Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_644.936436418630.0
CAGL0E02343g36436515460.0
YOL010W (RCL1)36736415420.0
Sklu_2419.236736315300.0
KLLA0C05984g36436315240.0
Kwal_56.2250236436415220.0
ACL015W36236414600.0
Kwal_56.2320127986760.16
KLLA0F21032g29781760.17
CAGL0L06732g28881740.32
Scas_633.128784653.5
Scas_688.486077646.0
KLLA0F01342g46931646.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_644.9
         (364 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_644.9                                                            722   0.0  
CAGL0E02343g 225099..226193 highly similar to sp|Q08096 Saccharo...   600   0.0  
YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required fo...   598   0.0  
Sklu_2419.2 YOL010W, Contig c2419 2010-3113                           593   0.0  
KLLA0C05984g 528906..530000 highly similar to sp|Q08096 Saccharo...   591   0.0  
Kwal_56.22502                                                         590   0.0  
ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH] complement(...   566   0.0  
Kwal_56.23201                                                          34   0.16 
KLLA0F21032g 1964630..1965523 highly similar to sp|Q9P4C1 Kluyve...    34   0.17 
CAGL0L06732g complement(757868..758734) similar to sp|P38120 Sac...    33   0.32 
Scas_633.1                                                             30   3.5  
Scas_688.4                                                             29   6.0  
KLLA0F01342g 124864..126273 similar to sp|P38348 Saccharomyces c...    29   6.1  

>Scas_644.9
          Length = 364

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/364 (96%), Positives = 353/364 (96%)

Query: 1   MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60
           MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG
Sbjct: 1   MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60

Query: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGIT 120
           SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAP           GIT
Sbjct: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPFSKKKFSIIFKGIT 120

Query: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180
           ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE
Sbjct: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180

Query: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240
           LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG
Sbjct: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240

Query: 241 ITLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI 300
           ITLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI
Sbjct: 241 ITLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI 300

Query: 301 GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTN 360
           GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTN
Sbjct: 301 GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTN 360

Query: 361 KKIA 364
           KKIA
Sbjct: 361 KKIA 364

>CAGL0E02343g 225099..226193 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1, start by
           similarity
          Length = 364

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/365 (78%), Positives = 322/365 (88%), Gaps = 2/365 (0%)

Query: 1   MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60
           MSS+ Y+ FQG +NFR RII +TLSGK IKIEKIRS DLNPGL+D+EVSFLRLME+VTNG
Sbjct: 1   MSSQ-YVVFQGPENFRHRIIFATLSGKPIKIEKIRSQDLNPGLRDHEVSFLRLMEAVTNG 59

Query: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGIT 120
           SVIEISYTGTT++YRPGII GG +TH CPPSKPVGYFVEPMLYLAP           GIT
Sbjct: 60  SVIEISYTGTTVIYRPGIIIGGPYTHTCPPSKPVGYFVEPMLYLAPFSKKKFSIVFKGIT 119

Query: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180
           ASH+DAGIEAIKWGL+P++EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMHE
Sbjct: 120 ASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPQGGGEVHLVVDSLIAQPITMHE 179

Query: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240
           L+RP I+++RGVAYSTRVSPSMVNRMID AK+VL  + C V ITADVWRGENSGKSPGWG
Sbjct: 180 LDRPVISSIRGVAYSTRVSPSMVNRMIDGAKQVLKNVKCEVNITADVWRGENSGKSPGWG 239

Query: 241 ITLVAQS-KKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMV 299
           IT+VA++ KKGWCYF+E IG +GD+PE+IG  VAY+L+EEIS SAAV RNQL LAI YMV
Sbjct: 240 ITIVAETKKKGWCYFAEEIGGSGDIPEEIGSKVAYKLIEEISKSAAVDRNQLPLAITYMV 299

Query: 300 IGKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNT 359
           IGKEDIGRLRIT++Q+DE FI +LRDIKK+FGTEVFLKPVDD+ SDD IAT+KG+GFTNT
Sbjct: 300 IGKEDIGRLRITREQVDERFIQMLRDIKKIFGTEVFLKPVDDIGSDDFIATVKGIGFTNT 359

