Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_644.870470436290.0
YOL011W (PLB3)68661623360.0
Scas_611.164659521160.0
CAGL0E02321g70461120680.0
YMR008C (PLB1)66460320430.0
CAGL0J11770g65960520280.0
Sklu_1900.165859019130.0
Kwal_56.2251064159618780.0
KLLA0C05940g64058118390.0
YMR006C (PLB2)70658218190.0
Scas_685.367759318140.0
CAGL0J11748g69557816560.0
Scas_92.0d2362307308e-92
Sklu_2442.195844345371e-59
AAL027W5924125343e-59
Kwal_0.1735074195181e-57
YNL012W (SPO1)6313994539e-48
KLLA0F12232g6804134504e-47
CAGL0H03575g5144014116e-43
Scas_695.105533824111e-42
Kwal_56.24139463134790.21
Scas_690.1*636104760.57
YPL217C (BMS1)1183104721.5
KLLA0B02068g1167104702.7
CAGL0F02541g63057668.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_644.8
         (704 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_644.8                                                           1402   0.0  
YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B (ly...   904   0.0  
Scas_611.1                                                            819   0.0  
CAGL0E02321g 222466..224580 some similarities with sp|Q08108 Sac...   801   0.0  
YMR008C (PLB1) [3972] chr13 complement(280590..282584) Phospholi...   791   0.0  
CAGL0J11770g complement(1145135..1147114) highly similar to sp|P...   785   0.0  
Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement        741   0.0  
Kwal_56.22510                                                         728   0.0  
KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromy...   712   0.0  
YMR006C (PLB2) [3971] chr13 complement(277561..279681) Phospholi...   705   0.0  
Scas_685.3                                                            703   0.0  
CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674 S...   642   0.0  
Scas_92.0d                                                            285   8e-92
Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement     211   1e-59
AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH] complement(2...   210   3e-59
Kwal_0.173                                                            204   1e-57
YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663) Meio...   179   9e-48
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...   177   4e-47
CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces c...   162   6e-43
Scas_695.10                                                           162   1e-42
Kwal_56.24139                                                          35   0.21 
Scas_690.1*                                                            34   0.57 
YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein i...    32   1.5  
KLLA0B02068g complement(179493..182996) similar to sgd|S0006138 ...    32   2.7  
CAGL0F02541g 248281..250173 similar to sp|Q04177 Saccharomyces c...    30   8.0  

>Scas_644.8
          Length = 704

 Score = 1402 bits (3629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/704 (96%), Positives = 678/704 (96%)

Query: 1   MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN 60
           MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN
Sbjct: 1   MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN 60

Query: 61  ESLWLQKRMQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGG 120
           ESLWLQKRMQNTREPLLQF             FDTAALLSSLMGSDSASQPKIGIAVSGG
Sbjct: 61  ESLWLQKRMQNTREPLLQFLNRSLTSLNTSSSFDTAALLSSLMGSDSASQPKIGIAVSGG 120

Query: 121 GYRSMLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQS 180
           GYRSMLTGAGILAAMDNRTRGAQHH      QSTTYLSGASGGNWLVGTLAYNNWTSVQS
Sbjct: 121 GYRSMLTGAGILAAMDNRTRGAQHHGLGGLLQSTTYLSGASGGNWLVGTLAYNNWTSVQS 180

Query: 181 IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL 240
           IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL
Sbjct: 181 IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL 240

Query: 241 SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF 300
           SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF
Sbjct: 241 SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF 300

Query: 301 EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS 360
           EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS
Sbjct: 301 EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS 360

Query: 361 TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG 420
           TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG
Sbjct: 361 TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG 420

Query: 421 GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY 480
           GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY
Sbjct: 421 GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY 480

Query: 481 VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE 540
           VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE
Sbjct: 481 VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE 540

Query: 541 QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT 600
           QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT
Sbjct: 541 QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT 600

Query: 601 LDTTPLPDNKKDIHNSFINVGVNRTDANAKSDPYVQLHHHDEYSEAVEQAQETDTVQASD 660
           LDTTPLPDNKKDIHNSFINVGVNRTDANAKSDPYVQLHHHDEYSEAVEQAQETDTVQASD
Sbjct: 601 LDTTPLPDNKKDIHNSFINVGVNRTDANAKSDPYVQLHHHDEYSEAVEQAQETDTVQASD 660

Query: 661 LPHSYQKKDSHXXXXXXXMPGGPIINIKVIMALLCLITFMVGFI 704
           LPHSYQKKDSH       MPGGPIINIKVIMALLCLITFMVGFI
Sbjct: 661 LPHSYQKKDSHNNNNNNNMPGGPIINIKVIMALLCLITFMVGFI 704

>YOL011W (PLB3) [4805] chr15 (305349..307409) Phospholipase B
           (lysophospholipase) [2061 bp, 686 aa]
          Length = 686

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/616 (68%), Positives = 502/616 (81%), Gaps = 16/616 (2%)

Query: 6   LYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWL 65
           +  +++ I      A AW+P++SY P  + C         +D +L+REA SIS NES WL
Sbjct: 10  IISYIFAISQFLLAANAWSPTDSYVPGTVSCP--------DDINLVREATSISQNESAWL 61

