Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_647.251151127190.0
YJR010W (MET3)51151122650.0
CAGL0B03839g50751122620.0
Sklu_2014.150651221440.0
Kwal_33.1543450551121220.0
KLLA0E09812g50251121110.0
AGR322W50051118160.0
KLLA0B10912g51259760.36
KLLA0B02827g94242730.93
Kwal_27.1043856962711.2
KLLA0B08800g57061711.4
Sklu_1647.1644163692.6
Scas_699.2053852648.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_647.2
         (511 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_647.2                                                           1051   0.0  
YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase (su...   877   0.0  
CAGL0B03839g 380291..381814 highly similar to sp|P08536 Saccharo...   875   0.0  
Sklu_2014.1 YJR010W, Contig c2014 195-1715                            830   0.0  
Kwal_33.15434                                                         822   0.0  
KLLA0E09812g complement(870664..872172) highly similar to sp|P08...   817   0.0  
AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH] complement(...   704   0.0  
KLLA0B10912g 955948..957486 similar to sp|P53043 Saccharomyces c...    34   0.36 
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    33   0.93 
Kwal_27.10438                                                          32   1.2  
KLLA0B08800g complement(772732..774444) similar to ca|CA4426|CaA...    32   1.4  
Sklu_1647.1 YPR179C, Contig c1647 141-2075 reverse complement          31   2.6  
Scas_699.20                                                            29   8.3  

>Scas_647.2
          Length = 511

 Score = 1051 bits (2719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/511 (100%), Positives = 511/511 (100%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
           TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV
Sbjct: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR
Sbjct: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL
Sbjct: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420

Query: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480
           QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN
Sbjct: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480

Query: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF
Sbjct: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511

>YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase
           (sulfate adenylyltransferase), catalyzes incorporation
           of inorganic sulfate into ATP to form adenosine
           5'-phosphosulfate (APS) [1536 bp, 511 aa]
          Length = 511

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/511 (81%), Positives = 454/511 (88%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           MPAPHGGILQDL+ARDA KK  L  EAQS  +  W LT RQ+CDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
            E DY SVV +SRLADGTLWT+PITLDVDE FA  + P++RI L QD EIPIAILTV DV
Sbjct: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           Y+P+K +EA++VFRGDPEHPAI YL N+AG+YY+GGSLEAIQLPQHYDYPGLRK PAQLR
Sbjct: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEFQSRQWDR+VAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VYQEIIKRYPNGIAFLSLLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           GVDFYGPYDAQELVESYK+ELDI+VVPFRMVTYLPDEDRYAPIDQIDT+KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LR+RLRVGGEIPEWFSYPEVVKILRESNPPRPKQGF+IVL +SL     QL+IALLSTFL
Sbjct: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420

Query: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480
           QFGGGR+YK+FEH N  +LL LI DFI +GSGLI+PNQW     S    QNVY L  S++
Sbjct: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480

Query: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           +DI+L+S DE I HIVQKVVLFLEDNG+ VF
Sbjct: 481 ADIQLESADEPISHIVQKVVLFLEDNGFFVF 511

>CAGL0B03839g 380291..381814 highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3, start by
           similarity
          Length = 507

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/511 (81%), Positives = 459/511 (89%), Gaps = 4/511 (0%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           MPAPHGG+LQDLVARDASK+ +L  E+Q   L+QWTLTARQICDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGVLQDLVARDASKRDSLLSESQQ--LSQWTLTARQICDIELILNGGFSPLTGFL 58

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
            ++DY  VV NSRL+DGTLWTMPITLDV E FA SV PN RI LLQDG IP+AILTV D+
Sbjct: 59  AQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDI 118

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           Y+PDK++EA++VFRGDPEHPAI YL N AG+YYIGG+L+AIQLPQHYDYPGLRK PAQLR
Sbjct: 119 YKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLR 178

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEFQSRQWDR+VAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 179 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVR 238

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPGSNSK
Sbjct: 239 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSK 298

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKNELDI VVPFRMVTYLPDEDRYAPID+IDTSKTRTLNISGTE
Sbjct: 299 GVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTE 358

