 336

Query: 228 --IPYR-EKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNN 284
             + +R  +K+    +R  ++     R    + D+ +LG +    L G  P+ G  +  +
Sbjct: 337 PEVGFRANRKAYQSFSRAATLEQ---RGYDSKCDLWSLGVITHIMLTGISPFYGDGSERS 393

Query: 285 KQKYEKIGEKKRTTNVYDLA 304
             +  KIG+       +D+ 
Sbjct: 394 IIQNAKIGKLNFKLKQWDIV 413

>YNL183C (NPR1) [4417] chr14 complement(293137..295509)
           Serine/threonine protein kinase involved in regulating
           transport systems for nitrogen source nutrients [2373
           bp, 790 aa]
          Length = 790

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 64/138 (46%), Gaps = 10/138 (7%)

Query: 152 DLFDWC-NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL 210
           DLF    + K S + +     Q++T ++ LH+  L +RD+K DN ++   G      + L
Sbjct: 523 DLFAIVMSNKMSYEEICCCFKQILTGVQYLHSIGLAHRDLKLDNCVINEKG-----IVKL 577

Query: 211 IDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHL-GREQSRRDDMEALGHVFFYF 269
           IDFG A  +  P +K  +   E   + G+  Y++    +  +   R  D+ +   +F   
Sbjct: 578 IDFGAAVVFSYPFSKNLV---EASGIVGSDPYLAPEVCIFAKYDPRPVDIWSSAIIFACM 634

Query: 270 LRGQLPWQGLKAPNNKQK 287
           +  + PW+  K  +N  K
Sbjct: 635 ILKKFPWKIPKLRDNSFK 652

>Kwal_23.3590
          Length = 499

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 103/240 (42%), Gaps = 39/240 (16%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKF-------EPRKTEAPQLKDEYRTYKILTG 122
           Y  GK++G G + ++ E  +  +G  VA+K        + +KT+  Q ++E +    +  
Sbjct: 186 YIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTK--QFREETKILMSIQH 243

Query: 123 TPGVPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV--QMITL 176
              V     F     +  +   LV++ +     +LFD   RK  ++     A+  Q++  
Sbjct: 244 KNIVKLIDRFVEPVSKAQIQTFLVLEKVSDG--ELFDRIVRKTRLREDETNAIFKQILNG 301

Query: 177 IEDLHAHDLIYRDIKPDNFL--VGRPGHEDANK------------IHLIDFGMAKQYRDP 222
           +  LHA ++I+RDIKP+N L  + +  H D  +            I + DFG+AK   + 
Sbjct: 302 LRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIGEM 361

Query: 223 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282
           +           +L GT  Y++         + R DM + G + +  L G  P+    AP
Sbjct: 362 QFTN--------TLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAP 413

>Kwal_26.7861
          Length = 955

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 14/130 (10%)

Query: 147 GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN 206
           G SL D+   C    +   +  V+ + +  ++ LH+  +I+RDIK DN L+   G     
Sbjct: 746 GGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNVLLSMSG----- 798

Query: 207 KIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 266
           +I L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ +LG + 
Sbjct: 799 EIKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 851

Query: 267 FYFLRGQLPW 276
              + G+ P+
Sbjct: 852 IEMIEGEPPY 861

>YJL141C (YAK1) [2777] chr10 complement(147885..150308)
           Serine/threonine protein kinase, negative regulator of
           cell growth acting in opposition to cAMP-dependent
           protein kinase A [2424 bp, 807 aa]
          Length = 807

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 28/184 (15%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILTGTPGVPQ 128
           Y +   +G+G+FG + +  N++    +A+K    +TE   Q   E +  ++L        
Sbjct: 369 YLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTN 428

Query: 129 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCNRKF---SVKTVVQVAVQMITLIED 179
            ++F +         H  LV +LL  +L +L      KF   S++ +     Q++  +  
Sbjct: 429 KHHFLRMYDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTTQILDSLCV 486

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ-------------YRDPKTKQ 226
           L    LI+ D+KP+N L+  P   D  ++ +IDFG + +             YR P+   
Sbjct: 487 LKESKLIHCDLKPENILLCAP---DKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIIL 543

Query: 227 HIPY 230
            IPY
Sbjct: 544 GIPY 547

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 113/265 (42%), Gaps = 51/265 (19%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK------------FEPRKTEAPQLKDEYRT 116
           +Y + K+IG+GSF V+++G ++ +G  +AIK             E  + E   LK     
Sbjct: 20  NYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKKIKHP 79

Query: 117 YKI-LTGTPGVPQAYYFGQE--GLHNILV-------IDLLGPSLEDLFDW---------- 156
           + + L         +Y   E   L ++         + L  P ++ +F+           
Sbjct: 80  HIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNG 139

Query: 157 CNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRP--GHEDANKIHLIDFG 214
            NR      VV    Q+ + ++ L + +L++RDIKP N L+  P   + D    H  + G
Sbjct: 140 LNRVL----VVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFH--ELG 193

Query: 215 MAKQYRDPKTK-------QHIPYRE-KKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 266
               Y  P  K       + +P     ++L G+  YM+      ++ + + D+ ++G V 
Sbjct: 194 FVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVL 253

Query: 267 FYFLRGQLPWQGLKAPNNKQKYEKI 291
           +    G+ P+   KA N+ + ++KI
Sbjct: 254 YEMCCGRPPF---KASNHLELFQKI 275

>Scas_700.34
          Length = 864

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 98/231 (42%), Gaps = 43/231 (18%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLP-----------VAIKFEPRKTEAPQLKDEYRTYK 118
           Y IG  +GEG FG +  G    N LP           VAIK   R T +     E + Y+
Sbjct: 48  YIIGSTLGEGEFGKVKLGWPK-NSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYR 106

Query: 119 ILTGTPGVPQAYYFG-QEGLHNILVIDLLGPSLE-----DLFDWCNRKFSVKT--VVQVA 170
            +     +        +E L N   I ++   LE     + + +  RK  +K     ++ 
Sbjct: 107 EINALKHLTHPNIVKLEEVLQNSKYIGIV---LEYASGGEFYKYIQRKKRLKEGPACRLF 163

Query: 171 VQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPY 230
            Q+I  +  +H+  L++RD+K +N L+ +  HE+   + + DFG   ++          Y
Sbjct: 164 AQLINGVHYIHSKGLVHRDLKLENLLLDK--HEN---LIITDFGFVSEF----------Y 208

Query: 231 RE---KKSLSGTARYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPW 276
                 K+  G+  Y +    +  +  ++++ D+ + G + +  L G LPW
Sbjct: 209 SHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPW 259

>AEL120W [2386] [Homologous to ScYKL171W - SH]
           complement(396394..398715) [2322 bp, 773 aa]
          Length = 773

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 92/200 (46%), Gaps = 30/200 (15%)

Query: 48  TPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVA---------- 97
           TP+S +  P    D+   + L +++GK IG G++G++ +  ++     ++          
Sbjct: 343 TPSSASFKP----DERGSIVLGHRLGKIIGFGAWGMIRDCYDVKQSFVISPSESQPPASH 398

Query: 98  ----IKFEPRKTEAPQLKDEYRTYKILTGTPGVPQ----------AYYFGQEGLHNILVI 143
               ++F+  +        E   +K L   P + +          A Y+  E + +  + 
Sbjct: 399 AMKIVRFKNNQKVKEHALREIAIWKKLH-HPNILELINWKQEEDYAAYYLTEKIQDGTLY 457

Query: 144 DLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHE 203
           DL+    E            K  + +A+Q+I+ ++ +H+  +++ D+K +N L+ + G +
Sbjct: 458 DLVSTWGESDGSTIPLDQRCKLTIALALQLISALKYMHSKYIVHADVKLENCLLEKTGSQ 517