Query: 66  QKRMQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMG-SDSASQPKIGIAVSGGGYRS 124
           +KR + T   L  F              D++ +LS L    +S + PKI +AVSGGGYRS
Sbjct: 62  EKRNKVTSVALKDFLTRATANFS-----DSSEVLSKLFNDGNSENLPKIAVAVSGGGYRS 116

Query: 125 MLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDN 184
           MLTGAG+LAAMDNRT GA  H      QSTTYLSGASGGNWLVGTLA NNWTSVQ I++N
Sbjct: 117 MLTGAGVLAAMDNRTEGAYEHGLGGLLQSTTYLSGASGGNWLVGTLALNNWTSVQDILNN 176

Query: 185 FNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKF 244
               DSIWDLS+SIV+PGG NIFK+A+RWDHIS+A++ KQ A ++TSLAD+WGRAL+Y F
Sbjct: 177 MQNDDSIWDLSDSIVTPGGINIFKTAKRWDHISNAVESKQNADYNTSLADIWGRALAYNF 236

Query: 245 FPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGS 304
           FPSL RGG+  TWSS+RD PVF   +MPFPISVADGRYPG+KV+NLNATVFEFNPFEMGS
Sbjct: 237 FPSLNRGGIGLTWSSIRDFPVFQNAEMPFPISVADGRYPGTKVINLNATVFEFNPFEMGS 296

Query: 305 WDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLH 364
           WDPSLN+F +VK+LGTNVS G P++  +C  GFDN  FIMGTSSTLFNQFLLRINST  H
Sbjct: 297 WDPSLNSFANVKYLGTNVSNGVPLERGKCTAGFDNAGFIMGTSSTLFNQFLLRINST--H 354

Query: 365 LPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDD 424
           LP FIT+LA HFLKD+SQDFND+A Y PNPFKD  F+D++YT SIV+S SL+LVDGGEDD
Sbjct: 355 LPSFITRLARHFLKDLSQDFNDIAVYSPNPFKDTKFLDSDYTTSIVDSDSLFLVDGGEDD 414

Query: 425 ENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGT 484
           EN+P+LPLIQ+ERD+DI+FA+DNS DM+LAWPDGSSLVHT+ERQFV+QGQGM+FPYVP T
Sbjct: 415 ENVPVLPLIQKERDVDIIFAVDNSADMRLAWPDGSSLVHTYERQFVKQGQGMSFPYVPDT 474

Query: 485 DTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRA 544
           +TFVNLGLN+KPTFFGCDA+NLTDL+YIPPLV+YLPN +YSF SNQSAFKLSY+E QRR+
Sbjct: 475 NTFVNLGLNKKPTFFGCDANNLTDLQYIPPLVVYLPNAEYSFNSNQSAFKLSYSESQRRS 534

Query: 545 MISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTT 604
           MI NGFEIATRNNFTDDP+F+GC+GCAIIRRKQQ+LN+TLP  C TCF NYCWNGTLDTT
Sbjct: 535 MIQNGFEIATRNNFTDDPEFMGCVGCAIIRRKQQALNITLPPECETCFKNYCWNGTLDTT 594

Query: 605 PLPDNKKDIHNSFINV 620
           PLPD +KD+H+SFINV
Sbjct: 595 PLPDVEKDVHHSFINV 610

>Scas_611.1
          Length = 646

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/595 (64%), Positives = 464/595 (77%), Gaps = 16/595 (2%)

Query: 14  VSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTR 73
            +LS    AW+PSNSY P+ + C        +++ +LIREA+S+S +E  WL KR   T 
Sbjct: 12  ATLSLQVGAWSPSNSYVPANVTC--------DDNINLIREANSLSDDEKSWLTKRDAITS 63

Query: 74  EPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILA 133
           E L  F             F   +L+S L   +S+S P+IG+A SGGGYR+ML+GAG++A
Sbjct: 64  EALESFLKRSTSN------FSDTSLISQLFSGNSSSAPRIGVACSGGGYRAMLSGAGMVA 117

Query: 134 AMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWD 193
           AMDNRT GA  H      Q  TYL+G SGGNWL  TL +NNWTSVQ+I++N    DSIWD
Sbjct: 118 AMDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLGWNNWTSVQAILNNMTNDDSIWD 177

Query: 194 LSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGV 253
           +S SI++PGG NI ++  RWDHISDA+Q KQ AGF+ SLADVWGRALSY FFPSLYRGG 
Sbjct: 178 ISHSIINPGGWNILETGERWDHISDAVQAKQDAGFNISLADVWGRALSYNFFPSLYRGGQ 237

Query: 254 AYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFT 313
            YTWS+LRD+ VF   +MPFPISVADGRYPG+ V+NLNATVFEFNPFEMGSWDP+LNTFT
Sbjct: 238 GYTWSTLRDADVFKNAEMPFPISVADGRYPGTTVINLNATVFEFNPFEMGSWDPTLNTFT 297

Query: 314 DVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLA 373
           DVK+LGTNVS GKPI   +C+ GFDNT FI GTSSTLFNQFLL INST+  LP FITKLA
Sbjct: 298 DVKYLGTNVSNGKPITEGKCIAGFDNTGFITGTSSTLFNQFLLHINSTS--LPSFITKLA 355

