Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_650.2299399343300.0
YML109W (ZDS2)9428719781e-116
YMR273C (ZDS1)9152105052e-52
CAGL0J06688g8282104854e-50
KLLA0D01683g9441024643e-47
AAL185W10184554592e-46
CAGL0F03421g8171794543e-46
Kwal_27.103189251284431e-44
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_650.22
         (993 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_650.22                                                          1672   0.0  
YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in r...   381   e-116
YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein t...   199   2e-52
CAGL0J06688g complement(637917..640403) similar to sp|P54786 Sac...   191   4e-50
KLLA0D01683g complement(148855..151689) some similarities with s...   183   3e-47
AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS...   181   2e-46
CAGL0F03421g complement(336157..338610) similar to sp|P50111 Sac...   179   3e-46
Kwal_27.10318                                                         175   1e-44

>Scas_650.22
          Length = 993

 Score = 1672 bits (4330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 844/993 (84%), Positives = 844/993 (84%)

Query: 1   MEHNTNLLPLRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPE 60
           MEHNTNLLPLRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPE
Sbjct: 1   MEHNTNLLPLRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPE 60

Query: 61  LEFRVNNDKSNQSTPIGSYERSNENLXXXXXXXXXXXXXXXXXXXXXXXLTQTEYLHDAS 120
           LEFRVNNDKSNQSTPIGSYERSNENL                       LTQTEYLHDAS
Sbjct: 61  LEFRVNNDKSNQSTPIGSYERSNENLEQINEPEDNENDESSVSIDDSIELTQTEYLHDAS 120

Query: 121 VPQTNRTVTPEEPSHRSMSGAGSLKRNGSSISKRKLPFISTGMXXXXXXXXXXXXXXXXX 180
           VPQTNRTVTPEEPSHRSMSGAGSLKRNGSSISKRKLPFISTGM                 
Sbjct: 121 VPQTNRTVTPEEPSHRSMSGAGSLKRNGSSISKRKLPFISTGMSAAPTSHLSPSSTSTSS 180

Query: 181 XXXXXXXXXXXXXDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXX 240
                        DDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQH  
Sbjct: 181 SSSSSSNSASSSPDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHEN 240

Query: 241 XXXXXXXXXXXXXXXXMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTXXXX 300
                           MSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYT    
Sbjct: 241 EKSNNNKENIDISKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEE 300

Query: 301 XXXXXXXXXXAKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNK 360
                     AKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNK
Sbjct: 301 DDYSNSEESEAKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNK 360

Query: 361 AGLTDSDAITLARTLSMASSFSDGNVNLGKSKLQXXXXXXXXFASNMFMKNGLTIPERSS 420
           AGLTDSDAITLARTLSMASSFSDGNVNLGKSKLQ        FASNMFMKNGLTIPERSS
Sbjct: 361 AGLTDSDAITLARTLSMASSFSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSS 420

Query: 421 LRRSKFNXXXXXXXXXXXXXXXXXXPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATT 480
           LRRSKFN                  PLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATT
Sbjct: 421 LRRSKFNTYRIRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATT 480

Query: 481 TSSPGSISDLYDHYQDNAESKQGNDNDNEARQGDLSHAXXXXXXXXXXXXXXXXXXLVKP 540
           TSSPGSISDLYDHYQDNAESKQGNDNDNEARQGDLSHA                  LVKP
Sbjct: 481 TSSPGSISDLYDHYQDNAESKQGNDNDNEARQGDLSHASISQESSFLSNESSNDSILVKP 540

Query: 541 LGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGNRANSEEDA 600
           LGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGNRANSEEDA
Sbjct: 541 LGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWSGNRANSEEDA 600

Query: 601 TVLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLKINKEAELPKESHKRETIEKRFVKLF 660
           TVLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLKINKEAELPKESHKRETIEKRFVKLF
Sbjct: 601 TVLVNSQDEDQTGYTDQKSKSRHRPILARSRDHLKINKEAELPKESHKRETIEKRFVKLF 660

Query: 661 RRKGHDNGNXXXXXXXXXXXXXXXXXXXXISKKNQVTTEEPKEITVEVQEPEEILEDTNQ 720
           RRKGHDNGN                    ISKKNQVTTEEPKEITVEVQEPEEILEDTNQ
Sbjct: 661 RRKGHDNGNKQQVLKKKSSSSTLSKFQKQISKKNQVTTEEPKEITVEVQEPEEILEDTNQ 720