Query: 204 DANKIHLIDFGMAKQYRDPK 223
            + K++L DFGM+ QY  P+
Sbjct: 518 -SWKLYLCDFGMSCQYGKPR 536

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 128/329 (38%), Gaps = 88/329 (26%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKF---------------EPRKTEAPQLKDEY 114
           Y+I K++G G  G +  G +++    VAIK                +P KTE  ++K E 
Sbjct: 141 YEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFFSFKKPGKTENDKIKREI 200

Query: 115 RTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNR--------------- 159
              K         + ++     L  +L  DL    +  + ++C+R               
Sbjct: 201 AIMK---------KCHHKHVVKLIEVL-DDLKSRKIYLVLEYCSRGEVKWCPPDCLETEA 250

Query: 160 ----KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGM 215
                 S +   ++   ++  +E LH   +I+RDIKP N L+   G      + + DFG+
Sbjct: 251 KGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETG-----IVKISDFGV 305

Query: 216 ---AKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLG----------REQ-------SR 255
              A       + + I   E    +GT  + +    LG          RE+       S 
Sbjct: 306 SLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCISF 365

Query: 256 RDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQGLPIQFGRYL 315
           + D+ ALG   +  + G LP+    +    + +EKI        V D     P++F +Y 
Sbjct: 366 KIDIWALGVTLYCLVFGMLPFV---SSFELELFEKI--------VND-----PVKFPKYS 409

Query: 316 EIVRN---LSFEETPDYEGYRMLLLSALD 341
           ++++N   L   E  +YE  + LL   L+
Sbjct: 410 DMLKNNQVLQMTEEAEYEAAKDLLTRLLE 438

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/244 (21%), Positives = 106/244 (43%), Gaps = 53/244 (21%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-------------FEPRKTEAPQLKDEYR 115
           +YKI K IGEGSFG ++   + +    V +K             F  R+ + P +    +
Sbjct: 36  NYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKNDPNVVREVFYHRQFDFPHIT---K 92

Query: 116 TYKILTGTPGVPQA--YYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQM 173
            Y+++     V  A  Y  G+E    +L+                 + S++   ++  Q+
Sbjct: 93  LYEVIVTESKVWMALEYCPGKELYEYLLM---------------QHRISLEESGKLFAQI 137

Query: 174 ITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREK 233
           ++ +   H+   ++RD+K +N L+ + G     +  + DFG     R+  TK  +     
Sbjct: 138 VSAVYYAHSLQCVHRDLKLENILLDKKG-----RAKITDFGFT---RECATKTML----- 184

Query: 234 KSLSGTARYMSINTHLGREQSR---RDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 290
           +++ GT  YM+    L   +S    + D+ +LG + +  + G +P+   +    K K++ 
Sbjct: 185 ETVCGTTVYMA--PELIERKSYDGFKIDIWSLGVILYTMIHGTMPFD--EEDETKTKWKI 240

Query: 291 IGEK 294
           I E+
Sbjct: 241 INEE 244

>Scas_721.46
          Length = 296

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 88/206 (42%), Gaps = 20/206 (9%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILTGTP 124
           +YK  +K+GEG++GV+++  +M  G  V     I+ E      P       +        
Sbjct: 7   NYKRLEKVGEGTYGVVYKALDMRQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDD 66

Query: 125 GVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWCNRKFSV--KTVVQVAVQMITLIEDLH 181
            + + Y       H + LV + L   L+   +   +  S+    + +   Q+   I   H
Sbjct: 67  NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQSLGSDIIKKFMRQLCKGIAYCH 126

Query: 182 AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
           AH +++RD+KP N L+ + G+     + L DFG+A+ +        +P R       T  
Sbjct: 127 AHRILHRDLKPQNLLINKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLW 174

Query: 242 YMSINTHLGREQ-SRRDDMEALGHVF 266
           Y +    LG +Q S   D  ++G +F
Sbjct: 175 YRAPEVLLGGKQYSTGVDTWSIGCIF 200

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 90/214 (42%), Gaps = 26/214 (12%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILT-------G 122
           YK   KIG+G+ G ++    +     VAIK   +     Q K E    +IL         
Sbjct: 698 YKNLIKIGQGASGGVYTAYELGTNASVAIK---QMNLEKQPKKELIVNEILVMKGSKHNN 754

Query: 123 TPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHA 182
                 +Y F   G   +++  + G SL D+   C    +   +  V+ + +  ++ LH+
Sbjct: 755 IVNFIDSYLF--RGDLWVVMEYMEGGSLTDVVTHC--ILTEGQIGAVSRETLKGLQFLHS 810

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
             +I+RDIK DN L+   G      I L DFG   Q  +   K       + ++ GT  +
Sbjct: 811 KGVIHRDIKSDNILLSMNGD-----IKLTDFGFCAQINEVNLK-------RTTMVGTPYW 858

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           M+      +E   + D+ +LG +    + G+ P+
Sbjct: 859 MAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 892

>Kwal_56.22788
          Length = 515

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 78/192 (40%), Gaps = 40/192 (20%)

Query: 112 DEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV 171
           D ++ Y IL   PG    Y+  ++G  +           ED            TV   A 
Sbjct: 208 DHHKLYLILQFIPGGELFYHLKEQGTLD-----------ED------------TVAFYAA 244

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYR--------DPK 223
           ++   +  LH   ++YRD+KP+N L+   GH     + L DFG++K           D  
Sbjct: 245 EISCALRFLHKRGVVYRDLKPENCLLDERGH-----LVLTDFGLSKVSASDDSADGGDVN 299

Query: 224 TKQH--IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL-- 279
           T  H         S+ GT  Y +     G+  ++  D  +LG + F  L G+ P+ G+  
Sbjct: 300 TNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYTGVNH 359

Query: 280 KAPNNKQKYEKI 291
           K   NK   +KI
Sbjct: 360 KVILNKILKDKI 371

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 158  NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
            NR+ SV+     A +++  ++  H + +IYRD+K +N L+   GH     I + D+G+  
Sbjct: 928  NRRLSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLTPEGH-----IKIADYGLC- 981

Query: 218  QYRDPKTKQHIPYREKKS-LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
                   K ++ Y  K S   GT  +M+     G+  ++  D    G + +  L  Q P+
Sbjct: 982  -------KDNMWYGNKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLCQSPF 1034

Query: 277  QG 278
             G
Sbjct: 1035 SG 1036

>Scas_689.22
          Length = 901

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 80/166 (48%), Gaps = 12/166 (7%)

Query: 66  VGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK---FEPRKTEAPQLKDEYRTYKILTG 122
           V L +K+G+ IG G++G + E +++ +G   A+K   F+        ++ E   ++ L  
Sbjct: 434 VILDHKLGRAIGAGAWGSIRECSDIQSGTRRAMKIVRFKENLNVKKHVRREVSIWEQLKH 493

Query: 123 TPGVPQAYYFGQEGLHNILVIDLLGP-SLEDL-FDWC---NRKFSVKTVVQVAV----QM 173
              +P   Y  +E      + + +   +L DL   W    N K S+    ++ +    Q+
Sbjct: 494 ENILPLLNYKFEESYAMYCLTEFINDGNLYDLAVSWSHMSNSKISLSKRCELTIFLGLQV 553

Query: 174 ITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           ++ ++ +H+  + + D+K +N L+ +       K+ L DFGM++ +
Sbjct: 554 VSALQYMHSKSICHGDVKLENCLLKKDKAVGNWKVLLCDFGMSRNF 599