Query: 374 THFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLI 433
           +HFL D+S D+ND+A Y PNPF+DA+FI +NY+KSIV SK L+LVDGGED++NIPL+PL+
Sbjct: 356 SHFLNDLSADYNDIAIYSPNPFRDADFIASNYSKSIVQSKDLFLVDGGEDNQNIPLVPLL 415

Query: 434 QRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLN 493
           Q+ER+LD++FA+DNS D   +WPDG+SLV+T+ERQF  QG GMAFPYVP  +TFVNLGLN
Sbjct: 416 QKERELDVIFALDNSADTNQSWPDGASLVNTYERQFGMQGNGMAFPYVPDKNTFVNLGLN 475

Query: 494 QKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIA 553
           ++PTFFGCDA NLTDLEYIPPLV+Y+PN ++SF  NQS FK+SY+  +R +MI NGFE A
Sbjct: 476 KRPTFFGCDARNLTDLEYIPPLVVYIPNARHSFNGNQSTFKMSYSTSERFSMIQNGFESA 535

Query: 554 TRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTPLPD 608
           TR NFTDD DFLGCIGCAI+RRKQQS+N TLP  CN CFTNYCWNGT+D TP  D
Sbjct: 536 TRGNFTDDSDFLGCIGCAIMRRKQQSMNATLPTECNQCFTNYCWNGTIDNTPAKD 590

>CAGL0E02321g 222466..224580 some similarities with sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3 phospholipase B,
           hypothetical start
          Length = 704

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/611 (62%), Positives = 473/611 (77%), Gaps = 29/611 (4%)

Query: 22  AWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFXX 81
            ++ ++ YAP    C        ++D +L+REA  +S NE+ WLQ+R   T+E L  F  
Sbjct: 19  GYSVADQYAPKLAYCP-------SDDINLVREASGLSQNETQWLQRRDVRTKEALHNFLQ 71

Query: 82  XXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRG 141
                       +   L   +   D+   P+IGIAVSGGGYRSMLTGAGIL+A DNRTRG
Sbjct: 72  RATSSSQ-----NFTQLFHRIF--DAGMVPRIGIAVSGGGYRSMLTGAGILSAFDNRTRG 124

Query: 142 AQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIID-NFNES----------DS 190
           A  H      QSTTY++G SGGNWLV +L++NNWTSVQ I+D N++            D 
Sbjct: 125 AMDHGLGGILQSTTYMTGCSGGNWLVASLSWNNWTSVQDILDMNYDRKTARKQGKITKDP 184

Query: 191 IWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYR 250
           IWDLS+SIVSPGG NI K+ARRWDHI++A++ KQ+AGF+TSLADVWGRALSYKFFP+L R
Sbjct: 185 IWDLSDSIVSPGGLNIIKTARRWDHITNAVKAKQEAGFNTSLADVWGRALSYKFFPTLER 244

Query: 251 GGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLN 310
           GG+ YTWSSLRDSP+F  G MP PI+VADGRYPGS  + LNATVFEFNPFEMGSWDPSLN
Sbjct: 245 GGIDYTWSSLRDSPIFQAGDMPLPITVADGRYPGSNAIALNATVFEFNPFEMGSWDPSLN 304

Query: 311 TFTDVKFLGTNVSAGKPI--DSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGF 368
            FTDVK+LGTNV+ GKP+   +++C++GFDNTAFIMGTSS LFNQFLLRINST  HLP F
Sbjct: 305 AFTDVKYLGTNVTNGKPVAHTAKKCIEGFDNTAFIMGTSSNLFNQFLLRINST--HLPNF 362

Query: 369 ITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIP 428
           +TK AT+ LK  + +FNDVA Y+PNPFKD  ++  N++ SIV+S+ LYLVDGGEDDEN+P
Sbjct: 363 VTKWATNLLKSWAHEFNDVAVYNPNPFKDTRYVMENFSTSIVDSEHLYLVDGGEDDENVP 422

Query: 429 LLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFV 488
           L+PL+QR+RDLDI+FAIDNS D KL WPDGSSLVHT+ERQFV QGQ +AFP++P T+TF+
Sbjct: 423 LIPLLQRDRDLDIIFAIDNSADNKLQWPDGSSLVHTYERQFVLQGQKIAFPHIPDTNTFI 482

Query: 489 NLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISN 548
           NLGLN++PTFFGC+A N+T L+YIPPLV+Y PN +YSF SNQSAFKLSY+ +Q   MISN
Sbjct: 483 NLGLNKRPTFFGCNATNMTSLKYIPPLVVYYPNSEYSFNSNQSAFKLSYSRDQMANMISN 542

Query: 549 GFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTPLPD 608
           GFEIATRNNFTDDP+F+GCI CAI++RKQ++L+L LP  C  C   YCW+GT+D TPL +
Sbjct: 543 GFEIATRNNFTDDPEFIGCIACAIMKRKQEALDLELPSECERCLARYCWDGTVDDTPLDE 602

Query: 609 NKKDIHNSFIN 619
            K+D+H+SFIN
Sbjct: 603 LKQDVHHSFIN 613

>YMR008C (PLB1) [3972] chr13 complement(280590..282584)
           Phospholipase B, preferentially deacylates
           phosphatidylcholine and phosphatidylethanolamine [1995
           bp, 664 aa]
          Length = 664

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/603 (61%), Positives = 465/603 (77%), Gaps = 16/603 (2%)