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LRKRLR GGEIPEWFSYPEVVKILRESNPPRPKQGFA+V  D +     QL+IALLSTFL
Sbjct: 359 LRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFL 418

Query: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480
           QFGGGRHYK+++H +  + LELI DF+QAGSGLI+P+ W++ N    A  NVYT+G + +
Sbjct: 419 QFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSA--NVYTIGHAKD 476

Query: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           +DIKL S +ETIFHIVQKVVLFLEDN ++ F
Sbjct: 477 ADIKLASTEETIFHIVQKVVLFLEDNHFIQF 507

>Sklu_2014.1 YJR010W, Contig c2014 195-1715
          Length = 506

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/512 (77%), Positives = 448/512 (87%), Gaps = 7/512 (1%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           MPAPHGG+LQDL+ARDAS K  L QEA    L  W+LT RQICD+ELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGVLQDLIARDASIKPQLLQEASDSKLT-WSLTGRQICDLELILNGGFSPLTGFL 59

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
            EKDY SVV +SRL++G +WTMPITLDVD  FA  +  + RI LLQ+ EIP+A LTVTDV
Sbjct: 60  NEKDYTSVVNDSRLSNGLVWTMPITLDVDSEFASKLQIDDRILLLQENEIPLAFLTVTDV 119

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           Y+PDK++EAK+VFRGDPEHPAI YLNNIAGEYY+GG L+AIQLPQHYDYPGLR+ PAQLR
Sbjct: 120 YKPDKSVEAKKVFRGDPEHPAISYLNNIAGEYYVGGELQAIQLPQHYDYPGLRRTPAQLR 179

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEF S+QWDRIVAFQTRNPMHRAHRELTVRAARE NAK+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 180 LEFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREQNAKILIHPVVGLTKPGDIDHHTRVR 239

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPG NSK
Sbjct: 240 VYQEIIKRYPNGMAHLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSK 299

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           GVDFYG YDAQELVESYKNEL+I+VVPFRMVTYLPDEDRYAPIDQID + T+TLNISGTE
Sbjct: 300 GVDFYGAYDAQELVESYKNELEIEVVPFRMVTYLPDEDRYAPIDQIDLATTKTLNISGTE 359

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LR RLR GGEIP WFSYPEVVKILRES+PPRP QGFA+VL+DSL   + QL+IALLSTFL
Sbjct: 360 LRNRLRDGGEIPAWFSYPEVVKILRESSPPRPNQGFAVVLDDSLKN-NKQLSIALLSTFL 418

Query: 421 QFGGGRHYKVFEHE-NNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASA 479
           QFGGGRHYK+F H  NN++L+ELIPDFI++G+GLIVP Q+   + +     NV+T+G + 
Sbjct: 419 QFGGGRHYKIFNHSNNNEELVELIPDFIRSGAGLIVPGQFNGSSDA----TNVFTVGVAD 474

Query: 480 NSDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           +++IKL+S DE I H+VQKVVLFLEDN +  F
Sbjct: 475 DAEIKLESEDEPILHVVQKVVLFLEDNSFFKF 506

>Kwal_33.15434
          Length = 505

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/511 (76%), Positives = 442/511 (86%), Gaps = 6/511 (1%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           MPAPHGGILQDL+ARDA  K  L +EA    +  W LTARQICD+ELI NGGFSPL+GFL
Sbjct: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKIT-WDLTARQICDLELIQNGGFSPLSGFL 59

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
            +KDY SVV NSRL++  +WT+PITLDVD  FAK + P +R+TLLQD EIP+AILTVTDV
Sbjct: 60  NQKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDV 119

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           Y+PDK +EAK+VFRGDPEHPA++YL   AGEYY+GG ++AIQ P HYDYPGLRK PAQLR
Sbjct: 120 YKPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLR 179

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDRIVAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 180 LEFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVR 239

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPG NS 
Sbjct: 240 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSA 299

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           GVDFYG YDAQELVE+YK+ELDI+VVPFRMVTYLPDEDRYAPIDQID S T+TLNISGTE
Sbjct: 300 GVDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTE 359