Query: 721 GTNRQDPLRLSTPIIPQPVHSIISDTTPIADGDHALSNKDTDDEAIEALPSLQPAVSVTS 780
           GTNRQDPLRLSTPIIPQPVHSIISDTTPIADGDHALSNKDTDDEAIEALPSLQPAVSVTS
Sbjct: 721 GTNRQDPLRLSTPIIPQPVHSIISDTTPIADGDHALSNKDTDDEAIEALPSLQPAVSVTS 780

Query: 781 TKNVHLSASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVMNSSDLQSIENSSDDI 840
           TKNVHLSASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVMNSSDLQSIENSSDDI
Sbjct: 781 TKNVHLSASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVMNSSDLQSIENSSDDI 840

Query: 841 NTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINV 900
           NTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINV
Sbjct: 841 NTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINV 900

Query: 901 ERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTD 960
           ERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTD
Sbjct: 901 ERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTD 960

Query: 961 VIDSDIHESSSYGTGVYTTEQNNANGTILIPEI 993
           VIDSDIHESSSYGTGVYTTEQNNANGTILIPEI
Sbjct: 961 VIDSDIHESSSYGTGVYTTEQNNANGTILIPEI 993

>YML109W (ZDS2) [3862] chr13 (51640..54468) Protein involved in
           regulation of transcriptional silencing and life span,
           multicopy suppressor of sin4 [2829 bp, 942 aa]
          Length = 942

 Score =  381 bits (978), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 309/871 (35%), Positives = 415/871 (47%), Gaps = 206/871 (23%)

Query: 195 DLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXXX 254
           DLT+NLLWVPA+QHPNVKPENYLEL+QDTLQNI +                         
Sbjct: 206 DLTQNLLWVPADQHPNVKPENYLELIQDTLQNIQI------------------------- 240

Query: 255 XXMSEEEPIDRHPQSLDKTFLEITNRNR--SLVRRPSRLRTSYTXXXXXXXXXXXXXXAK 312
              S  + ID +   L    + I+NR R  S+VRRPSRL+TSYT                
Sbjct: 241 ---STNQDIDENKLELGNNHV-ISNRKRTGSVVRRPSRLKTSYTKFD------------- 283

Query: 313 TNESQLSSR-EEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITL 371
            +E  L+ + +E     + R   + ++    RSVSLK+ITEELT ISN AGLTDSDA+TL
Sbjct: 284 -DEPPLADKPQEGEIQVDKRISSSDIKTI--RSVSLKEITEELTKISNNAGLTDSDAVTL 340

Query: 372 ARTLSMASSFSDGNVNLGKSKLQXXXXXXXXFASNMFMKNGLTIPERSSLRRSKFNXXXX 431
           AR+LSM+ SF++ +++L  +  +        FASNMF + GLTIPERSSLRRSKFN    
Sbjct: 341 ARSLSMSGSFTNESLHLNGNHTENDNE----FASNMFNETGLTIPERSSLRRSKFNTYKI 396

Query: 432 XXXXXXXXXXXXXXPLLQSSSFARQEADTDDLQRS---PVSFTNRDSYLATTTSSPGSIS 488
                          L+           T+D +RS   P S+T     +    +S     
Sbjct: 397 RLEGSSLPQAVKLNSLMN--------IQTNDNRRSASSPASYTQ----VPQEQASLNDFH 444

Query: 489 DLYDHYQDNA-----ESKQGNDNDNE-ARQGDLSHAXXXXXXXXXXXXXXXXXXLVKPLG 542
           +++DHY+  +     E+++  D+ N  + + DL+HA                  L+KP  
Sbjct: 445 EIFDHYRRTSTDWSTENEKYVDSTNYYSDEEDLTHASISQESSLLSTDSSNNSVLIKPHN 504

Query: 543 SKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSW--SGNRA------ 594
           + SMI E LD            Q VS    +  + S + H   GWSW  S N +      
Sbjct: 505 TGSMISEKLD------------QHVSSSEKSNTNNSEANH---GWSWLNSSNGSLNANEQ 549

Query: 595 ----------------NSEEDATVLVNSQDEDQTGYTDQK---SKSRHRPILARSRDHLK 635
                           N + D   L  S+    T    ++   SK+RH PI     +  K
Sbjct: 550 TYQQLTDDEDDEECVDNEKADFVNLSVSRRAKSTKRASERINHSKNRHSPIFQIHSEEAK 609