Query: 1   MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN 60
           M L  L     ++ SL+    AW+P+NSY P+ + C        ++D +L+REA  +S N
Sbjct: 1   MKLQSLLVSAAVLTSLTENVNAWSPNNSYVPANVTC--------DDDINLVREASGLSDN 52

Query: 61  ESLWLQKRMQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGG 120
           E+ WL+KR   T+E L  F             F   +LLS+L GS+S++ PKI +A SGG
Sbjct: 53  ETEWLKKRDAYTKEALHSFLNRATSN------FSDTSLLSTLFGSNSSNMPKIAVACSGG 106

Query: 121 GYRSMLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQS 180
           GYR+ML+GAG+LAAMDNRT GA  H      Q  TYL+G SGGNWL  TLA+NNWTSVQ+
Sbjct: 107 GYRAMLSGAGMLAAMDNRTDGANEHGLGGLLQGATYLAGLSGGNWLTSTLAWNNWTSVQA 166

Query: 181 IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL 240
           I+DN  ES+SIWD+S SI++P G NIFK+  RWD ISD +QDK+ AGF+ SLADVWGRAL
Sbjct: 167 IVDNTTESNSIWDISHSILTPDGINIFKTGSRWDDISDDVQDKKDAGFNISLADVWGRAL 226

Query: 241 SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF 300
           +Y F+PSL+RGGV YTWS+LR++ VF  G+MPFPI+VADGRYPG+ V+NLNAT+FEFNPF
Sbjct: 227 AYNFWPSLHRGGVGYTWSTLREADVFKNGEMPFPITVADGRYPGTTVINLNATLFEFNPF 286

Query: 301 EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS 360
           EMGSWDP+LN FTDVK+LGTNV+ GKP++  +C+ GFDNT FI  TSSTLFNQFLLR+NS
Sbjct: 287 EMGSWDPTLNAFTDVKYLGTNVTNGKPVNKGQCIAGFDNTGFITATSSTLFNQFLLRLNS 346

Query: 361 TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG 420
           T+  LP FI  LAT FL+D+S + +D+A Y PNPFK+ANF+  N T SI+ S+ L+LVDG
Sbjct: 347 TD--LPSFIANLATDFLEDLSDNSDDIAIYAPNPFKEANFLQKNATSSIIESEYLFLVDG 404

Query: 421 GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY 480
           GED++NIPL+PL+Q+ER+LD++FA+DNS D    WPDG+SLV+T++RQF  QG  ++FPY
Sbjct: 405 GEDNQNIPLVPLLQKERELDVIFALDNSADTDDYWPDGASLVNTYQRQFGSQGLNLSFPY 464

Query: 481 VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE 540
           VP  +TFVNLGLN+KPTFFGCDA NLTDLEYIPPL++Y+PN ++SF  NQS FK+SY++ 
Sbjct: 465 VPDVNTFVNLGLNKKPTFFGCDARNLTDLEYIPPLIVYIPNSRHSFNGNQSTFKMSYSDS 524

Query: 541 QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT 600
           +R  MI NGFE AT  NFTDD DFLGC+GCAIIRRKQQ+LN TLP  C+ CFTNYCWNGT
Sbjct: 525 ERLGMIKNGFEAATMGNFTDDSDFLGCVGCAIIRRKQQNLNATLPSECSQCFTNYCWNGT 584

Query: 601 LDT 603
           +D+
Sbjct: 585 IDS 587

>CAGL0J11770g complement(1145135..1147114) highly similar to
           sp|P39105 Saccharomyces cerevisiae YMR008c PLB1 or
           sp|Q08108 Saccharomyces cerevisiae YOL011w PLB3 or
           sp|Q03674 Saccharomyces cerevisiae YMR006c PLB2, start
           by similarity
          Length = 659

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/605 (60%), Positives = 463/605 (76%), Gaps = 12/605 (1%)

Query: 1   MILIPLYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHN 60
           M L  L   V ++ + +    AW+P+NSY P+ + C          D +L+R A  +S +
Sbjct: 1   MQLQDLVVTVSLLAAFNGGVEAWSPTNSYVPANVTCPN--------DINLLRNATGLSQS 52

Query: 61  ESLWLQKRMQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGG 120
           E  WL+KR  NTRE L  F                + L+  L  ++S++ PKIGIA SGG
Sbjct: 53  EIDWLKKRDVNTREALESFLKRVTSNFTSNSS--ASNLIDQLFSTNSSNIPKIGIAASGG 110

Query: 121 GYRSMLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQS 180
           GYR+ML+GAG+++AMDNRT GA  H      Q+ TYL+G SGGNWL  TL++NNWTSVQ 
Sbjct: 111 GYRAMLSGAGMVSAMDNRTDGANEHGLGGLLQAATYLAGLSGGNWLTTTLSWNNWTSVQD 170

Query: 181 IIDNFNESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRAL 240
           I+D+ +   +IWD+S SIVSPGG NIFK+  RWDHISDA++DKQKAGF+ SLADVWGRAL
Sbjct: 171 IVDSQDNDSAIWDISHSIVSPGGINIFKTGSRWDHISDAVEDKQKAGFNVSLADVWGRAL 230

Query: 241 SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPF 300
           SY+FFP+LYRGGVAY WS LR+S VF   +MP PISVADGRYPG+ V++LN+TVFE++PF
Sbjct: 231 SYQFFPTLYRGGVAYLWSDLRESDVFKNAEMPMPISVADGRYPGTAVIDLNSTVFEYSPF 290

