Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_647.724624612890.0
YGR195W (SKI6)24624611791e-166
CAGL0G09317g24624611781e-166
Kwal_33.1545324524511411e-160
Sklu_1267.227324611331e-158
KLLA0D09625g24524510481e-146
ACR035W24624310261e-142
KLLA0D14993g2251481299e-09
Sklu_1989.12232171272e-08
Scas_716.302281361236e-08
YGR095C (RRP46)2231401211e-07
KLLA0F18304g2361421202e-07
CAGL0G03113g2331381183e-07
Sklu_1879.12381411149e-07
Kwal_23.39692242261112e-06
AFR109W2371391095e-06
Scas_621.17239129999e-05
CAGL0E03223g248147770.058
CAGL0F07645g251120760.088
YGR158C (MTR3)250128720.28
Kwal_27.1019957286671.4
AGL162C70476625.9
ACR193C72977609.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_647.7
         (246 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_647.7                                                            501   0.0  
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   458   e-166
CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   458   e-166
Kwal_33.15453                                                         444   e-160
Sklu_1267.2 YGR195W, Contig c1267 529-1350                            441   e-158
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   408   e-146
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   399   e-142
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    54   9e-09
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             54   2e-08
Scas_716.30                                                            52   6e-08
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    51   1e-07
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    51   2e-07
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    50   3e-07
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          49   9e-07
Kwal_23.3969                                                           47   2e-06
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    47   5e-06
Scas_621.17                                                            43   9e-05
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    34   0.058
CAGL0F07645g 742923..743678 similar to sp|P34247 Saccharomyces c...    34   0.088
YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein in...    32   0.28 
Kwal_27.10199                                                          30   1.4  
AGL162C [4150] [Homologous to ScYDR164C (SEC1) - SH] (392348..39...    28   5.9  
ACR193C [1240] [Homologous to ScYPR031W - SH] (687668..689857) [...    28   9.5  

>Scas_647.7
          Length = 246

 Score =  501 bits (1289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
           LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
           LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

Query: 241 ANASSK 246
           ANASSK
Sbjct: 241 ANASSK 246

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  458 bits (1179), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 216/246 (87%), Positives = 238/246 (96%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           MSRLEIYSPEGLRLDGRRWNELRRFE SINTH HA+DGSSY+EQGNNK+ITLVKGPKEP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
           L+SQMDT KA+L +SVNIT+FSKFERSKSSHKNERRVLE+QT+L+R FEKNVMLNIYPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
           +IDIE+HVL+QDGGIMGSLINGITLALIDAGI+M+DYISG+S+GLYDTTPLLD NSLEEN
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMS+VTLGVVGKSEKLSLLLVEDKIPLDRLE VLAIGIAGAHRVRDLMDEELRKHA+KRV
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

Query: 241 ANASSK 246
           +NAS++
Sbjct: 241 SNASAR 246

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  458 bits (1178), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 239/246 (97%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           MSR+EIYSPEGLRLDGRRWNELRRFE +INTH HA+DGSSYLEQGNNKVITLVKGPKEPT
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
           L+SQMD +KAILK++VNIT+FSKFERSKSSHKNERRVLEMQTAL+RTFEKNVML++YPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
           LIDIE+HVLQQDGGIMG+L+NGI+LALIDAGIAMYDY+SG+S+GLYDTTPLLD+NSLEEN
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMS+VTLGVVGKSEKLSLL +EDKIPLDR+E VLAIGIAGAHR+RDLM++E+R HAEKRV
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

Query: 241 ANASSK 246
           ANAS +
Sbjct: 241 ANASKQ 246

>Kwal_33.15453
          Length = 245

 Score =  444 bits (1141), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 209/245 (85%), Positives = 234/245 (95%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           MSRLEIYSPEGLR+DGRRWNELRR EC+INTH++ASDGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
           LRSQM+  +A L ++VNIT+FSK ERSKSSHKNERRVLEMQTAL+RTFEKNVML++YPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
            IDI++HVLQQDGG+MGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLD+NS+EEN
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLE+VLAIGIAG+HR+R+LMD+ELRKH EKR+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

