Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_647.51161165953e-81
Sklu_2075.21131011682e-16
KLLA0D09669g1351101683e-16
YJR012C207461453e-12
Kwal_33.154481131031387e-12
ACR033C95531229e-10
Scas_522.763356611.9
CAGL0K08206g116925583.9
Scas_578.3*52435575.7
AFR412C43925576.6
Scas_518.3d62635567.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_647.5
         (116 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_647.5                                                            233   3e-81
Sklu_2075.2 YJR012C, Contig c2075 940-1281                             69   2e-16
KLLA0D09669g 816343..816750 no similarity, hypothetical start          69   3e-16
YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protei...    60   3e-12
Kwal_33.15448                                                          58   7e-12
ACR033C [1081] [Homologous to ScYJR012C - SH] (420391..420678) [...    52   9e-10
Scas_522.7                                                             28   1.9  
CAGL0K08206g 814575..818084 similar to sp|P53120 Saccharomyces c...    27   3.9  
Scas_578.3*                                                            27   5.7  
AFR412C [3604] [Homologous to ScYHR011W (DIA4) - SH] (1173600..1...    27   6.6  
Scas_518.3d                                                            26   7.3  

>Scas_647.5
          Length = 116

 Score =  233 bits (595), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MSEELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQVEVAGEETPT 60
           MSEELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQVEVAGEETPT
Sbjct: 1   MSEELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQVEVAGEETPT 60

Query: 61  NDNFGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQKKEPIDNETGDVNNDQDAS 116
           NDNFGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQKKEPIDNETGDVNNDQDAS
Sbjct: 61  NDNFGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQKKEPIDNETGDVNNDQDAS 116

>Sklu_2075.2 YJR012C, Contig c2075 940-1281
          Length = 113

 Score = 69.3 bits (168), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 62/101 (61%), Gaps = 4/101 (3%)

Query: 1   MSEELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQ-VEVAGEETP 59
           M+ +LSY++LV+HIV NKP+PNVV VP+  LDS + ++  L  R+KPWE+  + A  E P
Sbjct: 1   MNRQLSYEELVDHIVNNKPVPNVVSVPNITLDSSMRTESLLKPRLKPWERKAQGATVEEP 60

Query: 60  ---TNDNFGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQ 97
                    +     + + ++  ++LS+ YA+EA++   LQ
Sbjct: 61  QELIQKAKEITEHVESVNKTQSFESLSRYYAIEAEFEKQLQ 101

>KLLA0D09669g 816343..816750 no similarity, hypothetical start
          Length = 135

 Score = 69.3 bits (168), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 62/110 (56%), Gaps = 22/110 (20%)

Query: 4   ELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQ---VEVAGEETPT 60
           ELSYD+L++ IV NKP+PNVV VPD +LD  L ++  L  R+KPWEQ   V V G     
Sbjct: 9   ELSYDELMDIIVNNKPVPNVVDVPDIILDQSLATEHHLKPRLKPWEQAKDVPVMG----- 63

Query: 61  NDNFGLV-------NLSTNSDLSKDMDNLSKL---YALEADYIATLQKKE 100
               GLV        L+ N +L K  ++L KL   YALE ++   L+  E
Sbjct: 64  ----GLVRQKEETKGLAENVELVKKSNSLEKLTNYYALEVEFQKQLKGYE 109

>YJR012C (YJR012C) [2915] chr10 complement(459709..460332) Protein
           of unknown function [624 bp, 207 aa]
          Length = 207

 Score = 60.5 bits (145), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 35/46 (76%)

Query: 4   ELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWE 49
           ELSY++L++HI+ NKPIPN+V+VP+  LD  L S P L  R +PWE
Sbjct: 81  ELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRPRPRPWE 126

>Kwal_33.15448
          Length = 113

 Score = 57.8 bits (138), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 14/103 (13%)

Query: 3   EELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQ-------VEVAG 55
           ++L+Y++LV+HI+ +KP+PN++ VP+   D  L ++  L  R KPWEQ       +E A 
Sbjct: 4   QQLTYEELVDHIINDKPVPNILAVPNITQDPSLITKSSLRPRAKPWEQKKEVTVTIEGAS 63

Query: 56  EETPTNDN-FGLVNLSTNSDLSKDMDNLSKLYALEADYIATLQ 97
           +E    D   G V+ S ++      ++LS  YA+E ++   +Q
Sbjct: 64  DEAQAIDREAGAVSHSHST------ESLSTYYAMETEFEQQMQ 100

>ACR033C [1081] [Homologous to ScYJR012C - SH] (420391..420678)
          [288 bp, 95 aa]
          Length = 95

 Score = 51.6 bits (122), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%)

Query: 3  EELSYDDLVEHIVLNKPIPNVVQVPDTVLDSKLGSQPRLTQRIKPWEQVEVAG 55
          +ELSYD LV+ IV  KP+PN+V+V D V D    S+ +L  R KPWE  +V  
Sbjct: 15 QELSYDQLVDIIVNGKPVPNLVEVADQVHDESQCSESKLCPRKKPWESTDVRA 67

>Scas_522.7
          Length = 633

 Score = 28.1 bits (61), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 62  DNFGLVNLSTNSDLSKDMDNLSKLYAL-EADYIATLQKKEPIDNETGDVNNDQDAS 116
           D   L + S +S+ +   D+ S   AL E+ ++    +K+ I+N+TG+V+ D   S
Sbjct: 11  DESNLQSFSGDSNPASKGDDGSNSIALSESSFVGRNPEKQTINNKTGEVSTDSQDS 66

>CAGL0K08206g 814575..818084 similar to sp|P53120 Saccharomyces
            cerevisiae YGL140c, start by similarity
          Length = 1169

 Score = 26.9 bits (58), Expect = 3.9,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 61   NDNFGLVNLSTNSDLSKDMDNLSKL 85
            ++NF L  + + SDLS DMD+ S +
Sbjct: 1043 HNNFDLYGMESASDLSSDMDSASAM 1067

>Scas_578.3*
          Length = 524

 Score = 26.6 bits (57), Expect = 5.7,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 78  DMDNLSKLYALE-ADYIATLQKKEPIDNETGDVNN 111
           D+DN   + A + + Y++TL KKE   N+T  VN+
Sbjct: 93  DVDNDGMIRASDVSKYLSTLAKKEAASNDTKKVNS 127

>AFR412C [3604] [Homologous to ScYHR011W (DIA4) - SH]
           (1173600..1174919) [1320 bp, 439 aa]
          Length = 439

 Score = 26.6 bits (57), Expect = 6.6,   Method: Composition-based stats.
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 81  NLSKLYALEADYIATLQKKEPIDNE 105
           N+  + A   DY+ ++Q +EP+D E
Sbjct: 21  NVKAMLARLPDYVGSVQAREPVDGE 45

>Scas_518.3d
          Length = 626

 Score = 26.2 bits (56), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 71  TNSDLSKDMDNLSKLYALEADYIATLQKKEPIDNE 105
           +N+ L+  + NL K    +A YI T+ +K P +NE
Sbjct: 555 SNTFLTMQLSNLRKENFSQAKYIDTISRKRPSENE 589

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.307    0.128    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,356,411
Number of extensions: 187076
Number of successful extensions: 406
Number of sequences better than 10.0: 30
Number of HSP's gapped: 405
Number of HSP's successfully gapped: 31
Length of query: 116
Length of database: 16,596,109
Length adjustment: 86
Effective length of query: 30
Effective length of database: 13,618,961
Effective search space: 408568830
Effective search space used: 408568830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 54 (25.4 bits)