Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_650.133433416750.0
YOR221C (MCT1)38434510621e-144
CAGL0J04136g3443389801e-132
Kwal_26.86643143205024e-61
ACR108C2962723786e-43
KLLA0D07051g3232703763e-42
KLLA0D19855g49765720.49
CAGL0L08272g526191681.8
Scas_713.2087634672.7
YLR195C (NMT1)45572645.3
Scas_715.2145769637.0
YPR034W (ARP7)47768627.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_650.1
         (334 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_650.1                                                            649   0.0  
YOR221C (MCT1) [5013] chr15 complement(756476..757536,757738..75...   413   e-144
CAGL0J04136g 385772..386806 similar to tr|Q12283 Saccharomyces c...   382   e-132
Kwal_26.8664                                                          197   4e-61
ACR108C [1155] [Homologous to ScYOR221C (MCT1) - SH] (545576..54...   150   6e-43
KLLA0D07051g complement(604505..605476) weakly similar to sgd|S0...   149   3e-42
KLLA0D19855g 1678342..1679835 gi|1346071|sp|P48828|G6PD_KLULA Kl...    32   0.49 
CAGL0L08272g 911326..912906 highly similar to sp|P39076 Saccharo...    31   1.8  
Scas_713.20                                                            30   2.7  
YLR195C (NMT1) [3598] chr12 complement(541939..543306) N-myristo...    29   5.3  
Scas_715.21                                                            29   7.0  
YPR034W (ARP7) [5468] chr16 (639520..640953) Component of SWI-SN...    28   7.9  

>Scas_650.1
          Length = 334

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/334 (95%), Positives = 319/334 (95%)

Query: 1   RGTSISIPVLKALIRNKSKQFQXXXXXXXXXXXXXXXFIFRNPSNPGSIAVCSSLLYQLY 60
           RGTSISIPVLKALIRNKSKQFQ               FIFRNPSNPGSIAVCSSLLYQLY
Sbjct: 1   RGTSISIPVLKALIRNKSKQFQLILNNNSTNANDLLNFIFRNPSNPGSIAVCSSLLYQLY 60

Query: 61  KISSLTPTPADEPPLLLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIAH 120
           KISSLTPTPADEPPLLLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIAH
Sbjct: 61  KISSLTPTPADEPPLLLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIAH 120

Query: 121 KINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNGTVSIANANSPKQCVATELVEDLE 180
           KINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNGTVSIANANSPKQCVATELVEDLE
Sbjct: 121 KINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNGTVSIANANSPKQCVATELVEDLE 180

Query: 181 SLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQNNTQTMTELPM 240
           SLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQNNTQTMTELPM
Sbjct: 181 SLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQNNTQTMTELPM 240

Query: 241 GIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINNKAFNVTDSVCIGPGNVIFNL 300
           GIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINNKAFNVTDSVCIGPGNVIFNL
Sbjct: 241 GIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINNKAFNVTDSVCIGPGNVIFNL 300

Query: 301 VRRNCPDVVPFEYSSLTTVNLFHEHELQLQEDKK 334
           VRRNCPDVVPFEYSSLTTVNLFHEHELQLQEDKK
Sbjct: 301 VRRNCPDVVPFEYSSLTTVNLFHEHELQLQEDKK 334

>YOR221C (MCT1) [5013] chr15
           complement(756476..757536,757738..757831) Malonyl
           CoA:acyl carrier protein transferase [1155 bp, 384 aa]
          Length = 384

 Score =  413 bits (1062), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/345 (58%), Positives = 253/345 (73%), Gaps = 21/345 (6%)

Query: 1   RGTSISIPVLKALIRNKSKQFQXXXXXXXXXXXXXXXFIFRNPSNPGSIAVCSSLLYQLY 60
           +GTSISI +LKA+IRNKS++FQ               +IF+NPS+PGSIAVCS+L YQLY
Sbjct: 33  QGTSISISILKAIIRNKSREFQTILSQNGKESNDLLQYIFQNPSSPGSIAVCSNLFYQLY 92