Query: 241 ANASS 245
           AN SS
Sbjct: 241 ANKSS 245

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  441 bits (1133), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 207/246 (84%), Positives = 231/246 (93%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           MSRLEIYSPEGLRLDGRRWNELRRF+CSINTH +A+DGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
           LRSQ +   A + ++VNIT+FSK ERSKSSHKNERRVLEMQT+L+RTFEKNVML +YPRT
Sbjct: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
           LIDI++HVLQQDGGIMG+LINGITLALIDAGIAMYDYISGVSIGLYDTTPLLD+NSLEEN
Sbjct: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMSS+TLGVVGKSEKLSLLLVEDK+PLDR E+VLAIGIAGAH +RDLMD+ELR+H EKR+
Sbjct: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267

Query: 241 ANASSK 246
            NASSK
Sbjct: 268 TNASSK 273

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  408 bits (1048), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 183/245 (74%), Positives = 225/245 (91%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           MSR EIYSPEGLR+DGRRWNELR F CSINTH +A+DGSSYLEQGNNK+ITLV GP+EP+
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
            RSQ++T++A L +++N+T+F+K ERSKSSHKNERR LE Q +L+RTFEKN+ML++YPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
            ID++VH LQ DGGI+G+++NGITLALIDAGIAMYD++SGVS+GLYDTTPLLD+NSLEEN
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMSSVT+G +GKSEKLSLL+VEDK+PLDRLE+V+AIGIAG HR+RDLMD+ELRKH + RV
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 241 ANASS 245
            N+S+
Sbjct: 241 ENSSN 245

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  399 bits (1026), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 183/243 (75%), Positives = 217/243 (89%)

Query: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60
           M + EIYSPEGLRLDGRRWNELRRFECSINTH  A+DGSSYLEQGNNK+ITLV GP EP 
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120
           LRSQ++  KA L ++VN+T+F+  ERSK+ HKNERR+LEMQTAL+RTFEKNVML +YPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180
            ID++VHVLQ DGG++GS+INGITLALIDAGIAMY+YISG+S+GLYDTTPLLD+N LEE 
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240
           AMS  TLGVVGKSEKLSLLLVEDK+PLDRLE+V+++GIAG HRVRD+MD+ LR+H + R+
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 241 ANA 243
            N+
Sbjct: 241 ENS 243

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 54.3 bits (129), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96
           DGSS +     KVI  V GP EP  R ++ T+ A L+I V   +  +  R K      R 
Sbjct: 12  DGSSVVSNSGTKVICSVSGPMEPKSRQELPTQLA-LEIIVKPAEGVQSTREKLMEDQIRS 70

Query: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQ----QDGGI--MGSLINGITLALIDA 150
           VL   T ++  +       ++PR  + I + VL+    +D  +  +   +N   LAL+DA
Sbjct: 71  VL---TPVLARY-------LHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVDA 120

Query: 151 GIAMYDYISGVSIGLYDTTPLLDVNSLE 178
           G+ +    SG  IG+      L VN  E
Sbjct: 121 GVPLLSMCSGTCIGITTEGKQLVVNPTE 148

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 95/217 (43%), Gaps = 31/217 (14%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96
           DGSS +E    KVI  V GP EP  R ++ T+ A L+I V  ++     R K      R 
Sbjct: 13  DGSSQVECSATKVICSVTGPVEPKARQELPTQLA-LEIVVRPSKGVPNTREKLMEDKIRG 71

Query: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVL-------QQDGGIMGSLINGITLALID 149
           VL     L+R         +YPR L  +   VL       Q     +G  IN   LAL+D
Sbjct: 72  VLT--PVLVRY--------LYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALVD 121