Query: 360 NKKIA 364
           NKKIA
Sbjct: 360 NKKIA 364

>YOL010W (RCL1) [4806] chr15 (307938..309041) Protein required for
           pre-rRNA processing at cleavage sites A0, A1 and A2, has
           similarity to RNA 3'-terminal phosphate cyclase,
           interacts with Bms1p [1104 bp, 367 aa]
          Length = 367

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/364 (79%), Positives = 321/364 (88%), Gaps = 1/364 (0%)

Query: 2   SSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNGS 61
           S+  Y TFQGSQNFRLRI+L+TLSGK IKIEKIRS DLNPGLKDYEVSFLRL+ESVTNGS
Sbjct: 4   SAPKYTTFQGSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGS 63

Query: 62  VIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGITA 121
           VIEISYTGTT++YRPGII GGA TH CP SKPVGYFVEPMLYLAP           GITA
Sbjct: 64  VIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAPFSKKKFSILFKGITA 123

Query: 122 SHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHEL 181
           SH+DAGIEAIKWGL+P++EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMHE+
Sbjct: 124 SHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEI 183

Query: 182 ERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWGI 241
           +RP I+++ GVAYSTRVSPS+VNRMID AKKVL  L C V ITADVWRGENSGKSPGWGI
Sbjct: 184 DRPIISSITGVAYSTRVSPSLVNRMIDGAKKVLKNLQCEVNITADVWRGENSGKSPGWGI 243

Query: 242 TLVAQSK-KGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI 300
           TLVAQSK KGW YF+E IGDAG +PE++G+ VA +LLEEIS SAAVGRNQL LAIVYMVI
Sbjct: 244 TLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKSAAVGRNQLPLAIVYMVI 303

Query: 301 GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTN 360
           GKEDIGRLRI K+QIDE FI LLRDIKK+F TEVFLKPVD+ +++DMIATIKG+GFTNT+
Sbjct: 304 GKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFTNTS 363

Query: 361 KKIA 364
           KKIA
Sbjct: 364 KKIA 367

>Sklu_2419.2 YOL010W, Contig c2419 2010-3113
          Length = 367

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/363 (77%), Positives = 319/363 (87%)

Query: 2   SSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNGS 61
           +S  Y  FQG++NFRLRIIL+TLSGK+IK+EKIRS DLNPGLKDYEVSFLRLME+VTNGS
Sbjct: 5   NSSRYTVFQGARNFRLRIILATLSGKAIKLEKIRSDDLNPGLKDYEVSFLRLMEAVTNGS 64

Query: 62  VIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGITA 121
            IEISYTGTT++Y+PGII GG++TH CP SKPVGYFVEPMLYLAP           GITA
Sbjct: 65  AIEISYTGTTVIYKPGIIIGGSYTHTCPSSKPVGYFVEPMLYLAPFSKKKFSILFRGITA 124

Query: 122 SHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHEL 181
           SH+DAGIEAIKWG+LP++EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMH L
Sbjct: 125 SHNDAGIEAIKWGMLPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHAL 184

Query: 182 ERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWGI 241
           + P I+++RGV+YSTRVSPSMVNRMID AK VL  + C V ITADVWRG+NSGKSPGWGI
Sbjct: 185 DTPLISSIRGVSYSTRVSPSMVNRMIDGAKAVLKNVGCEVNITADVWRGDNSGKSPGWGI 244

Query: 242 TLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVIG 301
           TLVA++KKGW YFSEAIGDAGDVPEDIG  VAY+LLEEIS S  VGR QL LAI YMVIG
Sbjct: 245 TLVAENKKGWRYFSEAIGDAGDVPEDIGTKVAYQLLEEISKSGVVGRAQLPLAITYMVIG 304

Query: 302 KEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTNK 361
           KEDIGRLRI K+QIDE FI+LLRDIK+VFGTEV+LKP D+++SDD+IATIKG+GFTNT+K
Sbjct: 305 KEDIGRLRIKKEQIDEKFIWLLRDIKQVFGTEVYLKPTDEIDSDDLIATIKGIGFTNTSK 364

