Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_647.390903586e-46
YJR010C-A (SPC1)94901876e-20
Sklu_2014.488881599e-16
Kwal_33.1544288871591e-15
AGR325C91861042e-07
KLLA0E09724g9189760.003
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_647.3
         (90 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_647.3                                                            142   6e-46
YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit...    77   6e-20
Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement       66   9e-16
Kwal_33.15442                                                          66   1e-15
AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH] (1337706....    45   2e-07
KLLA0E09724g 862612..862887 weakly similar to sp|P46965 Saccharo...    34   0.003

>Scas_647.3
          Length = 90

 Score =  142 bits (358), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 73/90 (81%)

Query: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGXXX 60
          MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYG   
Sbjct: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGVTF 60

Query: 61 XXXXXXXXXXXXXXNKQKLQWVQPKLATNL 90
                        NKQKLQWVQPKLATNL
Sbjct: 61 VVTLLLVVPPYPFYNKQKLQWVQPKLATNL 90

>YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit
          of the signal peptidase complex [285 bp, 94 aa]
          Length = 94

 Score = 76.6 bits (187), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 52/90 (57%)

Query: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGXXX 60
          MS IL ++Q+ LV PIDFPSQ++T + QQ  L+IGA+ A I GF  QSL   L  YG   
Sbjct: 1  MSEILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISC 60

Query: 61 XXXXXXXXXXXXXXNKQKLQWVQPKLATNL 90
                        NKQKL+W QPK+  N+
Sbjct: 61 VITLICVLPAYPWYNKQKLRWAQPKIEINV 90

>Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement
          Length = 88

 Score = 65.9 bits (159), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 46/88 (52%)

Query: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGXXX 60
          MS +L EI + +V PIDFPSQ+ T +L   IL  G + +   GF+TQSL   + CYG   
Sbjct: 1  MSELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATLVYCYGACC 60

Query: 61 XXXXXXXXXXXXXXNKQKLQWVQPKLAT 88
                        NK++L+W   K+ T
Sbjct: 61 LLCLLLVLPSYPTYNKRRLKWAGTKIET 88

>Kwal_33.15442
          Length = 88

 Score = 65.9 bits (159), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 46/87 (52%)

Query: 1  MSAILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGXXX 60
          MS +L EIQK LV PIDF SQ+ T  L    L+ G IAA   G  TQSL N ++ +G   
Sbjct: 1  MSEVLQEIQKKLVFPIDFASQRETDRLVNRTLIFGTIAACFIGLFTQSLANLMMSFGVSL 60

Query: 61 XXXXXXXXXXXXXXNKQKLQWVQPKLA 87
                        NK++ +WV+ K++
Sbjct: 61 ALCFAAVLPSYSAYNKRRPEWVKTKIS 87

>AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH]
          (1337706..1337981) [276 bp, 91 aa]
          Length = 91

 Score = 44.7 bits (104), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%)

Query: 4  ILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGXXXXXX 63
          I +++ + LV PID+PSQ+R  +L   IL  G + + + GF   SL  TL  +       
Sbjct: 3  IFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSLTLYAFAAAYGLA 62

Query: 64 XXXXXXXXXXXNKQKLQWVQPKLATN 89
                      +QKL WV    AT 
Sbjct: 63 LLLVVPAYGKYRQQKLAWVGSAAATT 88

>KLLA0E09724g 862612..862887 weakly similar to sp|P46965
          Saccharomyces cerevisiae YJR010ca SPC1 signal peptidase
          10.8 kDa subunit singleton, hypothetical start
          Length = 91

 Score = 33.9 bits (76), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 7/89 (7%)

Query: 4  ILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGXXXXXX 63
          +L ++ + LV PIDF SQ  T  +    L +    + I G+LT+S+  + I +       
Sbjct: 3  VLQDLGRQLVFPIDFESQSYTESISNKALYLITFFSFISGYLTESIKVSGIVFVLGLIVV 62

Query: 64 XXXXXXXXXXXNKQKLQW-------VQPK 85
                     NK + QW       V+PK
Sbjct: 63 LVIVLPPYSAYNKHRPQWANSGPTVVEPK 91

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,083,524
Number of extensions: 52145
Number of successful extensions: 141
Number of sequences better than 10.0: 6
Number of HSP's gapped: 139
Number of HSP's successfully gapped: 6
Length of query: 90
Length of database: 16,596,109
Length adjustment: 61
Effective length of query: 29
Effective length of database: 14,484,411
Effective search space: 420047919
Effective search space used: 420047919
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)