Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_647.642342320220.0
YJR013W40342012011e-164
ACR034W39741310441e-140
CAGL0B03905g43141510451e-140
KLLA0D09647g40239310091e-135
Kwal_33.154493964099911e-132
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_647.6
         (423 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_647.6                                                            783   0.0  
YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with mod...   467   e-164
ACR034W [1082] [Homologous to ScYJR013W - SH] complement(420791....   406   e-140
CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces c...   407   e-140
KLLA0D09647g complement(814829..816037) some similarities with s...   393   e-135
Kwal_33.15449                                                         386   e-132

>Scas_647.6
          Length = 423

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/423 (92%), Positives = 392/423 (92%)

Query: 1   MNLQNTERLLVVSGLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNS 60
           MNLQNTERLLVVSGLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNS
Sbjct: 1   MNLQNTERLLVVSGLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNS 60

Query: 61  NFPVNGSPYQRDTYRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNXXX 120
           NFPVNGSPYQRDTYRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKN   
Sbjct: 61  NFPVNGSPYQRDTYRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNISP 120

Query: 121 XXXXXXXXXXXXXXXXNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSI 180
                           NPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSI
Sbjct: 121 KISSLKLGLLSSIWLLNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSI 180

Query: 181 HFKIYPIIYCLAISIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEF 240
           HFKIYPIIYCLAISIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEF
Sbjct: 181 HFKIYPIIYCLAISIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEF 240

Query: 241 LDQAYFYHLYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYL 300
           LDQAYFYHLYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYL
Sbjct: 241 LDQAYFYHLYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYL 300

Query: 301 QPTFANLLNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVG 360
           QPTFANLLNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVG
Sbjct: 301 QPTFANLLNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVG 360

Query: 361 TQALWLSQGYYLEFEGRNVFYPXXXXXXXXXXXXNVWTLGQFIDDITSTILKSSIAVKVK 420
           TQALWLSQGYYLEFEGRNVFYP            NVWTLGQFIDDITSTILKSSIAVKVK
Sbjct: 361 TQALWLSQGYYLEFEGRNVFYPGIFFGAVAFFAGNVWTLGQFIDDITSTILKSSIAVKVK 420

Query: 421 KNV 423
           KNV
Sbjct: 421 KNV 423

>YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with
           moderate similarity to mannosyltransferase I
           (glycosylphosphatidylinositol mannosyltransferase I, rat
           Pigm), which transfers the first mannose to
           glycosylphosphatidylinositol (GPI) during the
           biosynthesis of GPI membrane anchors [1212 bp, 403 aa]
          Length = 403

 Score =  467 bits (1201), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 251/420 (59%), Positives = 297/420 (70%), Gaps = 18/420 (4%)

Query: 3   LQNTERLLVVSGLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNF 62
           +   E  L V   L+RV F+LFGIYQDA+FKVRYTDIDYFVFHDAA YVYE         
Sbjct: 1   MTGEEWGLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYE--------- 51

Query: 63  PVNGSPYQRDTYRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNXXXXX 122
               SPY RDTYRYTPLLSWLLVP+HYF  FHLGK +F+IFDL TG++IMK+L       
Sbjct: 52  --GKSPYARDTYRYTPLLSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISRK 109

Query: 123 XXXXXXXXXXXXXXNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHF 182
                         NPMVITISTRGNAES+LC L+M +L+FLQK RY LAGI+YGLSIHF
Sbjct: 110 RALILESIWLL---NPMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHF 166

Query: 183 KIYPIIYCLAISIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLD 242
           KIYPIIYC+ I+I++     N     ++L +L+ +G +TL T++G G  MY IYG+EFLD
Sbjct: 167 KIYPIIYCIPIAIFIYYNKRNQGP-RTQLTSLLNIGLSTLTTLLGCGWAMYKIYGYEFLD 225

Query: 243 QAYFYHLYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQP 302
           QAY YHLYRTDHRHNFS+WN+LLY DSA+  N  S LS+++F PQ+L+ +V   LE+  P
Sbjct: 226 QAYLYHLYRTDHRHNFSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNP 285

Query: 303 TFANLLNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQ 362
           TF NLL VLF+QTFAFVTYNKVCTSQYFVWYLIFLPF L  T I  K+G+ M  +WVGTQ
Sbjct: 286 TFDNLLRVLFVQTFAFVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQ 345

Query: 363 ALWLSQGYYLEFEGRNVFYPXXXXXXXXXXXXNVWTLGQFIDDITSTILKSSIAVKVKKN 422
            +WLSQGYYLEFEG+NVFYP            NVW LGQFI DI    + +   V  KKN
Sbjct: 346 GIWLSQGYYLEFEGKNVFYPGLFIASVLFFVTNVWLLGQFITDIK---IPTQPTVSNKKN 402