Query: 362 KIA 364
           KIA
Sbjct: 365 KIA 367

>KLLA0C05984g 528906..530000 highly similar to sp|Q08096
           Saccharomyces cerevisiae YOL010w RCL1 singleton, start
           by similarity
          Length = 364

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/363 (77%), Positives = 320/363 (88%), Gaps = 1/363 (0%)

Query: 2   SSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNGS 61
           SS  Y+TF+GS+NFRLR++++TLSGK+IKIEKIRS DLNPGLKDYEVSFLRLME+VTNGS
Sbjct: 3   SSSRYVTFEGSRNFRLRVVMATLSGKAIKIEKIRSDDLNPGLKDYEVSFLRLMEAVTNGS 62

Query: 62  VIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGITA 121
            IEISYTGTT+++RPGII+GG++TH CP SKPVGYF EPMLYLAP           GIT+
Sbjct: 63  SIEISYTGTTVIFRPGIITGGSYTHQCPNSKPVGYFAEPMLYLAPFSKKKFSILFRGITS 122

Query: 122 SHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHEL 181
           SH+DAGI+AIKWGL+PI+EKFG RECALHTLKRGSPP GGGEVHLVVDSLIAQPITMH L
Sbjct: 123 SHNDAGIDAIKWGLMPIMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHAL 182

Query: 182 ERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWGI 241
           ++  I+++RGV+YSTRVSPS+VNRMID AKKVL   SC V ITADVWRGENSGKSPGWG+
Sbjct: 183 DKTMISSIRGVSYSTRVSPSLVNRMIDGAKKVLKSASCEVNITADVWRGENSGKSPGWGL 242

Query: 242 TLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVIG 301
           TLVA++K+GW  FSEAIGDAGDVPEDIG  VAY LLEEIS S  VGRNQL L I+YM+IG
Sbjct: 243 TLVAENKQGWRIFSEAIGDAGDVPEDIGASVAYHLLEEISKSGVVGRNQLPLTILYMIIG 302

Query: 302 KEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTNK 361
           KEDIGRLRITKDQIDE F++LLRDIKKVFGTE+ LKPVDD N+ D+IATIKG+GFTNTNK
Sbjct: 303 KEDIGRLRITKDQIDERFVWLLRDIKKVFGTEILLKPVDD-NTTDLIATIKGIGFTNTNK 361

Query: 362 KIA 364
           KIA
Sbjct: 362 KIA 364

>Kwal_56.22502
          Length = 364

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/364 (76%), Positives = 319/364 (87%)

Query: 1   MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60
           MSS    +FQG +NFRL I+L+TLSGK IKIEKIRS DLNPGL+D+EVSFLRLME+VTNG
Sbjct: 1   MSSMRINSFQGVRNFRLLIVLATLSGKPIKIEKIRSDDLNPGLRDHEVSFLRLMEAVTNG 60

Query: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGIT 120
           S IEISYTGTT++Y+PGII GG++THNCPP KPVGY+VEPMLYLAP           G+T
Sbjct: 61  STIEISYTGTTVIYKPGIIIGGSYTHNCPPGKPVGYYVEPMLYLAPFSKKKFSIIFRGVT 120

Query: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180
           ASH+DAGIEAIKWGL+P++EKFG RECALHTLKRG+PP GGGEVHLVVDSLIAQPITMH 
Sbjct: 121 ASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHA 180

Query: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240
           L+ P IA++RGVAYSTRVSPSMVNRMI+ A+ VL  + C V+ITADVWRGENSGKSPGWG
Sbjct: 181 LDTPQIASIRGVAYSTRVSPSMVNRMIEGARNVLKNVGCEVDITADVWRGENSGKSPGWG 240