Query: 301 EMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINS 360
           E+GSWDPSL+ FTDV++LGT VS GKP +  +C+ GFDN  F+MGTSSTLFNQFLLRIN 
Sbjct: 291 ELGSWDPSLSAFTDVQYLGTKVSDGKPAEEGKCIAGFDNVGFLMGTSSTLFNQFLLRIND 350

Query: 361 TNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDG 420
           T+  +P FI  LATHFLKD+S+D++D+A Y PNPF+DA++++ N +KS+  S+ L+LVDG
Sbjct: 351 TS--IPKFIRNLATHFLKDLSEDYDDIAVYAPNPFRDADYVNNNRSKSLSESEYLFLVDG 408

Query: 421 GEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY 480
           GED +N+PL+PLIQ+ERDLDIVFA+DNS D +  WPDG+SL+HT+ RQF  QGQG+ FP 
Sbjct: 409 GEDGQNVPLVPLIQQERDLDIVFALDNSADTEENWPDGASLMHTYRRQFGFQGQGVTFPS 468

Query: 481 VPGTDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEE 540
           VPGTDTFVNLGLN+KPTFFGCDA N+TDLEYIPPL++Y+PN ++S+  N S FKLSY+E+
Sbjct: 469 VPGTDTFVNLGLNKKPTFFGCDARNMTDLEYIPPLIVYIPNSRHSYNGNTSTFKLSYSEK 528

Query: 541 QRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGT 600
           +R  +I NGFE AT NN T D +F GCIGCAI+RRKQQ+LNLTLP+ C TCFTNYCWNGT
Sbjct: 529 ERLGVIRNGFEAATMNNLTADSNFAGCIGCAIMRRKQQALNLTLPKECETCFTNYCWNGT 588

Query: 601 LDTTP 605
           +D TP
Sbjct: 589 IDNTP 593

>Sklu_1900.1 YMR008C, Contig c1900 2946-4922 reverse complement
          Length = 658

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/590 (59%), Positives = 433/590 (73%), Gaps = 20/590 (3%)

Query: 13  IVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNT 72
           +V L  T  AW+P+NSY P  + C        ++D +L+REA  +S +ES WL+KR   T
Sbjct: 7   LVFLLSTVGAWSPTNSYTPGNVTC--------DDDINLVREAVGLSTDESEWLKKREVYT 58

Query: 73  REPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGIL 132
              L  F             F   +++ +L  S SA  P+IG+A SGGGYR+ML+GAG+L
Sbjct: 59  NSALEDFLNRATEN------FTDNSIVKTLFNSSSA--PRIGVACSGGGYRAMLSGAGML 110

Query: 133 AAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIW 192
           AAMDNRTRG+  H      QSTTYL+G SGGNWLVGTLA+NNWTSVQ I+D   + D IW
Sbjct: 111 AAMDNRTRGSVEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQHILDTMGQDDDIW 170

Query: 193 DLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGG 252
           D+S SI+SPGG N+ ++  RWD ISDA+  KQ AGF+ SL DVWGRALSY FFP+L  GG
Sbjct: 171 DISNSIISPGGTNVLETTSRWDDISDAVDAKQDAGFNASLTDVWGRALSYDFFPTLPNGG 230

Query: 253 VAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTF 312
            AYTWS+LR++ VF   +MPFPISVADGRYPG++V+NLNATVFEFNPFEMGSWD SL  F
Sbjct: 231 DAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNATVFEFNPFEMGSWDRSLRAF 290

Query: 313 TDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINST----NLHLPGF 368
           T+VK+LGT V+ G P    +C+ GFDNT FIMGTSS+LFNQF L+ NST    N  LP +
Sbjct: 291 TNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQFSLQSNSTLMLLNASLPSY 350

Query: 369 ITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIP 428
           + K A  FL  +S+D++D+A Y PNPFK  N++  NYT+SIV S+ LYLVDGGED +NIP
Sbjct: 351 LYKFANKFLTGLSKDYDDIALYAPNPFKGTNYVFENYTRSIVESEILYLVDGGEDGQNIP 410

Query: 429 LLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFV 488
           L+PL+Q ER+LD++FA+DNS D    WP+G SL  T+ERQF +QG  +AFPYVP   TFV
Sbjct: 411 LIPLLQEERELDVIFALDNSADTNQYWPNGFSLTQTYERQFEKQGDDIAFPYVPDVSTFV 470

Query: 489 NLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISN 548
            LGLN++PTFFGCDA NLTDL+YIPPLV+Y+PN + SF SNQS FKLSY+ E RRAMI N
Sbjct: 471 ELGLNKRPTFFGCDATNLTDLDYIPPLVVYMPNTKESFNSNQSTFKLSYSSENRRAMIKN 530

Query: 549 GFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWN 598
           GFE  TRNN TDD DF+ C+ CA+IRRKQQS+N TLPE C  CFTNYCWN
Sbjct: 531 GFEAVTRNNLTDDSDFVSCVACAVIRRKQQSMNATLPEECEKCFTNYCWN 580

>Kwal_56.22510
          Length = 641

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/596 (57%), Positives = 439/596 (73%), Gaps = 23/596 (3%)

