Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_647.944944922720.0
YJR015W51042611351e-152
YGR197C (SNG1)54741311191e-149
CAGL0G09273g54541910981e-146
Scas_617.354142210061e-132
CAGL0B03971g5434219941e-130
Kwal_55.221064954099841e-129
Sklu_2316.34874189711e-127
KLLA0E02134g5394079371e-122
CAGL0B03949g6324209411e-121
ADL193C4654076725e-83
Scas_434.13572514553e-52
Scas_617.0d46451501e-12
KLLA0B09856g42452720.77
YPL221W79354720.81
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_647.9
         (449 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_647.9                                                            879   0.0  
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   441   e-152
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   435   e-149
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   427   e-146
Scas_617.3                                                            392   e-132
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   387   e-130
Kwal_55.22106                                                         383   e-129
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             378   e-127
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   365   e-122
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   367   e-121
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   263   5e-83
Scas_434.1                                                            179   3e-52
Scas_617.0d                                                            62   1e-12
KLLA0B09856g complement(859162..860436) some similarities with s...    32   0.77 
YPL221W (YPL221W) [5228] chr16 (133042..135423) Protein of unkno...    32   0.81 

>Scas_647.9
          Length = 449

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/449 (95%), Positives = 430/449 (95%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60
           MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60

Query: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120
           LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN
Sbjct: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120

Query: 121 ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF 180
           ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF
Sbjct: 121 ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF 180

Query: 181 PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ 240
           PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ
Sbjct: 181 PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ 240

Query: 241 FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV 300
           FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV
Sbjct: 241 FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV 300

Query: 301 VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY 360
           VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY
Sbjct: 301 VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY 360

Query: 361 GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNRVVX 420
           GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNRVV 
Sbjct: 361 GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNRVVE 420

Query: 421 XXXXXXXXXXXXXXXXXXHSVAAGKNLDE 449
                             HSVAAGKNLDE
Sbjct: 421 EAQAKAKQEALKEAKRRAHSVAAGKNLDE 449

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  441 bits (1135), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 224/426 (52%), Positives = 306/426 (71%), Gaps = 7/426 (1%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGI----- 55
           ++G+RK VL+ F FTN +LA+ CFT+FVLFWG  Y  +   H+V++L VIQ+  +     
Sbjct: 79  LQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDN 138

Query: 56  NNSTVLPMAS-ILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMA 114
           N+S V+P  S  LPT + + P  W +YN+ +F  KF  N+ + ++ +V+  V+ E YW A
Sbjct: 139 NSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFA 198

Query: 115 LNVKPNATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNY 174
           +N+KPNAT+ LFE+ IN   P FNST + Q V+ + RDP+N + T+LP+ + +E  Y  +
Sbjct: 199 INIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTF 258

Query: 175 YINTYFPQFMSNVS-IANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYC 233
           Y   Y P  ++N++ +     T N   IA AG  N++Y+D+RPFT+R L+AP  IGV YC
Sbjct: 259 YTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYC 318

Query: 234 LLLTFFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRA 293
           LLLTFFQFL+Y  LH E +++L+P   + YRI M W T F ASLFFCTT+AIFQVDFT++
Sbjct: 319 LLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFASLFFCTTTAIFQVDFTKS 378

Query: 294 FGKGGFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLIL 353
           FG+GGFVVYWM+TWLFM+A GG NENAV L+  +GP++LG WILSF+ILNI P+F+PL L
Sbjct: 379 FGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLAL 438

Query: 354 ANPVYRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKI 413
            N VYRYGYMMPVHN IDIYRVIF D+++ KMGRN+G+L+A IA+NTA LPFV K+ S+ 
Sbjct: 439 NNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASRK 498

Query: 414 LTNRVV 419
           L  + +
Sbjct: 499 LKQKAL 504

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  435 bits (1119), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 192/413 (46%), Positives = 292/413 (70%), Gaps = 2/413 (0%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60
           ++  RK +L  F   N  +A  C ++  ++WG  Y     + +V+ + V+QD   +N++V
Sbjct: 98  LRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQD-APSNTSV 156

Query: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120
             +++I+P+L+   P TWH+YN TSF+ KFGT ++  ID++++  ++ E YW+ALNVKPN
Sbjct: 157 QSISAIIPSLLASVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPN 216

Query: 121 ATQALFETFINPNG-PPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTY 179
           AT  L+ + I+ +    FNS+ +F++VF S RDPS+ + T+LPL++ LE   + YY+  Y
Sbjct: 217 ATDTLYNSLISQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEY 276