Query: 241 ITLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI 300
           ITLVA++KKGW YFSE IG AGDVPEDIG  +AY LLEEIS SA VGRNQLALAI+YMVI
Sbjct: 241 ITLVAETKKGWKYFSEGIGGAGDVPEDIGAQIAYELLEEISTSAVVGRNQLALAIIYMVI 300

Query: 301 GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTN 360
           GKEDIGRLRITK QIDE FI+LLR IK++FGTEVFLKPVDD +SDD+IAT+KG+GF+NTN
Sbjct: 301 GKEDIGRLRITKAQIDEKFIWLLRHIKQIFGTEVFLKPVDDADSDDLIATVKGIGFSNTN 360

Query: 361 KKIA 364
           KK+A
Sbjct: 361 KKMA 364

>ACL015W [1034] [Homologous to ScYOL010W (RCL1) - SH]
           complement(332683..333771) [1089 bp, 362 aa]
          Length = 362

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/364 (73%), Positives = 313/364 (85%), Gaps = 2/364 (0%)

Query: 1   MSSKPYITFQGSQNFRLRIILSTLSGKSIKIEKIRSTDLNPGLKDYEVSFLRLMESVTNG 60
           MSSK Y+TF+G+ NFR RI+++TLSGK++KIEKIRS D+NPGL+D+EVSFLRL+E+VTNG
Sbjct: 1   MSSK-YVTFRGATNFRHRIVMATLSGKAVKIEKIRSEDMNPGLRDHEVSFLRLIEAVTNG 59

Query: 61  SVIEISYTGTTILYRPGIISGGAHTHNCPPSKPVGYFVEPMLYLAPXXXXXXXXXXXGIT 120
           SVIEISYTGTT++YRPGII GG+HTHNCP  K VGY+VEP+LYLAP           G+T
Sbjct: 60  SVIEISYTGTTVIYRPGIIVGGSHTHNCPNGKAVGYYVEPLLYLAPFSKKKFSIILRGVT 119

Query: 121 ASHSDAGIEAIKWGLLPILEKFGCRECALHTLKRGSPPNGGGEVHLVVDSLIAQPITMHE 180
           ++H DAGIEAIKWGL+P++EKFG RECALHTLKRG+PP GGGEVHLVVDSLIAQPITMH 
Sbjct: 120 STHQDAGIEAIKWGLMPVMEKFGVRECALHTLKRGAPPLGGGEVHLVVDSLIAQPITMHA 179

Query: 181 LERPTIATVRGVAYSTRVSPSMVNRMIDSAKKVLNKLSCPVEITADVWRGENSGKSPGWG 240
           LERP I+ +RGVAYSTRVSPSMVNRMID AK VL ++ C   ITADVWRG NSGKSPGWG
Sbjct: 180 LERPLISAIRGVAYSTRVSPSMVNRMIDGAKSVLKQVPCEANITADVWRGANSGKSPGWG 239

Query: 241 ITLVAQSKKGWCYFSEAIGDAGDVPEDIGQLVAYRLLEEISMSAAVGRNQLALAIVYMVI 300
           ITLVA++KKGW YF+EAIGDAG+VPEDIG   AY LLEEIS SA V R+QL LAIVYMVI
Sbjct: 240 ITLVAETKKGWRYFTEAIGDAGEVPEDIGNKAAYNLLEEISRSAVVCRSQLPLAIVYMVI 299

Query: 301 GKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFLKPVDDLNSDDMIATIKGVGFTNTN 360
           GKEDIGRLRI + Q+DE+ + LLRDIK++FGTE  LKP DD ++DD+I TIKG+GFTNT+
Sbjct: 300 GKEDIGRLRIARAQVDESLVLLLRDIKELFGTEALLKPADD-DTDDLIVTIKGIGFTNTS 358

Query: 361 KKIA 364
           KKIA
Sbjct: 359 KKIA 362

>Kwal_56.23201
          Length = 279

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 272 VAYRLLEEISMSAAVGRNQLALAIVYMVIGKEDIGRLRITKDQIDENFIYLLRDIKKVFG 331
           V+ + L+E   S AVGR + + A VY+V G    G + +   Q+++ F+     +K    
Sbjct: 144 VSLKTLDEFGRSVAVGRRKTSTAKVYLVRG---TGEILVNGRQLNDYFV----KMKDRES 196