>Scas_715.34
          Length = 1150

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 93/218 (42%), Gaps = 22/218 (10%)

Query: 69   HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGT 123
            ++ + K +G+G+FG +    +   G   AIK   +       +    + E + + + T T
Sbjct: 822  NFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKT 881

Query: 124  --PGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLH 181
              P +   Y   Q        ++ +G   + ++   N++ SV+     A +++  ++  H
Sbjct: 882  KHPFLTNLYCSFQTENRIYFAMEFIGGG-DLMWHVQNQRLSVRRAKFYAAEVLLALKYFH 940

Query: 182  AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKS-LSGTA 240
             + +IYRD+K +N L+   GH     I + D+G+         K  + Y  K S   GT 
Sbjct: 941  DNGVIYRDLKLENILLTPQGH-----IKIADYGLC--------KDEMWYNNKTSTFCGTP 987

Query: 241  RYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
             +M+      +  +R  D  A G + +  L  Q P+ G
Sbjct: 988  EFMAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSG 1025

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 90/207 (43%), Gaps = 22/207 (10%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMING---LPVA---IKFEPRKTEAPQLKDEYRTYKILTGT 123
           YK  +K+GEG++GV+++  ++  G     VA   I+ E      P       +       
Sbjct: 8   YKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 67

Query: 124 PGVPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWC--NRKFSVKTVVQVAVQMITLIEDL 180
             + + Y       H + LV++ L   L+   +    ++   V  + +  VQ+   I   
Sbjct: 68  DNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKKFMVQLCKGIAYC 127

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           HAH +++RD+KP N L+ + G+     + L DFG+A+ +        +P R       T 
Sbjct: 128 HAHRILHRDLKPQNLLIDKEGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTL 175

Query: 241 RYMSINTHLGREQ-SRRDDMEALGHVF 266
            Y +    LG +Q S   D  ++G +F
Sbjct: 176 WYRAPEVLLGGKQYSTGVDTWSIGCIF 202

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 97/227 (42%), Gaps = 44/227 (19%)

Query: 64  TIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-------------FEPRKTEAPQL 110
           T VG +YKI K+IGEGSFG ++  T+      V +K             F  R+ + P +
Sbjct: 37  TEVG-NYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYI 95

Query: 111 KDEYRTYKILTGTPGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVA 170
              Y    I+T T       Y   + L++ L+     P+LE     C   F+        
Sbjct: 96  TKLYEV--IVTETKVWMALEYCPGKELYDHLLSKSRLPTLE-----CAELFA-------- 140

Query: 171 VQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPY 230
            Q+   +   H  + ++RD+K +N L+ + G+       L DFG     R+  TK  +  
Sbjct: 141 -QITGAVHYAHTLNCVHRDLKLENVLLDKNGN-----AKLTDFGFT---RESMTKAVL-- 189

Query: 231 REKKSLSGTARYMSINTHLGRE-QSRRDDMEALGHVFFYFLRGQLPW 276
              +++ GT  YM+      +     + D+ +LG + +  L G LP+
Sbjct: 190 ---ETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPF 233

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPK------ 223
           A ++   +E LH    IYRD+KP+N L+ + GH     I L DF ++ Q +D K      
Sbjct: 603 ASEVTAALEYLHLLGFIYRDLKPENILLHQSGH-----IMLSDFDLSIQAKDAKVPVVKG 657

Query: 224 --------TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLP 275
                   TK         S  GT  Y++     G   +   D   LG + +  L G  P
Sbjct: 658 NAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTP 717

Query: 276 WQG 278
           ++G
Sbjct: 718 FKG 720

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 95/241 (39%), Gaps = 42/241 (17%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK----FEPR-------KTEAPQLKDEYRTY 117
           +++I   +G G +G +    ++  G  VAIK    FE R       K E P++  E    
Sbjct: 49  NFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKVENPRVNQEIEVM 108

Query: 118 KILTGTPGVPQAYYF--GQEGLHNILVIDLL--GPSLEDLFDWC-NRKFSVKTV------ 166
           K       V + Y      E     LV++    GP       WC   K  +K V      
Sbjct: 109 K-RCHHENVVELYEILNDPESTKVYLVLEYCSRGP-----VKWCPENKMEIKAVGPSILT 162

Query: 167 ----VQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP 222
                +V + +++ +E LH+  + +RDIKP N L+   G      + + DFG+A      
Sbjct: 163 FQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNG-----TVKISDFGVAMSTATG 217

Query: 223 KTKQHIPYRE--KKSLSGTARYMS---INTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
            T     + +  K    GT  + +    +T      S   D+ +LG   +  L G+LP+ 
Sbjct: 218 STNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFN 277

Query: 278 G 278
            
Sbjct: 278 A 278

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 16/120 (13%)

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPK--TKQH 227
           A +++  +E LH    IYRD+KP+N L+ + GH     + L DF ++ Q    K  T + 
Sbjct: 430 ASEVVAALEYLHLLGFIYRDLKPENILLHQSGH-----VMLSDFDLSIQATGSKKPTMKD 484

Query: 228 IPYREKK---------SLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
             Y + K         S  GT  Y++     G   +   D   LG + +  L G  P++G
Sbjct: 485 STYLDTKICSDGFRTNSFVGTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKG 544

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 58/119 (48%), Gaps = 15/119 (12%)

Query: 161 FSVKTVVQVAVQMITLIEDLH-AHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           F+  T+ ++A  ++  ++ L+  + +I+RDIKP N L+   G     +I L DFG++K+ 
Sbjct: 302 FNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKG-----QIKLCDFGVSKKL 356

Query: 220 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
            +      +         GT+ YMS     G   S + D+ +LG +    + G+ P  G
Sbjct: 357 INSIADTFV---------GTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGG 406

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 52/121 (42%), Gaps = 19/121 (15%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQ----- 226
           ++   +E LH    IYRD+KP+N L+ + GH     I L DF ++ Q +D K  Q     
Sbjct: 487 EVTAALEYLHLMGFIYRDLKPENILLHQSGH-----IMLSDFDLSVQAKDTKNPQVKGNA 541

Query: 227 -HIPYREK--------KSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
            H     K         S  GT  Y++     G   +   D   LG + +  L G  P++
Sbjct: 542 SHSLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFK 601

Query: 278 G 278
           G
Sbjct: 602 G 602

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 163 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP 222
           +  +V+   Q +  + D H   +I+RDIK DN L+   G     ++ + DFG   +  D 
Sbjct: 621 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLLDTHG-----RVKITDFGFCAKLTDK 672

Query: 223 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 673 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 719

>AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH]
           complement(564252..566714) [2463 bp, 820 aa]
          Length = 820

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 83/196 (42%), Gaps = 47/196 (23%)

Query: 70  YKIGKKIGEGSFGVLF--------------EGTNMINGLPVAIKFE-------------P 102
           YK+ +++G GSFG +               EGT M   +   I+ E              
Sbjct: 38  YKLIQELGNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKT 97

Query: 103 RKTEAPQLKD--EYRTYKILTGTPG---VPQAY-YFGQEGLHNI-LVIDLLGPSLEDLFD 155
             T  P L D    R  K +   P    + Q Y  F  + L+ + +V++ +  ++  L  
Sbjct: 98  MMTRLPTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMK 157

Query: 156 WCNRK-FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVG-----------RPGH- 202
              R+ FS+ T+  +  Q+++ I  +HAH+  +RDIKP+N L+              GH 
Sbjct: 158 CRKRRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHY 217