Query: 180 FPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFF 239
            P  MSN++  +    +N+ N A+AG + F Y DYRPF +R L+AP+ +G+ YC+LLT  
Sbjct: 277 LPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVL 336

Query: 240 QFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGF 299
           Q  +Y  LH E +R+LKP  ++ YR+++ W T F+ S+ FCT SAIF++DFT AFG+GGF
Sbjct: 337 QLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGF 396

Query: 300 VVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYR 359
           VVYWM+TWL M+A GG NEN +SL+    P +L IW++++IILNI+ +FYP++L N  YR
Sbjct: 397 VVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYR 456

Query: 360 YGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSK 412
           YGY+MP+HNA+DIY+VIFL+L+K KMGRN+G+L+AW+A+NT+ +PF  KF  K
Sbjct: 457 YGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGK 509

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  427 bits (1098), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/419 (47%), Positives = 288/419 (68%), Gaps = 5/419 (1%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60
           ++  +  +   F FTN +LA  C +I  ++WG  YR      +V IL+VIQD+  NN  +
Sbjct: 110 LESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNN--I 167

Query: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFG-TNSTEAIDKEVIHEVFSEHYWMALNVKP 119
             MAS LP L+ + P TWHLYN +SF EK+G  N++EA+DK++   +F E YWM+LNVK 
Sbjct: 168 QSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSLNVKT 227

Query: 120 NATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTY 179
            AT+AL+ +  +   P FNS+ YF+ +F S RDP+N +  +LP+++ L+ AY  YY +TY
Sbjct: 228 GATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYYTSTY 287

Query: 180 FPQFMSNVSIA-NNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTF 238
            P  + NVS   N++  VN  ++A +G   F+Y DYRPF +R L+AP+ +G+ + L+LT 
Sbjct: 288 LPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILTV 347

Query: 239 FQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGG 298
            Q  +Y  +HA+  R+ KP   + YR  + W T FI SLFFCT SAI+Q+DFT AFG+GG
Sbjct: 348 VQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRGG 407

Query: 299 FVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVY 358
           FV+YW+TT+  M+A G TNEN +SL+    P+++ IW++S+IILNI+P+FYP++L N  Y
Sbjct: 408 FVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMVLNNQFY 467

Query: 359 RYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFV-SKILTN 416
           RYGY MP+HNA+DIYRVIFLDLS++K+GRN+G+L AW+A+     PFV K   +K+ +N
Sbjct: 468 RYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSN 526

>Scas_617.3
          Length = 541

 Score =  392 bits (1006), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 181/422 (42%), Positives = 273/422 (64%), Gaps = 4/422 (0%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGI--NNS 58
           +  +RK + + F  +N +LA  C +I  L+WG  Y+ T    R+ I+A+IQD+ I  N+ 
Sbjct: 115 LASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERISIIAIIQDDYIPPNDL 174

Query: 59  TVLPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVK 118
            +  + + +P+ ++++   WH+YN + F EKF       I++ +   +  E YW+ALN+ 
Sbjct: 175 NLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIG 234

Query: 119 PNATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINT 178
            N T  +  +   PN P FNST++ + V+ ++R+P+     +LP+I+ +E AY+++Y   
Sbjct: 235 ANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTE 294

Query: 179 YFPQFMSNV--SIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLL 236
           Y P+ +S +  S    L+     N+A  G   FDY D   F +R LIAP+ +G+ YCL+L
Sbjct: 295 YLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLIL 354

Query: 237 TFFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGK 296
           T FQ  ++  LHAE ++ LKP  +I YR+ + W T F  SLFFCT SAIFQ+DFT  FGK
Sbjct: 355 TVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGK 414

Query: 297 GGFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANP 356
           GGFV+YWMTT+L M+A GG NEN +SL+ L  P +L +W+LS+II+NI+PTF P++L N 
Sbjct: 415 GGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNV 474

Query: 357 VYRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416
            YRYGYMMP+H A+DI++V+FL++SK  MGRN+G+L+AWI +NT   P V K V K +  
Sbjct: 475 FYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQK 534

Query: 417 RV 418
           R+
Sbjct: 535 RM 536

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  387 bits (994), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/421 (44%), Positives = 272/421 (64%), Gaps = 8/421 (1%)

Query: 2   KGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGI---NNS 58
           K +RK V   +     +L  FCFTI VL WG+ YR      R ++LAVIQ++ +   N++
Sbjct: 116 KDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDT 175