Query: 61  KISSLTPTPADEPP-----------------LLLGHSLGELTCLSINNLFTLNDLFKISN 103
           +I S    P D+ P                  LLGHSLGELTCLS+N+LF+L DLF I+N
Sbjct: 93  QILSNPSDPQDQAPKNMTKIDSPDKKDNEQCYLLGHSLGELTCLSVNSLFSLKDLFDIAN 152

Query: 104 YRNDLMIKYTEKYLIAHKINHSSKFEMWALSSPNASDLPEQVYQLLTS---LPIPNGTVS 160
           +RN LM+  TEKYL+AH IN S+KFEMWALSSP A+DLP++V +LL S   L     T+S
Sbjct: 153 FRNKLMVTSTEKYLVAHNINRSNKFEMWALSSPRATDLPQEVQKLLNSPNLLSSSQNTIS 212

Query: 161 IANANSPKQCVATELVEDLESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLY 220
           +ANANS KQCV T LV+DLESLRTEL++ FP+LRITELTNP NIPFHN  +LRP+QEPLY
Sbjct: 213 VANANSVKQCVVTGLVDDLESLRTELNLRFPRLRITELTNPYNIPFHNSTVLRPVQEPLY 272

Query: 221 DYIWSILKQNNTQTMTELPMGIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINN 280
           DYIW ILK+N T T+ EL   IIANLDG +S ++HHAL++F+KCSS TV+FT CY+TIN+
Sbjct: 273 DYIWDILKKNGTHTLMELNHPIIANLDGNISYYIHHALDRFVKCSSRTVQFTMCYDTINS 332

Query: 281 KA-FNVTDSVCIGPGNVIFNLVRRNCPDVVPFEYSSLTTVNLFHE 324
                +  S+C GPGNVI+NL+RRNCP V   EY+SL T++ +H+
Sbjct: 333 GTPVEIDKSICFGPGNVIYNLIRRNCPQVDTIEYTSLATIDAYHK 377

>CAGL0J04136g 385772..386806 similar to tr|Q12283 Saccharomyces
           cerevisiae YOR221c MCT1 malonyl-CoA:ACP transferase,
           hypothetical start
          Length = 344

 Score =  382 bits (980), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 245/338 (72%), Gaps = 13/338 (3%)

Query: 1   RGTSISIPVLKALIRNKSKQFQXXXXXXXXXXXXXXXFIFRNPSNPGSIAVCSSLLYQLY 60
           +GT I + VLKALIRNK  QF                +IFRNPS+PGSIAVCS+ LY++Y
Sbjct: 9   QGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLE-YIFRNPSSPGSIAVCSNFLYEMY 67

Query: 61  KISSLTPTPADEPPL-LLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIA 119
            + S    P     L LLGHSLGELTCL +N LFT  +LF+I+NYRNDLM+KYTE+YL A
Sbjct: 68  GLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTKELFEIANYRNDLMVKYTEQYLRA 127

Query: 120 HKINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNG--TVSIANANSPKQCVATELVE 177
           +     SKFEMWALSSP A+DLP ++++LLT  P   G  T+S+ANANS KQCV T LVE
Sbjct: 128 YN-RRGSKFEMWALSSPKATDLPYEIHKLLTESPTFPGSHTISVANANSVKQCVVTGLVE 186

Query: 178 DLESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQNNTQTMTE 237
           DLE+LRTELH++ P+LRI+ELTNP N+PFHN+ +LRPIQEPLYD+IW I+K N T T T 
Sbjct: 187 DLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLRPIQEPLYDFIWKIMKNNGTHTWTT 246

Query: 238 LPMGIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINNKAFNVTD-------SVC 290
           L   I++NLDG  ++F+HHAL+KF+KCSS TV+FTKCY+TIN  A    D       ++C
Sbjct: 247 LNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFTKCYDTINRIAEATKDQEDPLDAAIC 306