Query: 150 AGIAMYDYISGVSIGLYDTTPLLDVNSLEENAMSSVTLGVV------GKSEKLSLLLVED 203
           AGIA+      V I + +   ++  N        SV+  ++      G ++  ++LLV+ 
Sbjct: 122 AGIALKSSFVSVPICILEQNKIV-TNPTAHQLAQSVSTHLISMEVGSGGTQVENVLLVDS 180

Query: 204 K--IPLDRLETVLAIG----IAGAHRVRDLMDEELRK 234
                 ++L  VLA G    I  A   R ++ E+L+K
Sbjct: 181 NGDFQENQLFDVLAEGEKECINVASAFRKIIQEKLQK 217

>Scas_716.30
          Length = 228

 Score = 52.0 bits (123), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96
           DGSS +E    K+I  V GP EP  R ++ T+ A L+I +         R  +   N R 
Sbjct: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELPTQLA-LEIII---------RPAAGVPNTRE 63

Query: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQDGG-------IMGSLINGITLALID 149
            L M+  L       +   +YPR L  I + +L             + + IN   +ALID
Sbjct: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122

Query: 150 AGIAMYDYISGVSIGL 165
           AGIA+    + V I L
Sbjct: 123 AGIALNSMCACVPIAL 138

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 61/140 (43%), Gaps = 18/140 (12%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96
           DGSS     + KVI  V GP EP  R ++ T+ A L+I V   +     R K      R 
Sbjct: 14  DGSSEFVSQDTKVICSVTGPIEPKARQELPTQLA-LEIIVRPAKGVATTREKVLEDKLRA 72

Query: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQ--QDGG-----IMGSLINGITLALID 149
           VL   T LI         + YPR L  I   +L+  +D        +   IN   LAL+D
Sbjct: 73  VL---TPLITR-------HCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 150 AGIAMYDYISGVSIGLYDTT 169
           AGIA+    + + I +   T
Sbjct: 123 AGIALNSMCASIPIAIIKDT 142

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 26/142 (18%)

Query: 36  SDGSSYLEQGNNK-----VITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSS 90
           ++GSSYLE  +       V++ V GP+   LR    +     K SV+I    +F+     
Sbjct: 55  ANGSSYLEYMDGTSDQVLVMSSVFGPRP--LRGSFQS-----KASVSI----QFKEVTLE 103

Query: 91  HKNERRVLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQDG----------GIMGSLI 140
           H N   + E+ T L   F   + +  YP++ IDI + ++Q              I+ + I
Sbjct: 104 HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCI 163

Query: 141 NGITLALIDAGIAMYDYISGVS 162
           N IT+AL+DAGI + D +S  S
Sbjct: 164 NSITMALVDAGIEIIDLVSAGS 185

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96
           DGS+ L   +  V+  V GP EP  R ++ TE A L++ V   +     R K      R 
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMA-LEVIVRPAKGVPTPREKYLEDKIRA 74

Query: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQ-------QDGGIMGSLINGITLALID 149
           +    T LI   +       YPR L  I   +++        +   + + +N   LAL++
Sbjct: 75  IF---TPLITRHK-------YPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 150 AGIAMYDYISGVSIGLYD 167
           AG+A+ D  + V+I + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 65/141 (46%), Gaps = 27/141 (19%)

Query: 36  SDGSSYLE-------QGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSK 88
           S+GSSYLE       Q +  +IT V GP+   +R    T +A L I        KF   +
Sbjct: 51  SNGSSYLEVTDENKTQYHALLITSVYGPR--PIRGSF-TSRASLTIQFKEVTLEKFTTGE 107

Query: 89  SSHKNERRVLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQD---------GGIMGSL 139
                   + E+   L   F   V L  YP++ IDI ++++Q             ++ + 
Sbjct: 108 --------IKEVCNFLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASVIPTC 159