Query: 636 ------------------------INKEAELPKES----HKRETIEKRFVKLFRRKGHDN 667
                                   + K+ ELP ++    HK+ ++EKR  KLF+RK H+ 
Sbjct: 610 SVVITPSVVSSSESQPSKPTAPAVVEKKVELPTDTQASTHKKNSLEKRLAKLFKRKQHNG 669

Query: 668 ---GNXXXXXXXXXXXXXXXXXXXXISKKNQVTTEEPKEITVEVQEPEEILEDTNQGTNR 724
               +                    +SK  +   ++P+E  VE                 
Sbjct: 670 TCKSDVKVIKKSVKKELKKKASHSSLSKFRKSPKKKPQEAEVE----------------- 712

Query: 725 QDPLRLSTPIIPQPVHSIISDTTPIADGDHALSNKDTDDEAIEALPSLQPAVSVTSTKNV 784
               R S+P        I  DT  + + +   SN  T       LP    +         
Sbjct: 713 ----RPSSPTKTITTEDI--DTASVIEPEVRSSNAST------LLPDSHTS--------- 751

Query: 785 HLSASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVMNSSDLQSIENSSDDINTGN 844
           H S  +VET+ EL  DDS DISGGD++ +V+      R+   ++ L+    +  + NT  
Sbjct: 752 HSSEFVVETISELDGDDSFDISGGDVNYDVEVHSSISRDT--TAGLEEDIGAEREDNTSP 809

Query: 845 TIEHV--LPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVER 902
           T   +  LP RKLTF DV +PD  NAPI+FTDSAFGFPLPM+T STVIMFDHRLGINVER
Sbjct: 810 TAPQISTLPPRKLTFEDVVKPDYSNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINVER 869

Query: 903 AIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTDVI 962
           AIYRLSHLKLSD  RELRQQVLLSNFMY+YLNLVNHTLYMEQV       D+A  G    
Sbjct: 870 AIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQVGTG----DIAFNG---- 921

Query: 963 DSDIHESSSYGTGVYTTEQNNANGTILIPEI 993
                      + +   ++N+++GTILIP+I
Sbjct: 922 ----------DSALGMMDKNDSDGTILIPDI 942

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 52/63 (82%)

Query: 4  NTNLLPLRKTSGSLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEF 63
          N  +  +RKT  S +   +KRKS+VLIAA+SLD E+Q+VKNLKRLSIGSMDL+IDPELEF
Sbjct: 28 NIQMRRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEF 87

Query: 64 RVN 66
          +VN
Sbjct: 88 KVN 90

>YMR273C (ZDS1) [4227] chr13 complement(811232..813979) Protein that
           regulates SWE1 and CLN2 transcription, Sir3p
           phosphorylation, rDNA recombination and silencing, and
           life span, involved in high calcium tolerance and
           regulation of beta-1,3 glucan biosynthesis [2748 bp, 915
           aa]
          Length = 915

 Score =  199 bits (505), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/210 (53%), Positives = 135/210 (64%), Gaps = 31/210 (14%)

Query: 767 EALPSLQPAVSVTSTK-NVHLSASIVETVRELGEDDSQDISGGDLSTEVDN--------- 816
           E+LP LQPAVSV+STK N           +     ++ +IS    S  V           
Sbjct: 694 ESLPQLQPAVSVSSTKSNSRDREEEEAKKKNKKRSNTTEISNQQHSKHVQKENTDEQKAQ 753

Query: 817 -SMLAERNVMNSSDLQS---IENSSDDINTGNTIE----------------HVLPARKLT 856
               A+  V  S  +Q+   ++NS+  + T   +E                 +LP RKLT
Sbjct: 754 LQAPAQEQVQTSVPVQASAPVQNSAP-VQTSAPVEASAQTQAPAAPPLKHTSILPPRKLT 812

Query: 857 FADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSK 916
           FADVK+PD+PN+P+QFTDSAFGFPLP+LTVSTVIMFDHRL INVERAIYRLSHLKLS+SK
Sbjct: 813 FADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVIMFDHRLPINVERAIYRLSHLKLSNSK 872

Query: 917 RELRQQVLLSNFMYAYLNLVNHTLYMEQVA 946
           R LR+QVLLSNFMYAYLNLVNHTLYMEQVA
Sbjct: 873 RGLREQVLLSNFMYAYLNLVNHTLYMEQVA 902

 Score =  165 bits (418), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 156/511 (30%), Positives = 213/511 (41%), Gaps = 106/511 (20%)