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LR RLR GG IPEWFSYPEVVKILRESNPPRP+QGFAIVL  +L+  + QLA ALLSTFL
Sbjct: 360 LRNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSN-NKQLATALLSTFL 418

Query: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480
           QFGGGRHYKV EH +   +LEL+PDFI++G+GLI+P+++  KN S  A  N Y +G S  
Sbjct: 419 QFGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEY--KNAS--ATTNAYQVGTSDG 474

Query: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           +DIKL+S DE++ H+VQKVVLFLEDNG+  F
Sbjct: 475 ADIKLESNDESVLHVVQKVVLFLEDNGFFTF 505

>KLLA0E09812g complement(870664..872172) highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3 sulfate
           adenylyltransferase singleton, start by similarity
          Length = 502

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/511 (76%), Positives = 443/511 (86%), Gaps = 9/511 (1%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           MP+PHGG+LQDLVARDASKKA L + AQSG L  W+LTARQICD+ELILNGGFSPL GFL
Sbjct: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
            ++DY SVV+ SRL +G +WT+PITLDVD  FA  ++P+ RI LLQD E P+AILTV+DV
Sbjct: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           Y+PDKA+EAK+VFRGDPEHPA++YL   AGE+Y+GGSLEAIQLP HYDYPG RK PAQLR
Sbjct: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
           LEF+S+QWDR+VAFQTRNPMHRAHRELTVRAAR  N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           GVDFYGPYDAQELVESYKNELDI+VVPFRMVTYLPDEDRYAPID+IDT KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LR RLR GGEIP WFSYPEVVKILRESNP RPKQGFA+VL ++L A   QL  ALLSTFL
Sbjct: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPA---QLKTALLSTFL 417

Query: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480
           Q+GGGRHYKV EH NN+++L L+PDF+++G+GLI+ N  + K        NV+ +G  + 
Sbjct: 418 QYGGGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNASSLKGT------NVFKIGEESG 471

Query: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           SDI L++ D+ I HIVQ+VVLFLED G+  F
Sbjct: 472 SDIPLETEDKNILHIVQRVVLFLEDQGFFQF 502

>AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH]
           complement(1332643..1334145) [1503 bp, 500 aa]
          Length = 500

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/511 (68%), Positives = 412/511 (80%), Gaps = 11/511 (2%)

Query: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60
           M +PHGGILQDLVARDA KK  L  EAQ   L QW LTARQ+CDIELILNGGFSPLTGFL
Sbjct: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQG--LPQWNLTARQLCDIELILNGGFSPLTGFL 58

Query: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120
            ++DY SVV+NSRL  G LWT+PITLDVDE FAKSV    RI LLQD +I +AI+TV+D+
Sbjct: 59  GKEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDI 118

Query: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180
           Y PDK +EA +VFRGD EHPAI+YLN  AG+ Y+GG LEAIQLP HYDY  LRK+PA LR
Sbjct: 119 YTPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALR 178

Query: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240
            +F ++QWDR+VAFQTRNPMHRAHRELT+RAA+E NAKVL+HPVVGLTKPGDID+HTR++
Sbjct: 179 ADFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIK 238

Query: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300
           VY+EI+KRYP GIA L+LLPLAMRM GDREAVWHAIIRKNYGATHFIVGRDHAGPG+NSK
Sbjct: 239 VYKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSK 298

Query: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360
           G DFYGPYDAQ LVESYKNEL I+VVPF+++TYLPD+D Y P+D+ID S  +TL ISGTE
Sbjct: 299 GDDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGS-VKTLTISGTE 357

Query: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420
           LRKRLR G +IP+WF+YPE+V+ILR+ NPPR +QGF IV+    +    ++A ALLSTFL
Sbjct: 358 LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVN---HENPKRIANALLSTFL 414

Query: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480
           Q GGGR YK+F+H+   +LLELIPDF+++G+GLIV    TS   S     N+Y L    +
Sbjct: 415 QVGGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIV----TSPLPSSVDAHNIYELNTYPS 470