Query: 59  TVLP-MASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNV 117
              P ++S L  ++ E P +W +YN TSF  K+     EA++++VI  V+ E +W+ALNV
Sbjct: 176 VQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNV 235

Query: 118 KPNATQALFETFINPNGP-PFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYI 176
           + N T  L  + I+ +    FNST  F+ V+ S RD +N    LLP+ + +E  ++  Y 
Sbjct: 236 QGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYT 295

Query: 177 NTYFPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLL 236
             Y PQ + N++  +N    N   +A AG M F+Y DYRP T+R  +    IG  YCLLL
Sbjct: 296 YQYLPQLLGNITNGDNF---NPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLL 352

Query: 237 TFFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGK 296
           T FQFLV+  LH E SR++K + +  YR+I+LW  +F  S+F+CT SA++QVDFT+AFG+
Sbjct: 353 TVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGR 412

Query: 297 GGFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANP 356
            GFVVYWM+T+L+M+A GG NEN + L+ L+ P ++G WILSF+ILN+ P F+ +  AN 
Sbjct: 413 AGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANV 472

Query: 357 VYRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416
            YRYGY MP+H  + I RVIF D+SKH++GRN+G+L AW+ +NT ++PFV KFV K L  
Sbjct: 473 FYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHK 532

Query: 417 R 417
           R
Sbjct: 533 R 533

>Kwal_55.22106
          Length = 495

 Score =  383 bits (984), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/409 (43%), Positives = 268/409 (65%), Gaps = 7/409 (1%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60
           +KGER+ +++ F   + +LA+   ++F L+WG  Y+ +   H+V+ILAV+QDE     T 
Sbjct: 75  VKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKILAVVQDE---PGTG 131

Query: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120
             +AS +PTL ++ P TWH+YNT+SF +K+G    E +D ++   V  + YW++LNVKPN
Sbjct: 132 TGIASSIPTLAEQAPGTWHVYNTSSFQQKYGVAQDE-VDAKIQQLVHDQKYWVSLNVKPN 190

Query: 121 ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF 180
           AT  L E+  N    PFNS+ +F+  + S RDP+N + ++LP+   LE+ Y+N Y +T  
Sbjct: 191 ATSTLIESLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLESRYQNIYASTIL 250

Query: 181 PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ 240
           P  +SN  I   +  V+  N+A+AG M F   D RPF +  L+ P+ +G+ YC+LLTFFQ
Sbjct: 251 PGILSN--ITQRVGDVS-RNVAMAGNMVFAQVDNRPFNDYVLLGPLQVGLIYCILLTFFQ 307

Query: 241 FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV 300
             ++  +HA   + LKP  ++ YR ++ +   F  SLFFC  S  FQVDFT+AFG+ GF+
Sbjct: 308 LALFGPIHALLGQKLKPVHMLLYRYVIAFVNYFFLSLFFCLVSLAFQVDFTKAFGRAGFM 367

Query: 301 VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY 360
           V WM++WL M A GG NEN ++++   GP++LG W++ +++LNI+P FYP+ L +  YRY
Sbjct: 368 VAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPAFYPMELTHNFYRY 427

Query: 361 GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKF 409
           GYM P++N + I+RV FLDL +  +GRN+G+L AWI +N A  PFV K 
Sbjct: 428 GYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVMKL 476

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  378 bits (971), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/418 (43%), Positives = 271/418 (64%), Gaps = 16/418 (3%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60
           ++ +RK+V   F F    LA    ++F L+WG  Y       +V+ILAVIQD+G      
Sbjct: 70  LQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDDG-----S 124

Query: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPN 120
           LP A  LP ++  NP  WH+Y +  F  K+  N T+ ID ++ H V ++ +WM+LNVKPN
Sbjct: 125 LPGA--LPAIIDANPGGWHVYTSEQFQSKYHINETQ-IDSKIEHLVHTQKFWMSLNVKPN 181

Query: 121 ATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYF 180
           AT AL E+  NP+  PF ++ YF+A++ S RDP+NFR ++LPL++ +E +++  Y ++Y 
Sbjct: 182 ATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSSYL 241

Query: 181 PQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQ 240
           P+ +S+     NL+  +  N+A AG + F   D RPF+   L+ P+ +G+ +C+LLTFFQ
Sbjct: 242 PELLSHT----NLSNASPANLAAAGNLEFCSEDMRPFSNYVLLGPLQVGLIFCVLLTFFQ 297