Query: 196 LTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXXXX 255
           L KNLLWVPANQHPNVKP+N+LELVQDTLQNI L +                        
Sbjct: 146 LKKNLLWVPANQHPNVKPDNFLELVQDTLQNIQLSDNGEDNDGNSNENNDI--------- 196

Query: 256 XMSEEEPIDRHPQSLDKTFLEITNRNR--------SLVRRPSRLRTSYTXXXXXXXXXXX 307
              E+   D+  QS +       N NR        SL+RRPS LR SYT           
Sbjct: 197 ---EDNGEDKESQSYENKENNTINLNRGLSRHGNASLIRRPSTLRRSYTEFDDNEDDDNK 253

Query: 308 XXXAKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSD 367
              A    +++  R               +    +R VSL+DITEELT ISN AGLTD+D
Sbjct: 254 GDSASETVNKVEER---------------ISKIKERPVSLRDITEELTKISNSAGLTDND 298

Query: 368 AITLARTLSMASSFSD--------GNV---NLGKSKLQXXXXXXXXFASNMFMKNGLTIP 416
           AITLARTLSMA S+SD        G+    ++G S  Q        FASNM + N +T P
Sbjct: 299 AITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGEFASNMPINNTMTWP 358

Query: 417 ERSSLRRSKFNXXXXXXXXXXXXXXXXXXPLLQSS----SFARQEADTD-DLQRSPVSFT 471
           ERSSLRRS+FN                   +           +     + D  +SP    
Sbjct: 359 ERSSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTIKVEIDPHKSPFRQQ 418

Query: 472 NRDSYLATTTSSPGSISDLYDHY-QDNAESKQGNDNDNEARQGDLSHAXXXXXXXXXXXX 530
           + DS   ++  S G   D+Y+HY Q + E +Q    + EA +  +               
Sbjct: 419 DEDSENMSSPGSIGDFQDIYNHYRQSSGEWEQEMGIEKEAEE--VPVKVRNDTVEQDLEL 476

Query: 531 XXXXXXLVKPLGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNGWSWS 590
                 +VKP  +              DD++              +T R + +RNGW+W 
Sbjct: 477 REGTTDMVKPSAT--------------DDNK--------------ETKRHR-RRNGWTWL 507

Query: 591 GNRANSEEDATVLVNSQDEDQTGYTDQKSKSRHRPILARSRDHL---------------- 634
            N+ + E+D        +E+Q    ++++    R  L  S+ H                 
Sbjct: 508 NNKMSREDD-------NEENQGDDENEENVDSQRMELDNSKKHYISLFNGGEKTEVSNKE 560

Query: 635 KINKEAELPKESHKRETIEKRFVKLFRRKGH 665
           ++N  +     S  R+ IEK F  LFRRK H
Sbjct: 561 EMNNSSTSTATSQTRQKIEKTFANLFRRKPH 591

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 57/71 (80%), Gaps = 2/71 (2%)

Query: 10 LRKTSG--SLQTQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNN 67
          LR TS   ++ +QRDKRKSEVLIAAQSLDNE++SVKNLKRLSIGSMDLLIDPEL+ +   
Sbjct: 10 LRTTSSDKAIASQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGG 69

Query: 68 DKSNQSTPIGS 78
          + S + +  G+
Sbjct: 70 ESSGRRSWSGT 80

>CAGL0J06688g complement(637917..640403) similar to sp|P54786
           Saccharomyces cerevisiae YML109w ZDS2 or sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 828

 Score =  191 bits (485), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 111/210 (52%), Positives = 145/210 (69%), Gaps = 15/210 (7%)

Query: 786 LSASIVETVRELGEDDSQDISGGDLSTEVDNSM--LAERNVMNSSDLQSIENSSDDINTG 843
           LS  +VE V+EL E+DS+++SG D+  ++++      E ++ NS++  SI N S  ++T 
Sbjct: 631 LSDEVVEYVQEL-EEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSI-NQSYSLHT- 687

Query: 844 NTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERA 903
           +    V   +KLTF DVK+P+R NAP++FTDSAFGFPLP LT+STVIM DHRLGINVERA
Sbjct: 688 DEPNKVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERA 747

Query: 904 IYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTDVID 963
           IYRLSHLKLS++ RELRQQVLLSNFMYAYLNLV HTL +E+  Q +         T   D
Sbjct: 748 IYRLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDK-------QSTSSPD 800