Query: 6   LYCFVYIIVSLSHTAYAWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWL 65
           L+    ++ ++S    AW+P++SY P  + C         +D +L+R+A S+S NE+ WL
Sbjct: 2   LWILSLLLAAIS-AVQAWSPTDSYVPGNVSCA--------DDINLVRKASSLSPNETEWL 52

Query: 66  QKRMQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSM 125
           +KR   T+E L  F             F  ++L+ ++    S   P+I +A SGGGYR+M
Sbjct: 53  KKRDAYTKEALRTFLDRATSN------FSNSSLVDNVW--KSGKIPRIAVACSGGGYRAM 104

Query: 126 LTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNF 185
           L+GAG+L+AMDNRT GA  H      QSTTYL+G SGGNWLVG+LA+NNWTSVQ IID  
Sbjct: 105 LSGAGMLSAMDNRTNGATEHGLGGLLQSTTYLAGLSGGNWLVGSLAWNNWTSVQHIIDTR 164

Query: 186 NESDSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFF 245
              D +WD+S SI++PGG NI  SA RWD ISDA++ K  AGF+TSLADVWGRALSY FF
Sbjct: 165 GTDDELWDISNSILNPGGVNILTSANRWDQISDAVEAKGDAGFNTSLADVWGRALSYDFF 224

Query: 246 PSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSW 305
           P+LY+GG+ YTWS+LRD+ VF  G+MPFPISVADGRYPG+++++LN+T+FEFNPFEMGSW
Sbjct: 225 PTLYKGGLGYTWSTLRDADVFKNGEMPFPISVADGRYPGTQIIDLNSTLFEFNPFEMGSW 284

Query: 306 DPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLH- 364
           DPSLN FTDVK+LGT V  G P+   +CV GFDNT F+MGTSSTLFNQFLL++N+T++  
Sbjct: 285 DPSLNAFTDVKYLGTEVKNGTPVTQGQCVAGFDNTGFVMGTSSTLFNQFLLQLNTTSVSS 344

Query: 365 -LPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGED 423
            L GFI      FL+D+S+D ND+A Y+PNPF+D  ++D NYT  IVNS++L+LVDGGED
Sbjct: 345 FLKGFI----QDFLQDLSEDSNDIAIYNPNPFRDTAYVDKNYTHGIVNSENLFLVDGGED 400

Query: 424 DENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPG 483
            ENIPL+PLIQ++RD+D++FA+DNS D    WP G SL+HT+ERQF  QG+ +AFPYVP 
Sbjct: 401 GENIPLVPLIQQDRDVDVIFALDNSADTDEYWPAGLSLMHTYERQFGPQGKDIAFPYVPD 460

Query: 484 TDTFVNLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRR 543
            DTFVN GLN KP FFGCDA N +DL Y PPL++Y+PN + S+ SN S FK+SY+  QR 
Sbjct: 461 VDTFVNEGLNTKPVFFGCDATNTSDLAYTPPLIVYMPNNRQSYNSNTSTFKMSYSSSQRM 520

Query: 544 AMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNG 599
            M  NGFE  TRNN TDD +F+GC+ CA++RRKQ+S N+T PE C  CF NYCW+G
Sbjct: 521 KMYQNGFEAITRNNLTDDSNFMGCVACAVLRRKQESQNMTFPEECTKCFQNYCWDG 576

>KLLA0C05940g 524768..526690 gi|3169132|dbj|BAA28619.1 Kluyveromyces
           lactis phospholipase B, start by similarity
          Length = 640

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/581 (58%), Positives = 432/581 (74%), Gaps = 16/581 (2%)

Query: 22  AWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFXX 81
           AW+P+N YAP  +DC        +E+ +L+R+AD++S +E+ WL+ R ++T   L  F  
Sbjct: 25  AWSPTNGYAPGVVDC--------DENINLVRKADAVSDDEADWLKVRHESTVPALKDFLQ 76

Query: 82  XXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRG 141
                       DT+ +   L   D+A  PK+ IA SGGGYR+ML+GAG+++AMDNRT G
Sbjct: 77  RGFKGFTN----DTSIIDKLLATQDTA--PKVAIACSGGGYRAMLSGAGMISAMDNRTDG 130

Query: 142 AQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSP 201
           A  H      QS+TYL+G SGGNWLVGTLAYNNWTSVQ+II+N  + +SIWD+S SIV+P
Sbjct: 131 ANDHGLGGLLQSSTYLAGLSGGNWLVGTLAYNNWTSVQAIINNMTDDNSIWDISNSIVNP 190

Query: 202 GGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLR 261
           GG NIF S  RWD ISDA+++K+KAGF+TS+ DVWGRALSY FFPSL  GGV YTW++LR
Sbjct: 191 GGINIFSSISRWDDISDAVEEKKKAGFNTSITDVWGRALSYNFFPSLDEGGVGYTWNTLR 250

Query: 262 DSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTN 321
           D  VF  G+MPFPISVA GRYPG++V+NLNATVFEFNPFEMGSWD +L+TFTDV++ GTN
Sbjct: 251 DVDVFKNGEMPFPISVAVGRYPGTQVVNLNATVFEFNPFEMGSWDYTLHTFTDVRYAGTN 310