Query: 140 INGITLALIDAGIAMYDYISG 160
           INGITLAL +AGI + D +S 
Sbjct: 160 INGITLALTNAGIEILDMVSA 180

>Kwal_23.3969
          Length = 224

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 92/226 (40%), Gaps = 40/226 (17%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERR 96
           DGS  ++ G   V+  V GP EP  R ++ ++ A L+I V   +     R K      R 
Sbjct: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELPSQLA-LEIVVRPCKGVPNTREKLLEDQIRG 71

Query: 97  VLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQ---DGGI----MGSLINGITLALID 149
           VL   T ++  +       +YPR L  I   +L+    D       + S IN   LALID
Sbjct: 72  VL---TPILARY-------LYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121

Query: 150 AGIAMYDYISGVSIGLYDTTPLLDVNSLEENAMSSVTLGVVGKSEKLSLLLVEDKIPLDR 209
           +GI +    + V + +      + +N   +  +         +S    LL +E      +
Sbjct: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLI---------RSTSSHLLALEMGPGSKK 172

Query: 210 LETVLAIGIAGAHRVRDLMD-------------EELRKHAEKRVAN 242
            + VL I   GA   + L+D             +ELR   E++++N
Sbjct: 173 TQKVLLIESHGAFTEQQLLDVLSKGEEACLQVAQELRSAVERKISN 218

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 66/139 (47%), Gaps = 25/139 (17%)

Query: 36  SDGSSYLE----QGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSH 91
           ++GSSYLE      N  ++T   GP+   +R    +  AI   SV+  + +  ER  S  
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPR--PIRGSFTSRAAI---SVHFKEVT-LERWDSGE 107

Query: 92  KNERRVLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQD----------GGIMGSLIN 141
                V EM   L   F   + +  YP++ IDI ++++Q              ++   I+
Sbjct: 108 -----VTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDCIS 162

Query: 142 GITLALIDAGIAMYDYISG 160
           GITLAL+DAGI + D ++ 
Sbjct: 163 GITLALMDAGIELKDVVAA 181

>Scas_621.17
          Length = 239

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 15/129 (11%)

Query: 36  SDGSSYLEQGNNKVITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNER 95
            +GS+ +E     ++T V GPK  ++R    ++  I           + +     +    
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPK--SIRGSFTSQGTIT---------IQLKNGVVENYQTT 104

Query: 96  RVLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQDGG----IMGSLINGITLALIDAG 151
            + E+ + L+  F   V L  YP++ IDI V+++    G    ++  LI GI LAL+D G
Sbjct: 105 ELKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 152 IAMYDYISG 160
           I + D ++G
Sbjct: 165 IEIIDIVTG 173

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 34.3 bits (77), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 61/147 (41%), Gaps = 37/147 (25%)

Query: 36  SDGSSYLEQGNNKV-------ITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSK 88
            +GS+ +E  + K+       IT V GPK  ++R    T +A L I +      K+E   
Sbjct: 51  CNGSALVEIKDTKITHHQTSLITSVYGPK--SVRGSF-TSQASLSIQLKNGLLEKYE--- 104

Query: 89  SSHKNERRVLEMQTALIRTFEKNVMLNIYPRTLIDIEVHVLQQDG--------------- 133
                 R + E+   L   F   + L  YP++ IDI +++  +                 
Sbjct: 105 -----SRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRK 159

Query: 134 ----GIMGSLINGITLALIDAGIAMYD 156
                I+   I+ IT+ALIDA I + D
Sbjct: 160 SNIYKILPHCISSITMALIDADIEIID 186

>CAGL0F07645g 742923..743678 similar to sp|P34247 Saccharomyces
           cerevisiae YKL099c, start by similarity
          Length = 251

 Score = 33.9 bits (76), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 101 QTALIRTFEKNVMLNIYPRTLIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISG 160
           Q  L++T + N     Y RTL  +E+  LQ+D  ++G          +D   +M D+ + 
Sbjct: 95  QVKLLKTQDSN-----YIRTLRQVELKKLQRDKQLIGYKSQSKHTVFVDDQDSMRDFKAE 149