Query: 203 EDANKIHLIDFGMAKQ 218
            D   + + D+G+A+ 
Sbjct: 218 PDNYVVKIADYGLARH 233

>Kwal_55.21709
          Length = 340

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 30/163 (18%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           HY+I  KIG G +  +F G  ++N     IK      +  +LK  YR  KILT   G P 
Sbjct: 49  HYEIVNKIGRGKYSEVFRGKCVVNDEYCVIK----VLKPVKLKKIYRELKILTNLTGGPN 104

Query: 129 AYYFGQEGLHNILVIDLLGPS--------LEDL----FDWCNRKFSVKTVVQVAVQMITL 176
                      I ++D++  S         E++    F     KF++  +     Q++  
Sbjct: 105 V----------IALLDIVQDSGSKIPALIFEEVKNVDFRTLYLKFTLPDIQYYFSQLLIA 154

Query: 177 IEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           ++  H+  +++RD+KP N ++         K+ LID+G+A+ Y
Sbjct: 155 LDYCHSMGIMHRDVKPQNVMID----PVERKLRLIDWGLAEFY 193

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD-----EYRTYKILTGTP 124
           Y   KK GEG++ V++ GT    G  +A+K    + +  Q KD       R  K L    
Sbjct: 10  YTKEKKAGEGTYAVVYLGTKKSTGRSIAVK----EIKTSQFKDGLDMSALREVKFLQELK 65

Query: 125 GVPQA----YYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDL 180
            V        +   + L+  LV++ L   LE +    +  FS   +    +  +  +   
Sbjct: 66  HVNVIELVDVFMANDNLN--LVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHC 123

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPK---TKQHIP--YREKKS 235
           H + +++RD+KP+N L+   G     ++ + DFG+A+    P+   T   +   YR  + 
Sbjct: 124 HRNFILHRDLKPNNLLLAPDG-----QLKIADFGLARLMASPQEILTSNVVTRWYRAPEL 178

Query: 236 LSGTARYMS 244
           L G   Y S
Sbjct: 179 LFGAKHYTS 187

>Kwal_23.5290
          Length = 819

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 15/114 (13%)

Query: 163 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP 222
           +  +V+   Q +  + D H   +I+RDIK DN L+     ++  ++ + DFG   +  D 
Sbjct: 647 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLL-----DNRARVKITDFGFCAKLTDK 698

Query: 223 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 699 RSK-------RATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY 745

>Scas_640.14*
          Length = 728

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/257 (21%), Positives = 111/257 (43%), Gaps = 40/257 (15%)

Query: 39  NLPMTPANQTPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVL---------FEGTN 89
           ++P++ A+Q P  + +  + M+         Y +G  +GEG FG +           G  
Sbjct: 13  SVPVSSAHQNPTISRNKKSHMKFGP------YIVGATLGEGEFGKVKMGWSTTSSSSGKI 66

Query: 90  MINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQAYYFG-QEGLHNILVIDLLGP 148
             +   VAIK   R       + E + ++ +     +        +E L N   I ++  
Sbjct: 67  TEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIV-- 124

Query: 149 SLE-----DLFDWCNRKFSVK--TVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPG 201
            LE     + + +  RK  +K  T  ++  Q+I+ +  +H+  +++RD+K +N L+ +  
Sbjct: 125 -LEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDK-- 181

Query: 202 HEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGRE--QSRRDDM 259
           HE+   + + DFG   ++       +      K+  G+  Y +    +  E  ++R+ D+
Sbjct: 182 HEN---LIITDFGFVNEF-------YADNELMKTSCGSPCYAAPELVITTEPYKARKADI 231

Query: 260 EALGHVFFYFLRGQLPW 276
            + G + +  L G LPW
Sbjct: 232 WSCGIILYGMLAGYLPW 248

>Scas_675.2
          Length = 527

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 93/217 (42%), Gaps = 22/217 (10%)

Query: 72  IGKKIGEGSFGVLFEGTNMIN-GLPVAIKFEPRKT------EAPQLKDEYRTYKILTGTP 124
           +G  IG+GSFG +      ++  + +A+K+    T          +  E   +   +  P
Sbjct: 17  LGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIPTCKKNGLTEKDISREVLLHSRCSKNP 76

Query: 125 GVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKT-VVQVAVQ-MITLIEDLHA 182
            V +         +  +++++      DLFD       V + V Q   Q ++  I  LH 
Sbjct: 77  NVLRLIDCNIAKDYMWMIMEMADGG--DLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHE 134

Query: 183 H-DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTAR 241
              + +RDIKP+N L+ + G+     + L DFG++ QYR       I   ++    G+  
Sbjct: 135 ECGVAHRDIKPENILLDKNGN-----LKLADFGLSSQYRRKDGTLRISTDQR----GSPP 185

Query: 242 YMSINTHLGR-EQSRRDDMEALGHVFFYFLRGQLPWQ 277
           YM+      R   +   D+ ++G + F  L G+ PW+
Sbjct: 186 YMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWE 222

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 16/81 (19%)

Query: 159 RKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGH--------EDAN---- 206
           R FS+ T+  +  Q++  I+ +H HD  +RDIKP+N L+  P H        ED N    
Sbjct: 162 RVFSLPTLRSILFQILAGIKHIHDHDFFHRDIKPENILIS-PSHRYFSKKWLEDDNYSDN 220

Query: 207 -KIHLIDFGMAKQY--RDPKT 224
             + L D+G+A+    R P T
Sbjct: 221 YVVKLADYGLARHVNNRSPYT 241

>Scas_201.1*
          Length = 274

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 67/127 (52%), Gaps = 11/127 (8%)

Query: 152 DLFDWCNRK--FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIH 209
           +LFD   +K  F+    V + VQ++  ++ +H+ ++++RD+KP+N L   P   D +++ 
Sbjct: 120 ELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPENVLYLDPS--DESQLV 177

Query: 210 LIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYF 269
           + DFG+AK+    K+   + ++     +G+  Y++          +  D+ +LG + +  
Sbjct: 178 IADFGIAKEL---KSNDDLIFKG----AGSLGYVAPEVLTKEGHGKPCDIWSLGVITYTL 230

Query: 270 LRGQLPW 276
           L G  P+
Sbjct: 231 LSGYSPF 237

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 158  NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
            N++ SV+     A +++  ++  H + ++YRD+K +N L+   GH     I + D+G+  
Sbjct: 942  NQRLSVRRAKFYAAEVLLALKYFHDNGVVYRDLKLENILLTPEGH-----IKIADYGLC- 995

Query: 218  QYRDPKTKQHIPYREKKS-LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
                   K  + Y  K S   GT  +M+      +E ++  D  A G + +  L  Q P+
Sbjct: 996  -------KDEMWYGNKTSTFCGTPEFMAPEILKEQEYTKSVDWWAFGVLLYQMLLCQSPF 1048

Query: 277  QG 278
             G
Sbjct: 1049 SG 1050

>Scas_629.16
          Length = 918

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPK------ 223
           A ++   +E LH    IYRD+KP+N L+ + GH     I L DF ++ Q +D K      
Sbjct: 625 ASEVTAALEYLHLLGFIYRDLKPENILLHKSGH-----IMLSDFDLSVQAKDAKVPVMKG 679

Query: 224 --------TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLP 275
                   TK         S  GT  Y++     G   +   D   LG + +  L G  P
Sbjct: 680 SAESTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTP 739

Query: 276 WQG 278
           ++G
Sbjct: 740 FKG 742

>Kwal_27.10581
          Length = 1154

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 158  NRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
            N++ SV+     A +++  ++  H + +IYRD+K +N L+   GH     I + D+G+  
Sbjct: 921  NQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGH-----IKIADYGLC- 974

Query: 218  QYRDPKTKQHIPYREKKS-LSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
                   K  + Y  K S   GT  +M+      +E ++  D  A G + +  L  Q P+
Sbjct: 975  -------KDEMWYGNKTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPF 1027

