Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_650.23*1151155033e-67
YML108W1051143113e-38
Kwal_27.103281271052942e-35
AAL184W1121092915e-35
KLLA0D01661g1121172812e-33
CAGL0J06666g1121062761e-32
Sklu_767.199742732e-32
Scas_650.1165645602.6
KLLA0D05313g20435584.1
Sklu_2144.320435566.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_650.23*
         (115 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_650.23*                                                          198   3e-67
YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown...   124   3e-38
Kwal_27.10328                                                         117   2e-35
AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..132...   116   5e-35
KLLA0D01661g complement(148193..148531) similar to sp|Q03759 Sac...   112   2e-33
CAGL0J06666g complement(636953..637291) similar to sp|Q03759 Sac...   110   1e-32
Sklu_767.1 YML108W, Contig c767 652-951 reverse complement            109   2e-32
Scas_650.11                                                            28   2.6  
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...    27   4.1  
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                            26   6.5  

>Scas_650.23*
          Length = 115

 Score =  198 bits (503), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 102/115 (88%), Positives = 102/115 (88%)

Query: 1   MSKDNMYRMXXXXXXXXXXXXXFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60
           MSKDNMYRM             FDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW
Sbjct: 1   MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60

Query: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQDLNESE 115
           FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQDLNESE
Sbjct: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQDLNESE 115

>YML108W (YML108W) [3863] chr13 (54793..55110) Protein of unknown
           function [318 bp, 105 aa]
          Length = 105

 Score =  124 bits (311), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 67/114 (58%), Positives = 79/114 (69%), Gaps = 16/114 (14%)

Query: 1   MSKDNMYRMXXXXXXXXXXXXXFDNDTTDSKATE------PKKTHEFIEELLLPFEVSEL 54
           MSK N YRM              ++DT  +K  E      P K HEF++EL+LPF V EL
Sbjct: 1   MSKSNTYRMLVL----------LEDDTKINKEDEKFLKGKPGKMHEFVDELILPFNVDEL 50

Query: 55  DALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDN 108
           D LN WFDKFD EICIPNEGHIKYEISSDGLIVL+LDKEIE V+ +VKKF+++N
Sbjct: 51  DELNTWFDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEEN 104

>Kwal_27.10328
          Length = 127

 Score =  117 bits (294), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 1   MSKDNMYRMXXXXXXXXXXXXXFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60
           MS +  YRM              D +  ++    PK THEF++EL+LPFE+ ++D LN+W
Sbjct: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEEN-TDAPKATHEFVDELILPFEIDDMDTLNEW 73

Query: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFI 105
           FDKFD EICIPNEG IKYEISSDGL+VLLLD+  E V++EV+KF+
Sbjct: 74  FDKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFV 118

>AAL184W [3] [Homologous to ScYML108W - SH] complement(12906..13244)
           [339 bp, 112 aa]
          Length = 112

 Score =  116 bits (291), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (66%), Gaps = 7/109 (6%)

Query: 1   MSKDNMYRMXXXXXXXXXXXXXFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60
           M+ DN YRM                 +TD +  E   +H+F++ELLLP +V +L+ LN W
Sbjct: 1   MATDNFYRMMILLEEPHK------QHSTDGRKIE-NASHDFVDELLLPIQVDDLEVLNTW 53

Query: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQ 109
           FDKFDEEICIPNEGHIKYEISSDGLIVL+LDKEI  VI  V+ F+  NQ
Sbjct: 54  FDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102

>KLLA0D01661g complement(148193..148531) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w hypothetical protein
           singleton, start by similarity
          Length = 112

 Score =  112 bits (281), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (65%), Gaps = 13/117 (11%)

Query: 2   SKDNMYRMXXXXXXXXXXXXXFDNDTTDSKATEPKK---THEFIEELLLPFEVSELDALN 58
           + +N+YRM              +   ++S     KK   THEF++EL LP +V E+D LN
Sbjct: 3   ATENVYRMLIL----------LEEPISESAGDTKKKQNATHEFVDELPLPIQVDEMDLLN 52

Query: 59  KWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFIDDNQDLNESE 115
            WFDKFDE+ICIPNEGHIKYEISSDGLIVL+LDK IE+++ EV  F++ N   +E E
Sbjct: 53  SWFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQNVPESEKE 109

>CAGL0J06666g complement(636953..637291) similar to sp|Q03759
           Saccharomyces cerevisiae YML108w, start by similarity
          Length = 112

 Score =  110 bits (276), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 75/106 (70%), Gaps = 8/106 (7%)

Query: 5   NMYRMXXXXXXXXXXXXXFDNDTTDSKATEPKKT-HEFIEELLLPFEVSELDALNKWFDK 63
           N+YRM              + D T S + E KK  HEF++EL LPF++ E+D LNKWFDK
Sbjct: 3   NLYRMMVLLEEP------MEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDK 56

Query: 64  FDEEICIPNEGHIKYEISSDGLIVLLLDKEI-ENVISEVKKFIDDN 108
           FD+EICIPNEGHIKYEI+SDGLIVL+LDKE+ E  + +VK F++ N
Sbjct: 57  FDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQN 102

>Sklu_767.1 YML108W, Contig c767 652-951 reverse complement
          Length = 99

 Score =  109 bits (273), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 48/74 (64%), Positives = 66/74 (89%)

Query: 36  KKTHEFIEELLLPFEVSELDALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIE 95
           K +HEF++EL+LP +V E+D LN WFDKFDE+ICIPNEG+IKYEISSDGLIVL+L+KE E
Sbjct: 20  KTSHEFVDELVLPIQVDEMDLLNDWFDKFDEQICIPNEGYIKYEISSDGLIVLILNKERE 79

Query: 96  NVISEVKKFIDDNQ 109
            V+ +V++F++++Q
Sbjct: 80  EVVDKVRRFVEEHQ 93

>Scas_650.11
          Length = 656

 Score = 27.7 bits (60), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 41 FIEELLLPFEVSELDALNK--WFDKFDEEICIPNEGHIKYEISSD 83
          F++ ++  F+ S  D L++  W+ K ++ I +P  GH    ++S+
Sbjct: 44 FVKLIIPTFQTSAFDPLSESDWYTKNNDGILLPTSGHFVSLLTSN 88

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score = 26.9 bits (58), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 25  NDTTDSKATEPKKTHEFIEELLLPF-EVSELDALN 58
           ND TD K  + +   EF + + +PF E S LD+ N
Sbjct: 123 NDLTDKKVVDTEVAKEFADSIGIPFIETSALDSSN 157

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score = 26.2 bits (56), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 25  NDTTDSKATEPKKTHEFIEELLLP-FEVSELDALN 58
           ND TD K  E +   EF + L +P  E S LD+ N
Sbjct: 123 NDLTDKKVVEYEVAKEFADSLQIPVLETSALDSSN 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,867,733
Number of extensions: 162638
Number of successful extensions: 489
Number of sequences better than 10.0: 25
Number of HSP's gapped: 489
Number of HSP's successfully gapped: 25
Length of query: 115
Length of database: 16,596,109
Length adjustment: 85
Effective length of query: 30
Effective length of database: 13,653,579
Effective search space: 409607370
Effective search space used: 409607370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)