Query: 332 TEVFLKPVDDLNSDDMIATIKGVGFT 357
               L+ VD +   ++ AT  G G T
Sbjct: 197 VAYPLRVVDSIGKYNVFATTSGGGIT 222

>KLLA0F21032g 1964630..1965523 highly similar to sp|Q9P4C1
           Kluyveromyces marxianus 40S ribosomal protein S9,
           mitochondrial precursor, start by similarity
          Length = 297

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 7/81 (8%)

Query: 277 LEEISMSAAVGRNQLALAIVYMVIGKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFL 336
           L+E   S A+GR + + A VY+V G+   G++ +   Q+++ F+  ++D + V      L
Sbjct: 167 LDEFGRSLAIGRRKTSTAKVYVVRGE---GKILVNDRQLNDYFV-KMKDRESVMYP---L 219

Query: 337 KPVDDLNSDDMIATIKGVGFT 357
           K +D +   ++ A + G G T
Sbjct: 220 KAIDSVGKYNVFAMVSGGGIT 240

>CAGL0L06732g complement(757868..758734) similar to sp|P38120
           Saccharomyces cerevisiae YBR146w MRPS9, hypothetical
           start
          Length = 288

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 277 LEEISMSAAVGRNQLALAIVYMVIGKEDIGRLRITKDQIDENFIYLLRDIKKVFGTEVFL 336
           L+E   S A+G+ + A A VY+V G+   G++ +   Q+++ F+     +K        L
Sbjct: 158 LDEFGRSVAIGKRKAATAKVYLVRGE---GKILVNGRQLNDYFL----KMKDRESIAYPL 210

Query: 337 KPVDDLNSDDMIATIKGVGFT 357
           + VD L   ++ AT +G G T
Sbjct: 211 QVVDSLGKYNVFATCRGGGPT 231

>Scas_633.1
          Length = 287

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 274 YRLLEEISMSAAVGRNQLALAIVYMVIGKEDIGRLRITKDQIDENFIYLLRDIKKVFGTE 333
           ++ L+E   S AVG  + A A VY+V G    G + +   Q+++ F+  L+D   +    
Sbjct: 154 FKTLDEFGRSVAVGHRKSAAAKVYVVRG---TGEILVNGRQLNDYFLK-LKDRDSIMYPL 209

Query: 334 VFLKPVDDLNSDDMIATIKGVGFT 357
             L  V D N   + AT  G G T
Sbjct: 210 RVLNAVGDYN---IFATTSGGGST 230

>Scas_688.4
          Length = 860

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 14/77 (18%)

Query: 7   ITFQGSQNFRLRI--------ILSTLSGK--SIKIEKIRSTDLNPGLKDYEVSFL----R 52
            TF+GS N +LRI         L+TL  K   +KIE+  ++D+N   K   V F+     
Sbjct: 31  FTFEGSANIKLRINDPTIDVLTLNTLEIKYHEVKIEETPASDINVDDKAQTVQFIFPKGT 90

Query: 53  LMESVTNGSVIEISYTG 69
           + +  T   +++  +TG
Sbjct: 91  IAQQGTEEFILQTKFTG 107

>KLLA0F01342g 124864..126273 similar to sp|P38348 Saccharomyces
           cerevisiae YBR272c HSM3 mismatch repair protein
           singleton, start by similarity
          Length = 469

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 188 TVRGVAYSTRVSPSMVNRMIDSAKKVLNKLS 218
           T  G+ + TR  PS++N +IDS  +V  KLS
Sbjct: 388 TSYGIQHLTRNMPSVMNSIIDSGNQVTEKLS 418

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,148,604
Number of extensions: 451860
Number of successful extensions: 1054
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1066
Number of HSP's successfully gapped: 15
Length of query: 364
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 261
Effective length of database: 13,030,455
Effective search space: 3400948755
Effective search space used: 3400948755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)