Query: 277  QG 278
             G
Sbjct: 1028 SG 1029

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 63/137 (45%), Gaps = 14/137 (10%)

Query: 140 ILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGR 199
           I++  + G SL D+   C    S   +  V  + +  ++ LH+  +++RDIK DN L+  
Sbjct: 692 IVMEYMEGGSLTDVVTHC--LLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSL 749

Query: 200 PGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDM 259
            G+     I L DFG   Q  +   K       + ++ GT  +M+      +E   + D+
Sbjct: 750 KGN-----IKLTDFGFCAQINENNLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDI 797

Query: 260 EALGHVFFYFLRGQLPW 276
            +LG +    + G+ P+
Sbjct: 798 WSLGIMIIEMIEGEPPY 814

>Scas_705.23
          Length = 553

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 71/183 (38%), Gaps = 41/183 (22%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMA--------------- 216
           +M   +  LH     +RD+KP+NFL+   GH     I L DFG+A               
Sbjct: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGH-----IKLTDFGLAAGTISTERIQSMKIR 318

Query: 217 ----KQYRDPK-TKQHIPYREK-------------KSLSGTARYMSINTHLGREQSRRDD 258
               K    P  T++ I  R K              S+ G+  YM++    G++     D
Sbjct: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378

Query: 259 MEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQGLPIQFGRYLEIV 318
             +LG + F  L G  P+ G    +  + YE +   K+T     L  G P    R  +I+
Sbjct: 379 YWSLGCMLFESLVGYTPFSG---SSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDII 435

Query: 319 RNL 321
             L
Sbjct: 436 TRL 438

>Scas_668.22
          Length = 893

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 14/130 (10%)

Query: 147 GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDAN 206
           G SL D+   C    +   +  V  + ++ ++ LH+  +++RDIK DN L+   G     
Sbjct: 690 GGSLTDVVTHC--ILTEGQIGAVCRETLSGLQFLHSKGVLHRDIKSDNILLSISGD---- 743

Query: 207 KIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVF 266
            I L DFG   Q  +   K       + ++ GT  +M+      +E   + D+ +LG + 
Sbjct: 744 -IKLTDFGFCAQINEINLK-------RTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMI 795

Query: 267 FYFLRGQLPW 276
              + G+ P+
Sbjct: 796 IEMIEGEPPY 805

>KLLA0B09790g complement(855327..856214) highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28 cyclin-dependent
           protein kinase, start by similarity
          Length = 295

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 20/205 (9%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVA----IKFEPRKTEAPQLKDEYRTYKILTGTPG 125
           YK  +K+GEG++GV+++  ++ +   V     I+ E      P       +         
Sbjct: 7   YKRLEKVGEGTYGVVYKAVDLRHQNRVVAMKKIRLESEDEGVPSTAIREISLLKELKDDN 66

Query: 126 VPQAYYFGQEGLHNI-LVIDLLGPSLEDLFDWC--NRKFSVKTVVQVAVQMITLIEDLHA 182
           + + Y       H + LV + L   L+   +    ++      + +  +Q+   I   HA
Sbjct: 67  IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESIPKDQPLGGNIIKKFMMQLCKGIAYCHA 126

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           H +I+RD+KP N L+ R G+     + L DFG+A+ +        +P R       T  Y
Sbjct: 127 HRIIHRDLKPQNLLINRDGN-----LKLGDFGLARAF-------GVPLRAYTHEIVTLWY 174

Query: 243 MSINTHLGREQ-SRRDDMEALGHVF 266
            +    LG +Q S   D+ ++G +F
Sbjct: 175 RAPEVLLGGKQYSTGVDVWSIGCIF 199

>YPR111W (DBF20) [5532] chr16 (747302..748996) Cell cycle protein
           kinase involved in termination of M-phase; related to
           Dbf2p [1695 bp, 564 aa]
          Length = 564

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 82/209 (39%), Gaps = 52/209 (24%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMA--------------- 216
           +M   +  LH     +RD+KP+NFL+   GH     I L DFG+A               
Sbjct: 275 EMFCAVNALHELGYTHRDLKPENFLIDATGH-----IKLTDFGLAAGTVSNERIESMKIR 329

Query: 217 ----KQYRDPK-TKQHIPYREK-------------KSLSGTARYMSINTHLGREQSRRDD 258
               K    P  T++ I  R K              S+ G+  YM++    G++     D
Sbjct: 330 LEEVKNLEFPAFTERSIEDRRKIYHNMRKTEINYANSMVGSPDYMALEVLEGKKYDFTVD 389

Query: 259 MEALGHVFFYFLRGQLPWQGL---KAPNNKQKYEKIGEKKRTTN--------VYDLAQGL 307
             +LG + F  L G  P+ G    +   N + ++K   + RT +         +DL   L
Sbjct: 390 YWSLGCMLFESLVGYTPFSGSSTNETYENLRYWKKTLRRPRTEDRRAAFSDRTWDLITRL 449

Query: 308 ---PIQFGRYLEIVRNLSFEETPDYEGYR 333
              PI   R  E VR +S+    ++E  R
Sbjct: 450 IADPINRVRSFEQVRKMSYFAEINFETLR 478

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 14/96 (14%)

Query: 183 HDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARY 242
           + +I+RDIKP N L+   G     +I L DFG++++  +      +         GT+ Y
Sbjct: 248 YKIIHRDIKPSNVLINSKG-----RIKLCDFGVSRKLNNSIADTFV---------GTSTY 293

Query: 243 MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
           MS     G + + + D+ +LG +    L G+ P  G
Sbjct: 294 MSPERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGG 329

>ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH]
           (797020..798951) [1932 bp, 643 aa]
          Length = 643

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 81/186 (43%), Gaps = 32/186 (17%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILTGTPGVPQ 128
           Y I   +G+G+FG + +  NM     VA+K    KTE   Q   E +  ++L        
Sbjct: 273 YLILDILGQGTFGQVVKCQNMQTKEIVAVKVVKSKTEYLNQSIMEAKILELLNKRIDPLN 332

Query: 129 AYYFGQEGLHN--------ILVIDLLGPSLEDLFDWCNRKF---SVKTVVQVAVQMITLI 177
            ++F +  LH+         LV +LL  +L +L      KF   S+  +     Q++  +
Sbjct: 333 QHHFLR--LHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSMNLIKNFCKQLLDSL 388

Query: 178 EDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ-------------YRDPKT 224
             L    LI+ D+KP+N L+  P   D  ++ +IDFG A +             YR P+ 
Sbjct: 389 CVLKESKLIHCDLKPENVLLVSP---DRPELKVIDFGSACEEARTVYTYIQSRFYRAPEV 445

Query: 225 KQHIPY 230
              IPY
Sbjct: 446 LMGIPY 451

>Kwal_26.8751
          Length = 848

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 103/229 (44%), Gaps = 35/229 (15%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           +YKI K +GEGSFG ++  ++ +    V +K   +    P +  E   ++         Q
Sbjct: 36  NYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSKND--PNVVREVFYHR---------Q 84

Query: 129 AYYFGQEGLHNILVID-LLGPSLE-----DLFDW--CNRKFSVKTVVQVAVQMITLIEDL 180
             Y     L+ ++V +  +  +LE     +L+++    +   ++   ++  Q++  +   
Sbjct: 85  FDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYA 144

Query: 181 HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTA 240
           H+   ++RD+K +N L+ + GH       L DFG     R+  TK  +     +++ GT 
Sbjct: 145 HSMKCVHRDLKLENILLDKKGH-----AKLTDFGFT---RECATKGIL-----ETICGTT 191