Query: 291 IGPGNVIFNLVRRNCPDVVPFEYSSLTTVNLFH-EHEL 327
           IGPGNVI+NL+RRN P +   EYSS+ T++ +H  H+L
Sbjct: 307 IGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYHGTHDL 344

>Kwal_26.8664
          Length = 314

 Score =  197 bits (502), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 117/320 (36%), Positives = 172/320 (53%), Gaps = 24/320 (7%)

Query: 1   RGTSISIPVLKALIRNKSKQFQXXXXXXXXXXXXXXXFIFRNPSNPGSIAVCSSLLYQLY 60
           +GT++ + V +  +   S++FQ                I R P+ P SIA CS LL+ LY
Sbjct: 9   QGTAVGLSVFRCYLAETSRRFQSVFGRPGRASVLAS--IERKPAEPASIAACSYLLFDLY 66

Query: 61  KISSLTPTPADEPPLLLGHSLGELTCLSINN-LFTLNDLFKISNYRNDLMIKYTEKYLIA 119
           +  S     +DE  + LGHSLGEL CL   N LF L +  +++ YRN LM++        
Sbjct: 67  RQFS----RSDEQLVFLGHSLGELGCLGAGNGLFGLTETMEVAAYRNRLMVEAV------ 116

Query: 120 HKINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNGTVSIANANSPKQCVATELVEDL 179
               H +++ MWA+S+P + +L  ++  LL++L I     ++AN N+  QCV T L  D 
Sbjct: 117 ----HGTQYGMWAVSAPRSRNLALELRPLLSNLGI-----ALANVNTNTQCVVTGLELDG 167

Query: 180 ESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQNNTQTMTELP 239
           E    EL    P+ RI +L NP +IPFHN  IL  IQEPL D++W  LK++   T T L 
Sbjct: 168 EHWTRELSQHIPRCRIQKLENPYHIPFHNRDILGSIQEPLLDFMWKKLKRDGGLTPTSLR 227

Query: 240 MGIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKCYETINNKAFNVTDSVCIGPGNVIFN 299
             +I+N  G +   V  ALE F   S N VEF  C  T+N     V +++ +GPG V+  
Sbjct: 228 YLMISNATGELITNVDRALESFAASSCNVVEFVSCCNTLNK--LGVHEAMHLGPGTVVSK 285

Query: 300 LVRRNCPDVVPFEYSSLTTV 319
           LVRRNC     +E++++  +
Sbjct: 286 LVRRNCDLQASYEWNTVEDI 305

>ACR108C [1155] [Homologous to ScYOR221C (MCT1) - SH]
           (545576..546466) [891 bp, 296 aa]
          Length = 296

 Score =  150 bits (378), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 139/272 (51%), Gaps = 29/272 (10%)

Query: 38  FIFRNPSNPGSIAVCSSLLYQLYKISSLTPTPADEPPLLLGHSLGELTCLSI---NNLFT 94
           ++ R P+ PG+IA CS+LLYQ +    L   P     ++LGHSLGEL+ L+    N L  
Sbjct: 39  YVERQPAAPGAIAACSTLLYQCW----LERGPEQGEAMMLGHSLGELSALNASGSNALLG 94

Query: 95  LNDLFKISNYRNDLMIKYTEKYLIAHKINHSSKFEMWALSSPNASDLPEQVYQLLTSLPI 154
           ++D+ +++  R+ LM +    +  AH +     F    ++   A DL  Q+         
Sbjct: 95  VHDVLEVAQRRHALMREAAAAHARAHGVR---GFVARVVTLRRAGDLRAQLEL------- 144

Query: 155 PNGTVSIANANSPKQCVATELVEDLESLRTELHISFPK-LRITELTNPSNIPFHNDRILR 213
             GT+ +AN NS +QC+ T   +D          + P   R+  L NP  IPFHND +LR
Sbjct: 145 -RGTLRLANHNSLRQCIVTGAADD------PAWAALPAGARVDALLNPDGIPFHNDAVLR 197