Query: 964 SDIHESSSYGTGVYTTEQNNANGTILIPEI 993
           + + E        Y T  N ++GTILIPE+
Sbjct: 801 NKVVELEGSN---YNTAHNQSDGTILIPEL 827

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 110/236 (46%), Gaps = 50/236 (21%)

Query: 200 LLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXXXXXMSE 259
           L WVPANQHPNVKPENYLELV++TL  I                             +S 
Sbjct: 174 LFWVPANQHPNVKPENYLELVKETLNKIR-----------DINTDGKEKSENNSEEEVSN 222

Query: 260 EEPIDRHPQSLDKTFLEITNRNR-SLVRRPSRLRTSYTXXXXXXXXXXXXXXAKTNESQL 318
           +E I+ +             R R S+VRRPS+LR SYT              A +N   +
Sbjct: 223 KENINEN------------GRLRGSIVRRPSKLRKSYTEFSSEDLELLDK--ALSNNRII 268

Query: 319 SSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTLSMA 378
           S+R          N  N  R      +SLK+IT EL   SNKAGLTD +A+TLARTLS+A
Sbjct: 269 STR----------NTTNSKR------LSLKEITNELVKHSNKAGLTDDNAVTLARTLSIA 312

Query: 379 SSFSDGNVNLGKS-------KLQXXXXXXXXFASNMFMKNGLTIPERSSLRRSKFN 427
           SS ++ N   G++       + Q        FA+ +   +       SSLRRSKFN
Sbjct: 313 SSVTNQN-ETGRNDQSNTEQQKQSEDADDDTFATAVVGNSHSLASNTSSLRRSKFN 367

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%)

Query: 22 DKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRV 65
          D   SE L AAQSLD EVQ+VKNLKRLSIGS+DL+ DPEL   V
Sbjct: 17 DGVSSEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTV 60

>KLLA0D01683g complement(148855..151689) some similarities with
           sp|P54786 Saccharomyces cerevisiae YML109w ZDS2
           multicopy suppressor of SIN4, hypothetical start
          Length = 944

 Score =  183 bits (464), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 94/102 (92%)

Query: 847 EHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYR 906
           ++ LP RKLTFADV +PDRPN+P++FTDSAFGFPLP LT+STVIMFDHRL I+VERAIYR
Sbjct: 821 QYPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHVERAIYR 880

Query: 907 LSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQ 948
           LSHLKLSD KR LRQQVLLSNFMYAYLNLVNH+LY++Q+ ++
Sbjct: 881 LSHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922

 Score =  137 bits (346), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 122/234 (52%), Gaps = 45/234 (19%)

Query: 194 DDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXX 253
           + L +NLLWV A+QHPNVKPENYLELVQ+TL+N++L   + +                  
Sbjct: 186 ESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLGGRSPTANETQAQSLSGL------ 239

Query: 254 XXXMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTXXXXXXXXXXXXXXAKT 313
                         ++L K  ++  N   SL RRPSRLRTSYT                 
Sbjct: 240 --------------KTLRKRSMQSGN---SLARRPSRLRTSYT----------------- 265

Query: 314 NESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLAR 373
              +LS  +E   + +           S+R+VSLKDITEELT +SN+AGLTD+DA+TLAR
Sbjct: 266 ---ELSEDDEDKGMTDQPLAAAAPTMSSRRTVSLKDITEELTKLSNQAGLTDTDAVTLAR 322

Query: 374 TLSMASSFSDGNVNLGKSKLQXXXXXXXXFASNMFMKNGLTIPERSSLRRSKFN 427
           TL +A   +  +   G S           FAS MF K+G T+P R SLRRSKFN
Sbjct: 323 TLWVADESTTDSTGQGLS--NNLADEEEEFASTMFTKSGFTVPARHSLRRSKFN 374

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (95%)

Query: 19 TQRDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRV 65
          ++RDKRKSEVLIAAQSLD EV+ VKNLKRLSIGSMDLL+DPELE+RV
Sbjct: 4  SKRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRV 50

>AAL185W [2] [Homologous to ScYML109W (ZDS2) - SH; ScYMR273C (ZDS1)
           - SH] complement(9537..12593) [3057 bp, 1018 aa]
          Length = 1018

 Score =  181 bits (459), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 145/455 (31%), Positives = 201/455 (44%), Gaps = 132/455 (29%)