Query: 241 RYMSINTHLGRE--QSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQK 287
            YM+    + R+  +  + D  +LG + +  + G +P+  +     K K
Sbjct: 192 VYMAPEL-IERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYK 239

>KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces
           cerevisiae YPR161c SGV1 ser/thr protein kinase,
           hypothetical start
          Length = 645

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 112/304 (36%), Gaps = 73/304 (24%)

Query: 42  MTPANQTPAS-------TASPPTSMRDDST--------------IVGL-----HYKIGKK 75
           M+  N+ PAS           PT ++DD T              + G+     +Y+  +K
Sbjct: 1   MSTVNKKPASLKYKIGKVKQIPTVVKDDKTGLEYIQVQSRENEKVYGVTKFLNNYREEEK 60

Query: 76  IGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLK------------------------ 111
           +G+G+FG +F+G ++     VAIK    + E                             
Sbjct: 61  LGQGTFGEVFKGIHLGTNRKVAIKRILVRAEKDLFPITAQREITILKRMNHKNIVKLIEI 120

Query: 112 --DEYRTYKILTGTPGVPQAYYFGQE---------GLHNILVIDLLGPSLEDLFDWCNRK 160
             DE  T K  + +P  P   Y G           G H  +++  +   L  L      +
Sbjct: 121 VYDESPTPKTDSTSP-RPVGNYHGNNTANQQKLITGKHFFMILPYMVSDLTGLLHNPRVE 179

Query: 161 FSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYR 220
           F +  V  + +Q++  I  +H +  ++RDIK  N L+   G      + + DFG+A+ Y 
Sbjct: 180 FGMADVKNIMLQLLEGINYIHCNKFLHRDIKTANILIDHKG-----VVKIADFGLARNYY 234

Query: 221 DPKTKQHIP-----YREKKSLSGTARYMSINTHLG-REQSRRDDMEALGHVFFYFLRGQL 274
                   P       +  S+  T  Y +    LG R  +   D+  +G VF  F   + 
Sbjct: 235 GSPPNLKYPGGAGSGAKYTSVVVTRWYRAPEIVLGDRHYTTAVDIWGIGCVFAEFFEKKP 294

Query: 275 PWQG 278
             QG
Sbjct: 295 ILQG 298

>Scas_627.7
          Length = 349

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 13/110 (11%)

Query: 168 QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQH 227
           +   Q+   +  LH   +I+RD+KP+N L+G       N I L DFG +    +P+  + 
Sbjct: 193 RFVFQIADALNYLHDKQIIHRDLKPENILIGF-----NNVIKLTDFGWS--IINPRGVK- 244

Query: 228 IPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ 277
                +K+L GT  Y+S      RE   + D+ ALG + +  + G  P++
Sbjct: 245 -----RKTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPFE 289

>KLLA0A06776g 612115..614517 some similarities with sp|P36003
           Saccharomyces cerevisiae YKL171w singleton, hypothetical
           start
          Length = 800

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 95/212 (44%), Gaps = 25/212 (11%)

Query: 29  SASNLRLLNGNLPMTPANQ-TPASTASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEG 87
           S  N+R  +G++     N  TP S++      RDD     L +++GK IG G++G++ E 
Sbjct: 372 STHNVRSRHGSVASKYLNSFTPGSSSFK----RDDKGSFILGHRLGKIIGFGAWGMIREC 427

Query: 88  ----------TNMINGLPVAIKFEPRKTEAPQLKDEYRTYKILTGTPGVPQAYYFGQEGL 137
                      N        IKF+  ++   Q+  E   +  L+    +P   +   + L
Sbjct: 428 FPSTDESQNQNNTCCKAMKIIKFKDNRSVKRQVLREISIWSKLSHNNILPLTKWKLDDDL 487

Query: 138 HNILVIDLL--GPSLEDLFDW--C-NRKFSVKTVVQ----VAVQMITLIEDLHAHDLIYR 188
               + D +  G   + +  W  C N K S++   Q    +A+Q+I  ++ +H+  + + 
Sbjct: 488 VAYCLTDKIDHGTLYDLVVSWGECGNSKISLRERCQATSALALQLIDAVQYMHSKFIAHG 547

Query: 189 DIKPDNFLVGRPGHEDAN-KIHLIDFGMAKQY 219
           DIK +N L+ +      + K+ L DFGM+  Y
Sbjct: 548 DIKLENCLLEKKSENYKDWKLVLCDFGMSHFY 579

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 72/135 (53%), Gaps = 25/135 (18%)

Query: 168 QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQH 227
           +V+  +++ ++ LHA+++++RD+K +N ++ + G     +I LIDFG++  Y DP+    
Sbjct: 195 KVSRGILSALQYLHANNIVHRDLKIENIMLSKTG-----EIKLIDFGLSNMY-DPR---- 244

Query: 228 IPYREKKSLSGTARY-----MSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282
              +  ++  G+  +     +  + +LG E     D+ + G V +  + G++P+      
Sbjct: 245 ---KSLQTFCGSLYFAAPELLKAHPYLGPEV----DVWSFGVVLYVLVCGKVPFDD---E 294

Query: 283 NNKQKYEKIGEKKRT 297
           N+   +EKI + K T
Sbjct: 295 NSSALHEKIKKGKVT 309

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/273 (19%), Positives = 109/273 (39%), Gaps = 36/273 (13%)

Query: 28   QSASNLRLLNGNLPMTPANQTPASTASPPTSMRDDSTIVGLHYK--------------IG 73
            Q  ++  +L   + + P +  P+ T    +  +  ++    H K              + 
Sbjct: 768  QDHASKEVLQETVSLAPTSTHPSRTTDQQSPQKSQTSTSAKHKKRAAKRRKVSLDNFVLL 827

Query: 74   KKIGEGSFGVLFEGTNMINGLPVAIKFEPRKT-----EAPQLKDEYRTYKILTGT--PGV 126
            K +G+G+FG +    +       AIK   +       +    + E + + + T T  P +
Sbjct: 828  KVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFL 887

Query: 127  PQAYYFGQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLI 186
               Y   Q        ++ +G   + ++   N++ SV+     A +++  ++  H + +I
Sbjct: 888  TNLYCSFQTENRIYFAMEFIGGG-DLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVI 946

Query: 187  YRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKS-LSGTARYMSI 245
            YRD+K +N L+   GH     I + D+G+         K  + Y  + S   GT  +M+ 
Sbjct: 947  YRDLKLENILLTPEGH-----IKIADYGLC--------KDEMWYGNRTSTFCGTPEFMAP 993

Query: 246  NTHLGREQSRRDDMEALGHVFFYFLRGQLPWQG 278
                 +E ++  D  A G + +  L  Q P+ G
Sbjct: 994  EILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSG 1026

>YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3
           subfamily of protein kinases, required for induction of
           IME2 by Ime1p [1113 bp, 370 aa]
          Length = 370

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 81/177 (45%), Gaps = 17/177 (9%)

Query: 53  ASPPTSMRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTEAPQLKD 112
           A PP ++ D +  V + +   + +G GSFGV+F          VAIK   +  +  + K+
Sbjct: 23  AHPPPTI-DPNDPVQISFPTTEVVGHGSFGVVFATVIQETNEKVAIK---KVLQDKRFKN 78

Query: 113 -EYRTYKILTGTPGVPQAYYF----GQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVV 167
            E    K+L+    +   Y+F     Q+ ++  L+++ +  SL         + +  + +
Sbjct: 79  RELEIMKMLSHINIIDLKYFFYERDSQDEIYLNLILEYMPQSLYQRLRHFVHQRTPMSRL 138