Query: 481 SDIKLDSVDETIFHIVQKVVLFLEDNGYLVF 511
           + IK+ S  E +  IVQK V FLEDN +  F
Sbjct: 471 AHIKV-SATEPVTEIVQKTVFFLEDNKFFQF 500

>KLLA0B10912g 955948..957486 similar to sp|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase,
           start by similarity
          Length = 512

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 431 FEHENNDKLLELIPDFIQAGSGL-----IVPNQWTSKNVSFGADQNVYTLGASANSDIK 484
           FEHEN    +   P++  AG  L     +VPN  + K  S  +D  + T  AS + DIK
Sbjct: 443 FEHENQLVTVFSAPNYCDAGGNLGAIIHVVPNTKSEKKSSIDSDLVIETFSASPHPDIK 501

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 232 DIDHHTRVRVYQEIIKRYPNGIA---FLSLLPLAMRMGGDRE 270
           D+DH +RV+V + I K    G+A   FL+  P+ +  GGD +
Sbjct: 279 DLDHRSRVQVLKGIHKEVNGGVARASFLNGQPIVVTCGGDNQ 320

>Kwal_27.10438
          Length = 569

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 372 PEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFLQFGGGRHYKVF 431
           P W+S  ++  I   +       G  I L  S+ +PSG+  + L   +++FGGG+   ++
Sbjct: 375 PTWYSEEQMTDIYTTNLKLYTCDGNKIQL--SMWSPSGEPLLPLTKHYMKFGGGKELSIY 432

Query: 432 EH 433
           E+
Sbjct: 433 EN 434

>KLLA0B08800g complement(772732..774444) similar to
           ca|CA4426|CaAMD21 Candida albicans amidase (by
           homology), start by similarity
          Length = 570

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 373 EWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFLQFGGGRHYKVFE 432
           +WFS  E+ ++   +       G  + L  S+  PSG+  + L   FL+FGGG+ + ++ 
Sbjct: 374 QWFSEEEMKELYDTTLSLYTCDGNKVQL--SMLEPSGEPILPLTRHFLEFGGGKEHSIYS 431

Query: 433 H 433
           +
Sbjct: 432 N 432

>Sklu_1647.1 YPR179C, Contig c1647 141-2075 reverse complement
          Length = 644

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 64/163 (39%), Gaps = 20/163 (12%)

Query: 78  TLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDVYRPDKALEAKEVFRGDP 137
           +L T  I   + ET  K       +  +Q+ E   AI     V RP + ++  E      
Sbjct: 99  SLITKDIPSHLAETSGKFAVLRDLMNFVQEYETDTAI-----VCRPGRTMDLLE------ 147

Query: 138 EHPAIRYLNNIAGEYYIGGSLEAIQLPQHYD-----YPGLRKAPAQLRLEFQSRQWDRIV 192
              A+ + N +  + Y G S++  Q P+ +      +P       +  L+   R +D +V
Sbjct: 148 ---ALLFGNKVNIKRYHGSSIKPKQKPRKFSCTCHLFPSDSIDQTKTPLDNNIR-FDMLV 203

Query: 193 AFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDH 235
              T   +++AH +  +   R         PVV LT    IDH
Sbjct: 204 CLDTTIDINKAHIQSILHQQRPRRGSTSTAPVVRLTTINSIDH 246

>Scas_699.20
          Length = 538

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 397 AIVLEDSLNAPSGQLAIALLSTFLQFGGGRHYKVFEHENNDKLLELIPDFIQ 448
           + V+ + ++   G +   + S +L FGGGRH  + EH    +L  ++ +FI+
Sbjct: 445 SYVVGEEVDYGFGAITKGVTSPYLPFGGGRHRCIGEHYAYCQLGVIMAEFIR 496

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,223,595
Number of extensions: 760700
Number of successful extensions: 1737
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1767
Number of HSP's successfully gapped: 17
Length of query: 511
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 405
Effective length of database: 12,926,601
Effective search space: 5235273405
Effective search space used: 5235273405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)