Query: 241 FLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFV 300
             ++  LH   S  LKP  ++ YR  +     F  SLFFCT SAIFQVDFT  FG+ GF+
Sbjct: 298 LAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRAGFM 357

Query: 301 VYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRY 360
           VYWM+TWL M A GG NEN +SL+   G ++LG W++ +I+ NI+P+F+PL L N  YRY
Sbjct: 358 VYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNFYRY 417

Query: 361 GYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNRV 418
           GYMMP+HNA+DIY+VIFL+  K  +GRN+G+L AW+ +N+     ++  V KI+ N++
Sbjct: 418 GYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINS----ILFVPVLKIVGNKM 471

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  365 bits (937), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 258/407 (63%), Gaps = 18/407 (4%)

Query: 12  FAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTVLP-MASILPTL 70
           FA    +L      +F L+WG  Y  +  YH V+ +AV++D+G   + V+P M S +P  
Sbjct: 140 FALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDDGDMGAGVIPIMDSAIPQF 199

Query: 71  MQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPNATQALFETFI 130
                    +YNT+SF +K+G +    I ++V H V ++ +W +L V P  T A  ++  
Sbjct: 200 F--------VYNTSSFRDKYGQDVN--ISEKVHHLVHTKKFWGSLIVYPGTTDAFVDSLT 249

Query: 131 NPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRN-YYINTYFPQFMSNVSI 189
             + P FNST+YF+  + +ARD SN R +++PL+  +ET Y+  ++ N YFP      S+
Sbjct: 250 TDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYNDYFP------SV 303

Query: 190 ANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQFLVYSGLHA 249
             N+T ++  N++ AG MN+   D RPFT+  L+ P+ +G+ YC+LLTFFQ  ++   HA
Sbjct: 304 IANITNISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLTFFQLALFGPFHA 363

Query: 250 ETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFVVYWMTTWLF 309
             S LLKP  +I YR++  W T F  SLFFCT SAIF VDFT AFG+GGFVVYWMTTW+ 
Sbjct: 364 MLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRGGFVVYWMTTWIL 423

Query: 310 MVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRYGYMMPVHNA 369
           M A GG NEN +S+L    P++LG W++S+II+NI+ +F PL+LAN  YRYGYM P++NA
Sbjct: 424 MGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRFYRYGYMTPIYNA 483

Query: 370 IDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416
           ++IYRVIF D  K  MGRN+G+L AW  +NT   PFV K V +   N
Sbjct: 484 MEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMN 530

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  367 bits (941), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/420 (39%), Positives = 265/420 (63%), Gaps = 3/420 (0%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGIN--NS 58
           MK  R+ +L  F  T+ +LA+F      L+WG  Y  +   +RV  +AVIQDE     + 
Sbjct: 176 MKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDG 235

Query: 59  TVLP-MASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNV 117
           TV+P +   +  ++   P  W + N+T F   +   + + ID++V   +F E +W+A+NV
Sbjct: 236 TVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKFWLAVNV 295

Query: 118 KPNATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYIN 177
           +  AT+A +++      P FNST YFQ+++ S RDP+N + ++ P++   E+ +R+ Y+ 
Sbjct: 296 REGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESVFRSQYLK 355

Query: 178 TYFPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLT 237
            Y P+F+ N++  +   TVN  N+   G    + +D RPFT+R L+ P+ +G+ Y ++ +
Sbjct: 356 IYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFS 415

Query: 238 FFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKG 297
            F   ++  ++ E ++ LKP  + +YRI++ W   F  SLF CT SAIFQ+DFT  FGK 
Sbjct: 416 VFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKA 475

Query: 298 GFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPV 357
           GFV+YWMT+WL M A G  NEN +S++    P+++  W++ + ILNI P+ YPL+L +  
Sbjct: 476 GFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRF 535

Query: 358 YRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNR 417
           YR+GY MP+HN + IYRVIFLD+S+H+M RN+G+L AW+A+NTA  PFV KF+SK++  R
Sbjct: 536 YRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKVVKKR 595

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  263 bits (672), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 226/407 (55%), Gaps = 8/407 (1%)

Query: 5   RKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTVLPMA 64
           RK +L+ F      LA     +F L  G+         R+ +L V+QDE    S  L  A
Sbjct: 60  RKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDEDAGMSAELLRA 119