Query: 168 QVAVQMITLIEDL----HAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYR 220
           ++   M  L + L    H  ++ +RDIKP N LV      +   + L DFG AKQ +
Sbjct: 139 EIKYYMFQLFKSLNYLHHFANVCHRDIKPQNLLVD----PETWSLKLCDFGSAKQLK 191

>CAGL0F03245g complement(316924..320034) similar to sp|P32361
           Saccharomyces cerevisiae YHR079c IRE1, hypothetical
           start
          Length = 1036

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 104/250 (41%), Gaps = 67/250 (26%)

Query: 74  KKIGEGSFG-VLFEGTNMINGLPVAIKFEPRKTEAPQLKDEY-----RTYKILTGTPGVP 127
           K +G GS G V++EG           KF+ R     ++  ++     +  ++L+ +   P
Sbjct: 605 KVLGYGSSGTVVYEG-----------KFQERSVAVKRMLVDFYDIASKEIELLSESDEHP 653

Query: 128 QA--YYFGQEGLHNILV-IDLLGPSLEDLFDWCN-----RKFSVKTVVQVAVQMITLIED 179
               YY  +E    + + ++L   +LE L +  N     ++     +V +  Q+   I  
Sbjct: 654 NVVRYYCSEETSKFLYIALELCDSNLEQLIETNNVMRHEQRLKDYELVDILAQITQGIAY 713

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHE----------DANKIHLIDFGMAKQ--YRDPKTKQH 227
           LH+ ++I+RDIKP N L+ +              +  +I L DFG+ K+  +     K +
Sbjct: 714 LHSLNIIHRDIKPQNILISKSKKRLQKPTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTN 773

Query: 228 IPYREKKSLSGTARYMS-------------------------INTHLGREQSRRDDMEAL 262
           I     K+ +GT  +M+                          + +L R  ++  D+ +L
Sbjct: 774 I-----KNAAGTVGWMAPELLIEDENSNKISVSQEIEKIDEVYDPYLRRRLTKAIDIFSL 828

Query: 263 GHVFFYFLRG 272
           G VF+Y L G
Sbjct: 829 GCVFYYVLSG 838

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 14/130 (10%)

Query: 160 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           + S K + ++A  ++  +  LH   +I+RDIKP N L+   G     ++ L DFG++ + 
Sbjct: 320 RISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENG-----QVKLCDFGVSGEA 374

Query: 220 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 279
            +             + +GT+ YM+     G+  S   D+ +LG        G+ P    
Sbjct: 375 VNSLA---------TTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSE 425

Query: 280 KAPNNKQKYE 289
           K   N   +E
Sbjct: 426 KMAANIAPFE 435

>ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C
           (PRR2) - SH] (128217..130394) [2178 bp, 725 aa]
          Length = 725

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/223 (20%), Positives = 96/223 (43%), Gaps = 21/223 (9%)

Query: 69  HYKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVP 127
           + + G+K+G G+ G +     + + +  A+K F P+     + K +Y           + 
Sbjct: 389 YSRTGEKLGAGAGGSVKLVRRLKDNVVFAVKEFRPKHEN--ETKRDY--------IKKIT 438

Query: 128 QAYYFGQEGLHNILVIDLLGPSLEDLFDWC-NRKFSVKTVVQVAVQMITLIEDLHAHDLI 186
             Y  G    H+ +++ ++     DLF    + + S + +     Q++  I  LH+  L 
Sbjct: 439 SEYCIGSTLRHSNIILQVMEYCDYDLFAIVMSNRMSYEEICCCLKQILIGIGYLHSLGLA 498

Query: 187 YRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSIN 246
           +RD+K DN ++   G      + +IDFG A  +  P +   +   E   + G+  Y++  
Sbjct: 499 HRDLKLDNCVLNSQG-----IVKIIDFGAAVVFTYPHSGTLV---EASGIVGSDPYLAPE 550

Query: 247 THL-GREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKY 288
             +  +   R  D+ +   ++   +  + PW+  K  +N  K+
Sbjct: 551 VCIFSKYDPRPVDIWSAAIIYACMILKKFPWKIPKLKDNSFKF 593

>CAGL0I05896g 560169..562505 some similarities with sp|P14680
           Saccharomyces cerevisiae YJL141c YAK1 ser/thr protein
           kinase, hypothetical start
          Length = 778

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 80/184 (43%), Gaps = 28/184 (15%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIKFEPRKTE-APQLKDEYRTYKILTGTPGVPQ 128
           Y +   +G+G+FG + +  N+     +A+K    ++E   Q   E +  ++L        
Sbjct: 361 YLVLDILGQGTFGQVVKCQNLQTKEIIAVKVVKSRSEYLNQSISEAKILELLNEKIDPNN 420

Query: 129 AYYFGQ------EGLHNILVIDLLGPSLEDLFDWCNRKF---SVKTVVQVAVQMITLIED 179
            ++F +         H  LV +LL  +L +L      KF   S++ +    +Q++  +  
Sbjct: 421 KHHFLRMHDSFVHKNHLCLVFELLSNNLYELLK--QNKFHGLSIQLIRTFTIQILDSLCV 478

Query: 180 LHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQ-------------YRDPKTKQ 226
           L    LI+ D+KP+N L+  P   D   + +IDFG + +             YR P+   
Sbjct: 479 LKDSKLIHCDLKPENILLCSPDKPD---LKVIDFGSSCEETRTVYTYIQSRFYRAPEIIL 535

Query: 227 HIPY 230
            IPY
Sbjct: 536 GIPY 539

>Kwal_14.2497
          Length = 418

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 12/123 (9%)

Query: 172 QMITLIEDLHAH-DLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQHIPY 230
           Q+I  I+ LH    + +RDIKP+N L+   G+     + L DFG+A Q++     + I  
Sbjct: 30  QLINAIDHLHNRCGVAHRDIKPENLLLDERGN-----LKLADFGLASQFKRKDGSKRIMS 84

Query: 231 REKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEK 290
             + SL   A  +  +     + +   D+ + G + F  L G+ PW    +P++  +++ 
Sbjct: 85  DTRGSLPYMAPEIVYSKSYYADST---DIWSCGVLVFVLLTGETPWD---SPSDDSRFDD 138

Query: 291 IGE 293
             E
Sbjct: 139 FLE 141

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 163 VKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDP 222
           +  +V+   Q +  + D H   +I+RDIK DN L+     +   ++ + DFG   +  D 
Sbjct: 670 IAYIVRETCQGLKFLHDKH---IIHRDIKSDNVLL-----DTRARVKITDFGFCARLTDK 721

Query: 223 KTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPW 276
           ++K       + ++ GT  +M+      RE   + D+ +LG +    L G+ P+
Sbjct: 722 RSK-------RATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPY 768

>Kwal_14.1249
          Length = 344

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPKTKQ 226
           Q+   + +LH H +I+RD+K  N +V   G  D  ++ LIDFG+A    DP+T Q
Sbjct: 124 QLADALSNLHEHKIIHRDVKLQNVMVDEDGPHDIPQLVLIDFGIA---YDPETSQ 175

>Scas_667.18
          Length = 437

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 80/170 (47%), Gaps = 38/170 (22%)

Query: 70  YKIGKKIGEGSFGVL---FEGTNMINGLPVAIKFEPRKTEAPQ----LKDEYRTYKILTG 122
           YKI K +G+GS+GV+    +  N  N  PVAIK   + T   Q    LK   R  K +  
Sbjct: 78  YKIIKVLGKGSYGVVCSAMDNKNPANAYPVAIK---KVTNIFQKEILLKRAIRELKFMN- 133