Query: 322 VSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDIS 381
           V+ G P  + +CV GFDNT F+MGTSS+LFNQFLL++N+T+  LP F+  L   FL D S
Sbjct: 311 VTNGTPNVTGKCVAGFDNTGFVMGTSSSLFNQFLLQLNTTD--LPSFLYNLLHGFLTDAS 368

Query: 382 QDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDI 441
            D++D++ + PNPF +   I +NY++SI    +LYLVDGGED +NIPL PL+Q ER++D+
Sbjct: 369 DDYDDISIWAPNPFYEITNIPSNYSQSISEDDTLYLVDGGEDGQNIPLTPLLQTEREIDV 428

Query: 442 VFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGC 501
           +FA+DNS D   +WPDG SL  T+ RQF  QG+G+AFPYVP  +TF NLGLN +PTFFGC
Sbjct: 429 IFALDNSADTDQSWPDGFSLTQTYARQFGLQGKGIAFPYVPDVNTFTNLGLNTRPTFFGC 488

Query: 502 DAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDD 561
           DA NLTDLE IPPLV+Y+PN + SF SN S FK+SY+  +R  MI NGFE  T  N T D
Sbjct: 489 DARNLTDLESIPPLVVYMPNTRESFNSNTSTFKMSYSTSERFKMIQNGFEAVTMKNLTKD 548

Query: 562 PDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLD 602
            +F+GCI CAI+RRKQ+SLN TLP  C+ CF  YCWNGT+D
Sbjct: 549 ENFMGCISCAILRRKQESLNYTLPSECDACFEKYCWNGTVD 589

>YMR006C (PLB2) [3971] chr13 complement(277561..279681)
           Phospholipase B2 (lysophospholipase), releases fatty
           acids from lysophospholipids [2121 bp, 706 aa]
          Length = 706

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/582 (56%), Positives = 423/582 (72%), Gaps = 15/582 (2%)

Query: 27  NSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFXXXXXXX 86
           + YAPS + C         +D SL+R A  +S  E+ WL+KR   T+E L  F       
Sbjct: 28  DGYAPSIIPCPS-------DDTSLVRNASGLSTAETDWLKKRDAYTKEALHSFLSRATSN 80

Query: 87  XXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHHX 146
                 F   +LLS+L  S+S++ PKIGIA SGGGYR+ML GAG++AAMDNRT GA  H 
Sbjct: 81  ------FSDTSLLSTLFSSNSSNVPKIGIACSGGGYRAMLGGAGMIAAMDNRTDGANEHG 134

Query: 147 XXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSPGGKNI 206
                QS+TYLSG SGGNWL GTLA+NNWTSVQ I+D+ +ESDSIW++++SIV+PGG N+
Sbjct: 135 LGGLLQSSTYLSGLSGGNWLTGTLAWNNWTSVQEIVDHMSESDSIWNITKSIVNPGGSNL 194

Query: 207 FKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDSPVF 266
             +  RW+ I   +Q K  AGF+ SL+D+W RALSY FFPSL   G A TWSSLRD  VF
Sbjct: 195 TYTIERWESIVQEVQAKSDAGFNISLSDLWARALSYNFFPSLPDAGSALTWSSLRDVDVF 254

Query: 267 TEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGK 326
             G+MP PI+VADGRYPG+ V+NLNAT+FEF PFEMGSWDPSLN FTDVK+LGTNV+ GK
Sbjct: 255 KNGEMPLPITVADGRYPGTTVINLNATLFEFTPFEMGSWDPSLNAFTDVKYLGTNVTNGK 314

Query: 327 PIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDISQDFND 386
           P++  +CV G+DN  F++ TS++LFN+F L  +++  +    I   A  ++ ++SQD +D
Sbjct: 315 PVNKDQCVSGYDNAGFVIATSASLFNEFSLEASTSTYY--KMINSFANKYVNNLSQDDDD 372

Query: 387 VATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVFAID 446
           +A Y  NPFKD  F+D NYT SIV++  L+LVDGGED +N+PL+PLI++ERDLD+VFA+D
Sbjct: 373 IAIYAANPFKDTEFVDRNYTSSIVDADDLFLVDGGEDGQNLPLVPLIKKERDLDVVFALD 432

Query: 447 NSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGCDAHNL 506
            S +   +WP G  + +T+ERQ+ +QG+GMAFPYVP  +TF+NLGL  KPTFFGCDA NL
Sbjct: 433 ISDNTDESWPSGVCMTNTYERQYSKQGKGMAFPYVPDVNTFLNLGLTNKPTFFGCDAKNL 492

Query: 507 TDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDDPDFLG 566
           TDLEYIPPLV+Y+PN ++SF  NQS  K++Y   +R  MI NGFE AT  NFTDD +FLG
Sbjct: 493 TDLEYIPPLVVYIPNTKHSFNGNQSTLKMNYNVTERLGMIRNGFEAATMGNFTDDSNFLG 552

Query: 567 CIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTPLPD 608
           CIGCAIIRRKQ+SLN TLP  C  CF +YCWNGTL T+  P+
Sbjct: 553 CIGCAIIRRKQESLNATLPPECTKCFADYCWNGTLSTSANPE 594

>Scas_685.3
          Length = 677

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/593 (57%), Positives = 430/593 (72%), Gaps = 19/593 (3%)

Query: 10  VYIIVSLSHTAY-AWAPSNSYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKR 68
           + +I ++S  A  AW+PSN YAP+ + C         +D +L+REA  +S +E  WL+KR
Sbjct: 6   LLLIAAISSNAVQAWSPSNGYAPANVTCA--------DDVNLLREASDLSKDEQDWLKKR 57