Query: 214 PIQEPLYDYIWSILKQNNTQTMTELPMGIIANLDGGVSRFVHHALEKFIKCSSNTVEF-T 272
           PIQ PLYD +W  L +N       L   +++ LDG  +  +  A+EKF++ S+N VEF  
Sbjct: 198 PIQGPLYDLLWERLARNGVSRARSLDRPLLSCLDGAATDRLDVAVEKFVRSSTNVVEFVA 257

Query: 273 KCYETINNKAFNVTDSVCIGPGNVIFNLVRRN 304
            C   +   A   T ++ +GPG  +  LV RN
Sbjct: 258 ACRTAVQAGA---TAALHVGPGRAVGALVDRN 286

>KLLA0D07051g complement(604505..605476) weakly similar to
           sgd|S0005747 Saccharomyces cerevisiae YOR221c MCT1
           malonyl-CoA:ACP transferase, start by similarity
          Length = 323

 Score =  149 bits (376), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 152/270 (56%), Gaps = 15/270 (5%)

Query: 46  PGSIAVCSSLLYQLYKISSLTPTPADEPPLLLGHSLGELTCL--SINNL-FTLNDLFKIS 102
           P +IA CS+LLY  + ++      ++    ++GHSLGEL  L  S+N L F   D+ +I+
Sbjct: 46  PETIAACSNLLYSNW-LTDNANQNSNGKTYVIGHSLGELNALNASVNGLAFGCKDIIEIA 104

Query: 103 NYRNDLMIKYTEKYLIAHKINHSSKFEMWALSSPNASDLPEQVYQLLTSLPIPNGTVS-- 160
           ++RN LM++ T++YL   +I   S FE+WA+++  + +L + +  +L S  I N +V   
Sbjct: 105 SFRNQLMVEATQRYLEKCRITDDS-FELWAVTNVRSKNLRKDLSAVLDS-NITNSSVDKP 162

Query: 161 ----IANANSPKQCVATELVEDLESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQ 216
               +AN N+  QCV T L  D++ L     +   + + T+L +P +IPFHN  +LR IQ
Sbjct: 163 CSIKLANDNAVNQCVITGLSNDIQKLVETCKMENLRHKFTKLDSPFSIPFHNINVLRSIQ 222

Query: 217 EPLYDYIWSILKQNNTQTMT--ELPMGIIANLDGGVSRFVHHALEKFIKCSSNTVEFTKC 274
           EPLYD+IW  LK+N        ++  GI +N+DG ++     ALE F+  S N V F   
Sbjct: 223 EPLYDFIWDTLKENGKHHFINEKVENGIFSNIDGKLTYQFDTALENFVAGSCNIVNFVDS 282

Query: 275 YETINNKAFNVTDSVCIGPGNVIFNLVRRN 304
            + I++ + +V  +   GPG  I  L+ RN
Sbjct: 283 CKNISSLS-SVEKAYHFGPGTSIGKLIERN 311

>KLLA0D19855g 1678342..1679835 gi|1346071|sp|P48828|G6PD_KLULA
           Kluyveromyces lactis Glucose-6-phosphate 1-dehydrogenase
           (G6PD), start by similarity
          Length = 497

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 49  IAVCSSLLYQLYKISSLTPTPADEPPLLLGHSLGELTCLS--INNLFTLNDLFKISNYRN 106
           I VCS L   LY  S +     ++P    GH L   T L   +  LF+ ++LF+I +Y  
Sbjct: 130 IDVCSKLKENLYTESGIQRVIVEKP---FGHDLQSATELQEKLAPLFSEDELFRIDHYLG 186

Query: 107 DLMIK 111
             M+K
Sbjct: 187 KEMVK 191

>CAGL0L08272g 911326..912906 highly similar to sp|P39076
           Saccharomyces cerevisiae YIL142w CCT2, start by
           similarity
          Length = 526

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 79/191 (41%), Gaps = 24/191 (12%)