Query: 123 TPGVPQAYYFGQEGLHNILVIDLLGP--------SLEDLFDW-------CNRKFSVKTVV 167
                  ++ G + + N++ ++++            ++L D+        + K +   + 
Sbjct: 134 -------FFQGHKNIVNLIDLEIINENSPYDGLYCYQELIDYDLAKVIHSSIKLTEFHIQ 186

Query: 168 QVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK 217
               Q+++ ++ +H+ D+I+RD+KP N L    G+     + + DFG+A+
Sbjct: 187 YFMYQILSGLKYIHSADVIHRDLKPGNILCTLNGN-----LKICDFGLAR 231

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 14/125 (11%)

Query: 160 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           + S K + ++A  ++  +  LH   +I+RDIKP N L+   G     ++ L DFG++ + 
Sbjct: 297 RISEKVLGKIAESVLRGLSYLHERRIIHRDIKPQNILLNEIG-----QVKLCDFGVSGEA 351

Query: 220 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 279
            +             + +GT+ YM+     G+  S   D+ +LG       +G  P+   
Sbjct: 352 VNSLA---------TTFTGTSYYMAPERIQGQPYSVTSDVWSLGLTLLEVAQGHFPFNSD 402

Query: 280 KAPNN 284
           K   N
Sbjct: 403 KMAIN 407

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 19/123 (15%)

Query: 170 AVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQYRDPK------ 223
           A ++   +E LH    IYRD+KP+N L+ + GH     I L DF ++ Q +D K      
Sbjct: 602 ASEVTAALEYLHLLGFIYRDLKPENILLHQSGH-----IMLSDFDLSIQAKDSKVPVVKG 656

Query: 224 --------TKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLP 275
                   TK         S  GT  Y++     G   +   D   LG + +  L G  P
Sbjct: 657 SAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTP 716

Query: 276 WQG 278
           ++G
Sbjct: 717 FKG 719

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 101/238 (42%), Gaps = 35/238 (14%)

Query: 70  YKIGKKIGEGSFGVLFEGTNMINGLPVAIK-FEPRKTEAPQLKDEYRTYKILTGTPGVPQ 128
           Y +GK++G G + ++ E  N   G  VA+K F  ++ +  +   ++R    +      P 
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQHPN 259

Query: 129 AYYF--------GQEGLHNILVIDLLGPSLEDLFDWCNRKFSVKTVVQVAV--QMITLIE 178
                        +  +   LV++ +     +LF+   RK  ++     A+  Q++T ++
Sbjct: 260 IVNLLDSFVEPISKSQIQKYLVLEKIDDG--ELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 179 DLHAHDLIYRDIKPDNFLVGRPGHEDANKIHL--------------IDFGMAKQYRDPKT 224
            LH  ++I+RDIKP+N L+     E+ +++ L               DFG+AK   + + 
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQF 377

Query: 225 KQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAP 282
                     +L GT  Y++      +  + + D+ + G + +  L G  P+     P
Sbjct: 378 TN--------TLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGP 427

>Scas_716.33
          Length = 573

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 86/230 (37%), Gaps = 58/230 (25%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAK-------------- 217
           +M   +  LH     +RD+KP+NFL+   GH     I L DFG+A               
Sbjct: 284 EMFLAVNALHDLGYTHRDLKPENFLIDAKGH-----IKLTDFGLAAGTISNDRIQSMKVR 338

Query: 218 ----------QYRDP----KTKQHIPYREKK-----SLSGTARYMSINTHLGREQSRRDD 258
                     ++ D     + + +  YRE +     S+ G+  YM++    G++     D
Sbjct: 339 LEEVKNLEFPEFSDKSIEDRRQMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVD 398

Query: 259 MEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTT--------------NVYDLA 304
             +L  + F  L G  P+ G    +  + YE +   K+T                 +D  
Sbjct: 399 YWSLSCMLFESLVGYTPFSG---SSTNETYENLRHWKKTLRRPMLDNGRPAFSDRTWDFI 455

Query: 305 QGL---PIQFGRYLEIVRNLSFEETPDYEGYRMLLLSALDDLGQSADGEY 351
             L   PI   R  E V+ +++ E+ D+   R L    +  L    D  Y
Sbjct: 456 TRLIADPINRLRSFEHVKRMTYFESVDFNTLRDLSPPFIPQLDNETDAGY 505

>Scas_649.30
          Length = 648

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 71/171 (41%), Gaps = 35/171 (20%)

Query: 147 GPSLEDLFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLV-GRPGHEDA 205
           G  ++D  +W            V V MI  +  L A+  I+RDIKP N L   R GH   
Sbjct: 216 GCDVQDFTEW------------VFVDMIKALRFLEANGCIHRDIKPANILCNARDGH--- 260

Query: 206 NKIHLIDFGMA------KQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSR---R 256
               + DFG +        ++DPK  +H    E   + GT  +++       E  R   R
Sbjct: 261 --FQISDFGCSILLPRYVPFKDPKL-EHCFQMELNKIIGTPAFIAPELCHFNESKRNNIR 317

Query: 257 D----DMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDL 303
           D    D+ +LG   +  L  +LP+ G    N    Y K+  +   +++ D+
Sbjct: 318 DGFKLDIWSLGITLYCLLHNKLPFSG---ENEFDTYHKVVSESLDSDLDDV 365

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 57/125 (45%), Gaps = 14/125 (11%)

Query: 160 KFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMAKQY 219
           + S + + ++A  ++  +  LH   +I+RDIKP N L+   G     +I L DFG++ + 
Sbjct: 313 RISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKG-----EIKLCDFGVSGEA 367

Query: 220 RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGL 279
            +             + +GT+ YM+     G+  S   D+ +LG        G+ P++  
Sbjct: 368 VNSLA---------MTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESD 418

Query: 280 KAPNN 284
           K   N
Sbjct: 419 KITQN 423

>Scas_713.21
          Length = 641

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 153 LFDWCNRKFSVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLID 212
           L +  NR F +  V  ++ +MI  I+ +H  D+++ D+KP NF+  +        + LID
Sbjct: 408 LHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK------GTLKLID 461

Query: 213 FGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQS-----------RRDDMEA 261
           FG+A +  D     +     + +  GT  YM+  T + +  S           +  D+ +
Sbjct: 462 FGIANKIADNTLNVY-----RNTQMGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWS 516

Query: 262 LGHVFFYFLRGQLPWQGL 279
            G + +    G  P+   
Sbjct: 517 YGCILYQMTYGHPPYSSF 534

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 70/183 (38%), Gaps = 41/183 (22%)

Query: 172 QMITLIEDLHAHDLIYRDIKPDNFLVGRPGHEDANKIHLIDFGMA--------------- 216
           +M   +  LH     +RD+KP+NFL+   GH     I L DFG+A               
Sbjct: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGH-----IKLTDFGLAAGTVSNERIESMKIR 331

Query: 217 ----KQYRDPK-TKQHIPYREK-------------KSLSGTARYMSINTHLGREQSRRDD 258
               K    P  T++ I  R K              S+ G+  YM++    G++     D
Sbjct: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391

Query: 259 MEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLAQGLPIQFGRYLEIV 318
             +LG + F  L G  P+ G    +  + YE +   KRT     L  G      R  E++
Sbjct: 392 YWSLGCMLFEALIGYTPFSG---SSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELI 448

Query: 319 RNL 321
             L
Sbjct: 449 TRL 451

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,698,927
Number of extensions: 734835
Number of successful extensions: 3035
Number of sequences better than 10.0: 575
Number of HSP's gapped: 2810
Number of HSP's successfully gapped: 597
Length of query: 523
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 417
Effective length of database: 12,926,601
Effective search space: 5390392617
Effective search space used: 5390392617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)