Query: 580 SKHKRNGWSWSGNRANSEEDATVLVNSQDE-------------------------DQTGY 614
           S  K+ GWSW GN      ++ +L  +  E                         D+T  
Sbjct: 580 SAEKKKGWSWFGNSRRPSSESVLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSDETPR 639

Query: 615 TDQKSKSRHRPILARSRDHLKIN-KEAEL------------PKESHKRETIEKRFVKLFR 661
               S++RH+     S + L+I   E  L            P+    +E +EK+F+K+F+
Sbjct: 640 RGNHSRNRHQ---TSSPEELEIGWTETSLTTLDGDTEQDGKPQHPKTKEKLEKKFMKIFK 696

Query: 662 RKGHDNGNXXXXXXXXXXXXXXXXXXXXISKKNQVTTEEP-KEITVEVQEPEEILEDTNQ 720
           ++    G                      S++++  T+EP   +T  V      L + N 
Sbjct: 697 KRS-GTGLSQDTPNQGEESSLKATSRIRRSRESKRQTDEPSASLTTSVS-----LNNHNN 750

Query: 721 GTNRQDPLRLSTPIIPQPVHSIISDTTPIADGDHALSNKDTDDEAIEALPSLQPAVSVTS 780
           G                     +S + P      +  N D    +I    SLQPAVSVTS
Sbjct: 751 GRKS------------------VSISRPTWQRTESSYNGDKGKGSIT---SLQPAVSVTS 789

Query: 781 TKNVHLSASIVETVRELGEDDSQDISGGDLSTEVDNS------MLAER------------ 822
           +++ H             E   QD     L T++D S      + ++R            
Sbjct: 790 SRDSH-------------EQTRQDPQPQSLVTKMDGSSSNGVTVSSQRAGFSKKGRSKTS 836

Query: 823 ----NVMNSSDLQSIENSSDDINTGNT----------------------------IEHVL 850
                +  S D+  ++N   D++  +T                            I H L
Sbjct: 837 HSRSKLSTSHDIAPVDNRPSDVDQKSTEANNTLSSRAEDSHPSLDPGKSALGPGEIAHSL 896

Query: 851 PARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLSHL 910
           P RKL F DV RP++PN+P++FT SAFGFPLP LTVSTVIMFDHRL I VERAIYRLSHL
Sbjct: 897 PPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVERAIYRLSHL 956

Query: 911 KLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQV 945
           KLSD KRELRQQVLLSNFMY+YLNLVNH+LY++Q+
Sbjct: 957 KLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQI 991

 Score =  129 bits (324), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 107/315 (33%), Positives = 132/315 (41%), Gaps = 75/315 (23%)

Query: 196 LTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXXXX 255
            + NLLWV A+QHPNVKPENYLELV DTL N+ +       +H                 
Sbjct: 228 FSSNLLWVRADQHPNVKPENYLELVHDTLNNLRI-----GARHGRGDSPVQQSNTPVANG 282

Query: 256 XMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTXXXXXXXXXXXXXXAKTNE 315
             S                   T   RSLVR+ SRLR S+T                  E
Sbjct: 283 ESS-------------------TASARSLVRKQSRLRKSFTEVEA------------IEE 311

Query: 316 SQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAITLARTL 375
           SQ          F D  G         R  SLK+ITEELT ISN AGLTDSDAITLARTL
Sbjct: 312 SQ----------FTDSIGSEIPVGKRMRVSSLKEITEELTRISNNAGLTDSDAITLARTL 361

Query: 376 SMASSFSDGNVNLGKSKLQXXXXXXXXFASNMFMKNGLTIPERSSLRRSKF--------- 426
            + S  +D +    +  +         +AS++  KNGL IP RSSLRRSKF         
Sbjct: 362 GIGSQSADEHATFSEC-VPSAEAEENEYASSILAKNGLAIPARSSLRRSKFTTYRIRSAG 420

Query: 427 -------NXXXXXXXXXXXXXXXXXXPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLAT 479
                  N                  P +Q ++F          + S    +  ++ LA 
Sbjct: 421 SDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAF----------KGSHPRLSGENTSLA- 469

Query: 480 TTSSPGSISDLYDHY 494
              SP SI+D+YDHY
Sbjct: 470 -PQSPNSINDIYDHY 483

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/47 (78%), Positives = 45/47 (95%)

Query: 21  RDKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNN 67
           ++KRKSEVLIAAQSLD E+Q+VKNLKR+SIGSMDLL+DPE+EFR+N 
Sbjct: 70  KEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNG 116