Query: 161 VSIGLYDTTPLLDV--NSLEENAMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGI 218
                  T   LD   N L  + ++S  L  VG SE  SLL+ ++ +   RL+ +  + +
Sbjct: 150 NYFKT--TKEFLDRPENRLTVDQLTSQNLN-VGDSE--SLLMPKESLDKKRLKKIKQVKL 204

>YGR158C (MTR3) [2112] chr7 complement(805272..806024) Protein
           involved in mRNA transport, component of the exosome
           complex responsible for 3'-5' degradation of mRNA and
           for 3'-end processing of multiple small RNA species [753
           bp, 250 aa]
          Length = 250

 Score = 32.3 bits (72), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 53/128 (41%), Gaps = 31/128 (24%)

Query: 49  VITLVKGPKEPTLRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTF 108
           +IT V GP+  ++R    T +  + I +      K+        N   + E+ + L+  F
Sbjct: 73  LITAVYGPR--SIRGSF-TSQGTISIQLKNGLLEKY--------NTNELKEVSSFLMGIF 121

Query: 109 EKNVMLNIYPRTLIDIEVHVL--------------------QQDGGIMGSLINGITLALI 148
              V L+ YP++ IDI V++                      Q   ++   I  ITLAL 
Sbjct: 122 NSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMMSSQISSLIPHCITSITLALA 181

Query: 149 DAGIAMYD 156
           DAGI + D
Sbjct: 182 DAGIELVD 189

>Kwal_27.10199
          Length = 572

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 13/86 (15%)

Query: 139 LINGITLALIDAGIAMYDYISG---VSIGLYDTTPLLDVNSLEENAMSSVTLGVVGKSEK 195
           L++ + ++L   GI  Y +  G    + G+Y+  PLLDVN+     ++ +   +   +  
Sbjct: 51  LMSQVIISLPGTGIGCYFFHCGHENATGGIYELLPLLDVNARSMKKLNDLLDDITAANTT 110

Query: 196 LSLLLVEDKIPLDR-----LETVLAI 216
           L     E + PLD      LETV  +
Sbjct: 111 L-----EKQFPLDEQLSTPLETVFIL 131

>AGL162C [4150] [Homologous to ScYDR164C (SEC1) - SH]
           (392348..394431,394501..394531) [2115 bp, 704 aa]
          Length = 704

 Score = 28.5 bits (62), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 15/76 (19%)

Query: 19  WNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPTL--RSQMDTEKAILKISV 76
           W EL+        H H +D S YL    N++I      K P L  RS++ T   +L +  
Sbjct: 302 WLELK--------HQHIADASEYLNSKINEMIA-----KNPLLVDRSKVKTTTDLLSVVA 348

Query: 77  NITQFSKFERSKSSHK 92
           ++  F +  R  + HK
Sbjct: 349 HLKDFDEERRRITVHK 364

>ACR193C [1240] [Homologous to ScYPR031W - SH] (687668..689857)
           [2190 bp, 729 aa]
          Length = 729

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 163 IGLYDTTPLLDVNS---LEENAMSSVTLGVVGKSEKLSLLLVE-DKIPLDRLETVLAIGI 218
           + ++D T    ++S   L+  A + V L  + K ++LS LLV   +    RL+ V  I  
Sbjct: 522 VRIFDPTSFNSMDSADILKRVAFADVLLNDLAKLDELSTLLVRRQQAAQARLDAVDIIND 581

Query: 219 AGAHRVRDLMDEELRKH 235
            G H VR L+ + +  H
Sbjct: 582 LGFHPVRHLVQKNVTTH 598

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,429,713
Number of extensions: 300979
Number of successful extensions: 1002
Number of sequences better than 10.0: 27
Number of HSP's gapped: 988
Number of HSP's successfully gapped: 27
Length of query: 246
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 147
Effective length of database: 13,168,927
Effective search space: 1935832269
Effective search space used: 1935832269
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)