Query: 67  PTPADEPPLLLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIAHKINHSS 126
           P   ++  +LL +     T L  + +      FK+ +      ++  E+  +A KIN  S
Sbjct: 223 PKRVEKAKILLAN-----TALDTDKVKIFGTKFKVDSTSKLAQLEKAERDKMASKINKIS 277

Query: 127 KFEMWA-LSSPNASDLPEQV-------------YQLLTSLPIPNGTVSIANANSPKQCVA 172
           KF +   ++     D PEQ+             ++ +  L +  G   ++  + P++C  
Sbjct: 278 KFGINTFINRQLIYDYPEQLFTDMNINSIEHADFEGIERLALVTGGEVVSTFDDPEKCKL 337

Query: 173 TE--LVEDLESLRTELHISFPKLRITELTNPSNIPFHNDRILRPIQEPLYDYIWSILKQN 230
            E  L+E++  +  E  + F   +  E      +    D++L   +  L+D + S+L Q 
Sbjct: 338 GECDLIEEV-IIGEETFLKFSGCKAGEACTIV-LRGATDQVLDEAERSLHDAL-SVLSQT 394

Query: 231 NTQTMTELPMG 241
             +T T L  G
Sbjct: 395 TKETRTVLGGG 405

>Scas_713.20
          Length = 876

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 191 PKLRITELTNPSN--IPFHNDRILRPIQEPLYDY 222
           P+  +TEL NP N   P HN   +R + EPLY Y
Sbjct: 478 PQGDVTELRNPINNEAPSHNTIKIRTVPEPLYHY 511

>YLR195C (NMT1) [3598] chr12 complement(541939..543306)
           N-myristoyltransferase, catalyzes cotranslational
           transfer of myristate from myristoyl-CoA to N-terminal
           glycine of certain nascent proteins [1368 bp, 455 aa]
          Length = 455

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 7/72 (9%)

Query: 66  TPTPADEPPLLLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIAHKINHS 125
           TP    + PL L  S  E   + ++N   L D+F + N        Y E      + N++
Sbjct: 64  TPEDISDKPLPLLSSF-EWCSIDVDNKKQLEDVFVLLNEN------YVEDRDAGFRFNYT 116

Query: 126 SKFEMWALSSPN 137
            +F  WAL SP 
Sbjct: 117 KEFFNWALKSPG 128

>Scas_715.21
          Length = 457

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 69  PADEPPLLLGHSLGELTCLSINNLFTLNDLFKISNYRNDLMIKYTEKYLIAHKINHSSKF 128
           PA   PLL   +  E + + INN   L D+F + N        Y E    A + N++  F
Sbjct: 65  PASPLPLL---NEFEWSTIDINNQTELEDVFLLLNEN------YVEDKDAAFRFNYTKDF 115

Query: 129 EMWALSSPN 137
             WAL +P 
Sbjct: 116 FNWALKAPG 124

>YPR034W (ARP7) [5468] chr16 (639520..640953) Component of SWI-SNF
           global transcription activator complex and RSC chromatin
           remodeling complex; acts to assist gene-specific
           activators through chromatin remodeling [1434 bp, 477
           aa]
          Length = 477

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 17/68 (25%)

Query: 134 SSPNASDLPEQVYQLLTSLPIPNGTVSIANANSPKQCVATELVEDLES-LRTELHISFPK 192
           SS N S  PEQVY LL +  I  G+              T L+E +E  +  EL I FP+
Sbjct: 375 SSSNIS--PEQVYSLLLTNVIITGS--------------TSLIEGMEQRIIKELSIRFPQ 418

Query: 193 LRITELTN 200
            ++T   N
Sbjct: 419 YKLTTFAN 426

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,312,542
Number of extensions: 496401
Number of successful extensions: 1430
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1437
Number of HSP's successfully gapped: 26
Length of query: 334
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 232
Effective length of database: 13,065,073
Effective search space: 3031096936
Effective search space used: 3031096936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)