>CAGL0F03421g complement(336157..338610) similar to sp|P50111
           Saccharomyces cerevisiae YMR273c ZDS1, hypothetical
           start
          Length = 817

 Score =  179 bits (454), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/179 (54%), Positives = 111/179 (62%), Gaps = 44/179 (24%)

Query: 771 SLQPAVSVTSTKNVHL-----SASIVETVRELGEDDSQDISGGDLSTEVDNSMLAERNVM 825
           SLQPAV+VTSTKN  +     + +   + RE   D S+  S   L               
Sbjct: 676 SLQPAVNVTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPL--------------- 720

Query: 826 NSSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLT 885
                                    P RKLTFADVK+ D+ NAPI+FTDSAFGFPLP LT
Sbjct: 721 ------------------------YPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELT 756

Query: 886 VSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQ 944
            STVIMFDHRL I+VERAIYRLSHLKLS+SKR LR+QVLLSNFMY+YLNLVNHTLYMEQ
Sbjct: 757 YSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  125 bits (313), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 141/500 (28%), Positives = 207/500 (41%), Gaps = 146/500 (29%)

Query: 194 DDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXX 253
           D++ +NLLWV A+QHPNVKPENY+ELVQD L NI +++                      
Sbjct: 148 DEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDK---------------------- 185

Query: 254 XXXMSEEEPIDRHPQSLDKT--FLEITNR----NRSLVRRPSRLRTSYTXXXXXXXXXXX 307
                 EE    +  +LDK   +    N+    N  LVRRPS LR SYT           
Sbjct: 186 -----TEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLVRRPSLLRKSYT----------- 229

Query: 308 XXXAKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSD 367
               + +E + S  +E+    N+ +     + F+     LKDITEELT ISNKAGLT++D
Sbjct: 230 ----EFDEVKDSDIKEQSSTNNNVDSTPHNKKFT-----LKDITEELTRISNKAGLTNND 280

Query: 368 AITLARTLSMASSFSDGNVNLGKSK-------LQXXXXXXXXFASNMFM-KNGLTIPERS 419
           A+TLARTLSMAS   +   +  + +        +        +AS M +  + L   E S
Sbjct: 281 AVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSLIKSEHS 340

Query: 420 SLRRSKFNXXXXXXXXXXXXXXXXXXPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLAT 479
           +L+RSK+                        +   R + D D      +  +    +   
Sbjct: 341 TLKRSKY------------------------TYHIRTQEDKDPT----IPVSTESQHQDV 372

Query: 480 TTSSPGSISDLYDHYQDNA-------------ESKQGNDNDNEARQGDLSHAXXXXXXXX 526
             +SPGSI+D+YDHY++ +             E+K+  D D ++    + H+        
Sbjct: 373 IEASPGSINDIYDHYREPSGDWSSLIQVAPENENKKRTDTDIDSNTKIVQHSTEHVD--- 429

Query: 527 XXXXXXXXXXLVKPLGSKSMIHENLDNGQDHDDDQPAYQKVSKLNPTIPDTSRSKHKRNG 586
                         LGS    H   D   D +  +PA++K                KRNG
Sbjct: 430 --------------LGSTG--HSTSDKS-DINKKEPAHRK----------------KRNG 456

Query: 587 WSWSGNRANSEEDATVLVNSQDEDQTGYTD-QKSKSRHRPILARSRDHLKINKEAELPKE 645
           W WS     SE+        ++ED    +    SK+RH P+        KI     L   
Sbjct: 457 WLWSS--KTSEKVNVTSDKHENEDIVPESRFNHSKNRHEPLYNH-----KIEIANTLGTL 509

Query: 646 SHKRETIEKRFVKLFRRKGH 665
             K+  I+K+   +FRRK H
Sbjct: 510 PEKKNAIDKKISNIFRRKHH 529

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 35/38 (92%)

Query: 26 SEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEF 63
          SEV IAAQSLD E++SVKNLKRLSIGSMDLL+DPE++ 
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>Kwal_27.10318
          Length = 925

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 79/128 (61%), Positives = 103/128 (80%)

Query: 820 AERNVMNSSDLQSIENSSDDINTGNTIEHVLPARKLTFADVKRPDRPNAPIQFTDSAFGF 879
           + ++V +SS +   +N+  D        + LP RKLTF+DV +P+RPN+P++F+DS+FGF
Sbjct: 781 SRKDVQDSSPVDIEDNAGIDPMAPAAGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGF 840