>ACR034W [1082] [Homologous to ScYJR013W - SH]
           complement(420791..421984) [1194 bp, 397 aa]
          Length = 397

 Score =  406 bits (1044), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/413 (50%), Positives = 274/413 (66%), Gaps = 20/413 (4%)

Query: 3   LQNTERLLVVSGLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNF 62
           ++  E LLV++GLL RV F+ +GIYQDAHF V+YTDIDY VFHDAA YV +         
Sbjct: 1   MKREECLLVLAGLLARVGFFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQ--------- 51

Query: 63  PVNGSPYQRDTYRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNXXXXX 122
               SPY RDTYRYTPLLSW+LVP+H+    H GKF+F++FDL  G+++M +L       
Sbjct: 52  --GNSPYLRDTYRYTPLLSWMLVPNHWLQWVHFGKFIFVLFDLLAGVMVMNLLGKCGRRR 109

Query: 123 XXXXXXXXXXXXXXNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHF 182
                         NP+VIT+STRGNAES++ FL+M  L  L+ R++ L+G +YG++IHF
Sbjct: 110 KLILASLWLL----NPVVITVSTRGNAESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHF 165

Query: 183 KIYPIIYCLAISIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLD 242
           KIYPIIY L ISIY+      ++  S     L+ +G  TL T+VG G  MY IYG+EFL+
Sbjct: 166 KIYPIIYALPISIYI-----RSSEGSRWFLRLLTMGIATLATLVGCGIGMYYIYGWEFLE 220

Query: 243 QAYFYHLYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQP 302
            AY YH  RTDHRHNFSLWN+LLY DS+    +    ++F+F PQ+ I   +TY+ +  P
Sbjct: 221 HAYIYHFTRTDHRHNFSLWNMLLYLDSSGVVPTTINWAEFAFLPQLFICAAVTYVLWEAP 280

Query: 303 TFANLLNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQ 362
           TF N+  VLFLQTFAFVTYNKVCTSQYF+WYL+FLP  L++TT+S  +G+ ++ +WVGTQ
Sbjct: 281 TFQNMQCVLFLQTFAFVTYNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQ 340

Query: 363 ALWLSQGYYLEFEGRNVFYPXXXXXXXXXXXXNVWTLGQFIDDITSTILKSSI 415
           A WL  GY LEFEG+N+FYP            NV+ L QFI D      +++I
Sbjct: 341 AWWLYNGYLLEFEGKNMFYPRLFSACVTFFLANVYLLAQFILDCRRRNYQTNI 393

>CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces
           cerevisiae YJR013w, hypothetical start
          Length = 431

 Score =  407 bits (1045), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 222/415 (53%), Positives = 282/415 (67%), Gaps = 24/415 (5%)

Query: 14  GLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNGSPYQRDT 73
            +L+R+ F+LFG+YQD HF V+YTDIDY VF+DAA +V  +            SPY RDT
Sbjct: 13  AVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHR-----------KSPYNRDT 61

Query: 74  YRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNXXXXXX--XXXXXXXX 131
           YRYTPLLSWLL+P+H    FH GK +F++ DL TG++I++MLK                 
Sbjct: 62  YRYTPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMA 121

Query: 132 XXXXXNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCL 191
                NPMVITISTRGNAES+LCFL++  LY     +Y L G+++GLSIHFKIYPIIY L
Sbjct: 122 AIWLLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKIYPIIYAL 181

Query: 192 AISIYLVCASHNNATVS---SKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYH 248
            I+IY V A+H N T S   S  K L +VG +TL  ++ L   MY +YG +F+DQ Y YH
Sbjct: 182 PIAIY-VAAAHYNKTQSVFKSSFK-LFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYH 239

Query: 249 LYRTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQPT-FANL 307
           +YRTDHRHNFS+WN+LLYF+SA    S   LSKF F PQM+I + ++  +  +P+ F  L
Sbjct: 240 IYRTDHRHNFSVWNMLLYFNSALPKTSE--LSKFVFLPQMIIVLAISLTQLRRPSSFPLL 297

Query: 308 LNVLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLS 367
            NVLFL+TFAFVT+NKVCTSQYF+WYLIFLPF L NT ISM+RG+ ML+VWV TQALWL 
Sbjct: 298 CNVLFLETFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLR 357

Query: 368 QGYYLEFEGRNVFYPXXXXXXXXXXXXNVWTLGQFIDDITSTILKSSIAVKVKKN 422
           QGY LEFEG+NVFYP            N W LGQFI+D   TI+++    +++ +
Sbjct: 358 QGYLLEFEGQNVFYPGLFCASVGFFVSNAWILGQFIED---TIIQNDYVYRIEPS 409