Query: 65  SILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVKPNATQA 124
           +      +     W   +  +    FG      +D+ +   +    YWMAL+V+P AT+A
Sbjct: 120 A------EHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHRYWMALHVRPGATEA 173

Query: 125 LFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTYFPQFM 184
           L  +  +P  P FNS+E+F+  + + RD  N   ++  L+E LE  +R YY++T+ P  +
Sbjct: 174 LRRSLDDPGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETLEANFRAYYLDTWLPGEL 232

Query: 185 SNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTFFQFLVY 244
              +   +L++   +NI  AG+M + Y D  PF +  L   + +G+  CLLLTFFQ  + 
Sbjct: 233 RERANTIDLSSTG-SNIVAAGSMRWSYVDLGPFYDPSLYGILQVGMIICLLLTFFQLAMI 291

Query: 245 SGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGGFVVYWM 304
           S LH E S LL+ + ++ YR I+ + +  + SLF+     I+ +D  +A+G+ GF+V+WM
Sbjct: 292 SALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDMEKAYGRAGFLVFWM 351

Query: 305 TTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVYRYGYMM 364
           TTWLFM A GG NEN +S++F   PRF+G W++ +I+ NITPTFY L LAN  Y+YGY+ 
Sbjct: 352 TTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYSLHLANDFYKYGYIT 411

Query: 365 PVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVS 411
           P++NA + Y+V+  D  +  +   + +L+AW  +N A  P   K V+
Sbjct: 412 PIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKIVN 458

>Scas_434.1
          Length = 357

 Score =  179 bits (455), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 149/251 (59%), Gaps = 6/251 (2%)

Query: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGIN--NS 58
           +   RK +   F   N ++ +FC T+  +FWG  Y     +H+V  L V+QDE +     
Sbjct: 106 LTQHRKKIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPLQLGGL 165

Query: 59  TVLPMASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNVK 118
           +V  MAS LP ++   P TWH+YNT++F + +   +   I+ +V+  +F E +W+A+NVK
Sbjct: 166 SVPSMASFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLIFQERFWVAVNVK 225

Query: 119 PNATQALFETFINPNGPP----FNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNY 174
           PNAT +L ++ + P        FN+T +FQ ++ +ARD ++ +  ++ +++ +E+AYR  
Sbjct: 226 PNATASLMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEMESAYREI 285

Query: 175 YINTYFPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCL 234
           Y+  Y P  ++ +   N ++++  T+++ A  +NF Y+DYR F  R L+ P++ G  Y L
Sbjct: 286 YMEQYLPTILAQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRALMGPLLAGTIYSL 345

Query: 235 LLTFFQFLVYS 245
            +T FQFL+++
Sbjct: 346 TITVFQFLIFT 356

>Scas_617.0d
          Length = 46

 Score = 62.4 bits (150), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 33/45 (73%)

Query: 372 IYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416
           +Y+VIF DL + KMGRN+G+L+AWI +NT   PF+ KFV K L  
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQE 46

>KLLA0B09856g complement(859162..860436) some similarities with
           sp|P38285 Saccharomyces cerevisiae YBR158w CST13
           singleton, hypothetical start
          Length = 424

 Score = 32.3 bits (72), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 147 FLSARDPSNFRVTLLPLIEFLETAYRNYYINTYFPQFMSNVSIANNLTTVNV 198
           F   +   NF    LP I F      N+YI+   P    +V+I+NNLT + +
Sbjct: 173 FYKLKQHRNFIENQLPRIRFTRLNSLNFYISPVLPAIFDDVTISNNLTKLTI 224

>YPL221W (YPL221W) [5228] chr16 (133042..135423) Protein of unknown
           function, has high similarity to uncharacterized S.
           cerevisiae Ygl139p [2382 bp, 793 aa]
          Length = 793

 Score = 32.3 bits (72), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 72  QENPATWHLYNTTSFNEKFGTNS--TEAIDKEVIHEVFSEHYWMALNVKPNATQ 123
           QE  +  +L+     +EK GTNS   E+  KE     FSE    +L++K N ++
Sbjct: 636 QEGKSEDNLFGVEYDDEKTGTNSENAESSSKETTRPTFSEKVLRSLSIKRNKSK 689

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.141    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,145,847
Number of extensions: 610031
Number of successful extensions: 1800
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1813
Number of HSP's successfully gapped: 18
Length of query: 449
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 344
Effective length of database: 12,961,219
Effective search space: 4458659336
Effective search space used: 4458659336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)