Query: 880 PLPMLTVSTVIMFDHRLGINVERAIYRLSHLKLSDSKRELRQQVLLSNFMYAYLNLVNHT 939
           PLP LT+STV+M DHRL INVERAIYRLSHLKL D KRELRQQV+LSNFMYAYLNLVNH+
Sbjct: 841 PLPPLTISTVVMIDHRLTINVERAIYRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHS 900

Query: 940 LYMEQVAQ 947
           LY++Q+ +
Sbjct: 901 LYLQQLEE 908

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 148/515 (28%), Positives = 219/515 (42%), Gaps = 122/515 (23%)

Query: 194 DDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHXXXXXXXXXXXXXXX 253
           D++T+NL WVPANQHPNVKPENYLELVQDTL  + ++                       
Sbjct: 168 DNVTQNLFWVPANQHPNVKPENYLELVQDTLHTLSID----------------------- 204

Query: 254 XXXMSEEEPIDRHPQSLDKTFLEITNRN-----------RSLVRRPSRLRTSYTXXXXXX 302
               SE EP        +  +L   N              SLVRRPS LR SYT      
Sbjct: 205 ----SEVEPPTDKTVEGNNPYLASANTKASPSSQLRSGQNSLVRRPSGLRKSYTELEDLL 260

Query: 303 XXXXXXXXAKTNESQLSSREEKPFLFNDRNGLNQLRNF-------SQRSVSLKDITEELT 355
                       + ++   +E     N+ N  ++L N        +    SLKDITEELT
Sbjct: 261 ------------QHEIQDSDE-----NNENAQSELNNIIKNRPRATSSGSSLKDITEELT 303

Query: 356 NISNKAGLTDSDAITLARTLSMASSFSDGNVNLGKSKLQXXXXXXXXFASNMFMKNGLTI 415
            ISNKAG TD DA+ LARTLSMASS+ DG  +               +AS +  KNGL I
Sbjct: 304 RISNKAGFTDGDAVCLARTLSMASSY-DGEQSQANQSANTDHTPDSEYASTILTKNGLAI 362

Query: 416 PERSSLRRSKFNXXXXXXXXXXXXXXXXXXPLLQSSSFARQEADTDDLQRSPVSFTNRDS 475
           P RSSLRRSKFN                      +SS  R  +  ++ ++ P  +  +  
Sbjct: 363 PARSSLRRSKFNTYRIRTPNGSS----------VTSSSLRSTSLPNEERKDPEGYIEKSD 412

Query: 476 YLATTTSSPGSISDLYDHYQDNAESKQGNDNDNEARQGDLSHAXXXXXXXXXXXXXXXXX 535
            L + TS     +++YDHY+   +   G+ ++  A   D S A                 
Sbjct: 413 RLRSPTSV-NDFNEIYDHYR---QGSVGSTSEPHAVDNDASSA------------SPFNK 456

Query: 536 XLVKPLGSKSMIHENLDNGQDHDDDQP---AYQKVSKLNPT-------IPDTSRSKHKRN 585
            LV P   ++ ++E  ++   H  D+      +K  K N +        P  ++   K++
Sbjct: 457 SLVHPSHHETHLNEESESSSKHSTDKTLNYPLEKDGKGNNSKAKNKENKPSGTQILRKKS 516

Query: 586 GWSWSGNRANSEEDATVLVNSQDEDQTGYTD------------------QKSKSRHRPIL 627
            W+W G + + ++D      + D++Q  ++D                    S+ RH  I 
Sbjct: 517 SWNWFGKKTSKDQDI-----ANDDEQNTFSDFLSVSGNAKTSYIPTEKVNHSRHRHYSID 571

Query: 628 ARSRDHLKINKEAELPKESHKRETIEKRFVKLFRR 662
           + SR  +  +        S K++  EK+F++LF+R
Sbjct: 572 SGSRGSIAADPSKLAVSSSPKKQKREKKFIQLFKR 606

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 4/60 (6%)

Query: 10 LRKTSGSLQTQR----DKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRV 65
          +R  S S  T+R    +KRKSEVLIAAQSLD+E+Q VKNLKR+S GSMDL +DPE+EFR+
Sbjct: 15 MRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFGSMDLPLDPEMEFRM 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,813,145
Number of extensions: 1180945
Number of successful extensions: 4299
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4433
Number of HSP's successfully gapped: 70
Length of query: 993
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 882
Effective length of database: 12,753,511
Effective search space: 11248596702
Effective search space used: 11248596702
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)