>KLLA0D09647g complement(814829..816037) some similarities with
           sp|P47088 Saccharomyces cerevisiae YJR013w singleton,
           hypothetical start
          Length = 402

 Score =  393 bits (1009), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 203/393 (51%), Positives = 268/393 (68%), Gaps = 21/393 (5%)

Query: 18  RVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNG-SPYQRDTYRY 76
           R+ F+ +GI+QD+HF V+YTDIDYFVFHDAAGYV             NG SPY RDTYRY
Sbjct: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVN------------NGQSPYLRDTYRY 63

Query: 77  TPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNXXXXXXXXXXXXXXXXXXX 136
           TPLLS+LL+P++Y    H+GK  F++FDL TG++I+K+L+                    
Sbjct: 64  TPLLSFLLLPNYYLKWIHMGKVFFVLFDLITGVMIIKLLQGSCQLTKQLILASIWLL--- 120

Query: 137 NPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCLAISIY 196
           NP+VITISTRGNAES+LCFL++ +LYFL++ R  ++G+ YGLSIHFKIYPIIY L I IY
Sbjct: 121 NPIVITISTRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIY 180

Query: 197 LVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYHLYRTDHRH 256
           L+ +SHN   +      L ++G +TL  I      MY +YG EF++ +Y YHL RTDHRH
Sbjct: 181 LLLSSHNRNCIW----RLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRH 236

Query: 257 NFSLWNILLYFDSASDPNSVSL-LSKFSFAPQMLITIVLTYLEYLQPTFANLLNVLFLQT 315
           NFS+WN++L  +SA    S S+ LSK +F PQ+ +  VL YL +   TF NL+NVLF+QT
Sbjct: 237 NFSIWNLVLLLESAGIHLSQSIELSKLAFVPQLTLCAVLPYLLWKSQTFENLMNVLFVQT 296

Query: 316 FAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLSQGYYLEFE 375
           +AFVT+NKVCTSQYF+WYL+  PF   NTTI+ ++GV  + +W+ +QA+WLSQ Y LEF+
Sbjct: 297 YAFVTFNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFK 356

Query: 376 GRNVFYPXXXXXXXXXXXXNVWTLGQFIDDITS 408
           G+NVF+P            NV+ LG FI DI S
Sbjct: 357 GQNVFFPNLFFGNIVFFLINVYLLGVFITDIKS 389

>Kwal_33.15449
          Length = 396

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 204/409 (49%), Positives = 273/409 (66%), Gaps = 27/409 (6%)

Query: 14  GLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNGSPYQRDT 73
            L++RV F+L+G+YQD HF V+YTDIDYFVF+DAA +V+  +           SPY RDT
Sbjct: 14  SLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGM-----------SPYLRDT 62

Query: 74  YRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNXXXXXXXXXXXXXXXX 133
           YRYTPLLSWLLVP+HY +  H GK +F++ DL TG++I+ +L+                 
Sbjct: 63  YRYTPLLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLE----IPNKRRRLILASL 118

Query: 134 XXXNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCLAI 193
              N MVITISTRGNAES++CFLV+LSLYFL+   Y LAG + GL+IHFKIYPIIY L I
Sbjct: 119 WLLNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPI 178

Query: 194 SIYLVCASHNNATVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYHLYRTD 253
           ++Y+     +       L +++ +G + +  +     LMY  YG E+L+ AY YH+ RTD
Sbjct: 179 AVYIYFQKKDG------LVSVVKIGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTD 232

Query: 254 HRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQPTFANLLNVLFL 313
           HRHNFS++++LLYF+SA    S    +K +F PQ +IT+ +  L +   +F NLL+VLF+
Sbjct: 233 HRHNFSVFHMLLYFESALPAESY--WAKLAFLPQAMITLGVVPLCFRSSSFNNLLSVLFI 290

Query: 314 QTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLSQGYYLE 373
           QT+AFVTYNKVCTSQYF+WYLIFLPF L +TTI+ +RG+AM  +W+ TQA WL  GY LE
Sbjct: 291 QTYAFVTYNKVCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLE 350

Query: 374 FEGRNVFYPXXXXXXXXXXXXNVWTLGQFIDDITSTILKSSIAVKVKKN 422
           F+G+NVFYP            NVW +GQFI+DI     K S+ +  KK+
Sbjct: 351 FKGQNVFYPGLFLASLSFFLSNVWIIGQFINDIN----KRSLQISDKKH 395

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.144    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,550,723
Number of extensions: 515697
Number of successful extensions: 1523
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1532
Number of HSP's successfully gapped: 15
Length of query: 423
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 319
Effective length of database: 12,995,837
Effective search space: 4145672003
Effective search space used: 4145672003
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 63 (28.9 bits)