Query: 69  MQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTG 128
              T E L  F              D+++ L + +  D  + PKIGIA SGGGYR+ML G
Sbjct: 58  NTITAESLKTFLDRSTKNFS-----DSSSSLLNKLFQDGDNVPKIGIAASGGGYRAMLAG 112

Query: 129 AGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNES 188
           AG+LAAMDNRT GA  H      QS+TYL+G SGGNWL  TLA+NNWTSVQ IIDN    
Sbjct: 113 AGMLAAMDNRTSGANDHGLGGLLQSSTYLAGLSGGNWLTTTLAWNNWTSVQDIIDNITVE 172

Query: 189 DSIWDLSESIVSPGGKNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSL 248
           +SIWD+  S+ S    +   ++  W  I++ ++ KQ AGF+ +LAD+WGRAL+Y FFP L
Sbjct: 173 NSIWDIDNSLFS---ISEMANSSIWTDIANDVKAKQDAGFNVTLADLWGRALAYNFFPDL 229

Query: 249 YRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPS 308
           Y GG  YTWS+LRDS VF   +MPFPI+VADGRYPG+ V++LNATVFEFNPFEMGSWDP+
Sbjct: 230 YHGGAGYTWSTLRDSEVFKNAEMPFPITVADGRYPGTTVISLNATVFEFNPFEMGSWDPT 289

Query: 309 LNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGF 368
           LN+FTDVK+LGTNVS GKPID+ +CV GFDN  F++GTS+TLFN  L+ +  T+  LP  
Sbjct: 290 LNSFTDVKYLGTNVSNGKPIDAGQCVAGFDNAGFVLGTSATLFN--LMPLPFTSSMLPKS 347

Query: 369 ITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIP 428
           ++ L  +F   ++  +ND+A Y PNPF+DA+ + +N++K+IV+S  L+LVDGGED E IP
Sbjct: 348 LSVLGDNFTASLADTYNDIAIYSPNPFRDADSVKSNFSKAIVDSDDLFLVDGGEDGEVIP 407

Query: 429 LLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFV 488
           L+PL+Q +R LD+VFA+D + D   +WPDGSSLV T++RQF  QG+GM+FPYVP T+TF+
Sbjct: 408 LVPLLQEKRGLDVVFALDFNSDTTTSWPDGSSLVATYQRQFEDQGEGMSFPYVPDTETFI 467

Query: 489 NLGLNQKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISN 548
             GLN KPTFFGCDA NLTDLEYIPPL++Y+PN +YSF SN S  +LSY   QR  MI N
Sbjct: 468 KYGLNTKPTFFGCDAKNLTDLEYIPPLIVYIPNSRYSFNSNTSTLQLSYNSSQRLGMIQN 527

Query: 549 GFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTL 601
           GFE ATR NFTDDP+FLGCIGCAI+RRKQQSLN TLP  C  CFTNYCWNGTL
Sbjct: 528 GFESATRGNFTDDPEFLGCIGCAIMRRKQQSLNETLPSECEQCFTNYCWNGTL 580

>CAGL0J11748g complement(1141497..1143584) similar to sp|Q03674
           Saccharomyces cerevisiae YMR006c PLB2 or sp|P39105
           Saccharomyces cerevisiae YMR008c PLB1 or sp|Q08108
           Saccharomyces cerevisiae YOL011w PLB3, start by
           similarity
          Length = 695

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/578 (52%), Positives = 410/578 (70%), Gaps = 18/578 (3%)

Query: 28  SYAPSYMDCKQALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFXXXXXXXX 87
           SY P  + C        N +F +   AD +S  E  WL+KR   TR+ L  F        
Sbjct: 21  SYTPQNVSCPD------NANF-IRNAADGLSPAEKEWLKKRDPITRDALQTFLRRAFA-- 71

Query: 88  XXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHHXX 147
                 + +  ++S + +D+ + PK+GIAV+GGGYR+M  GAG  AAMDNRT GA  H  
Sbjct: 72  ------NVSTEITSALFNDTENVPKLGIAVAGGGYRAMFVGAGAFAAMDNRTDGANEHGL 125

Query: 148 XXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDNFNESDSIWDLSESIVSPGGKNIF 207
               Q+ TY++G SGGNWL GTLAYNN+TSVQ I++  +++D+IW+++ S ++P  K+  
Sbjct: 126 GGLLQAATYMAGLSGGNWLTGTLAYNNFTSVQQILEEGDKADAIWNITNSFLNPYDKDFS 185

Query: 208 KSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDSPVFT 267
           K+  RW  I   +Q K+ AGF+ ++ D+W RAL+Y +FP+L   G   TWSSLRD+ +F 
Sbjct: 186 KTLARWTAIGSQVQGKRDAGFNVTITDLWSRALAYGWFPTLPNAGAGLTWSSLRDNEIFM 245

Query: 268 EGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKP 327
            G+MP PISVADGRYPG+ V+NLNATVFE  PFE+GSWDPSLN F+D+K+LGT V+ GKP
Sbjct: 246 NGEMPMPISVADGRYPGTTVINLNATVFEMTPFEIGSWDPSLNAFSDIKYLGTQVTDGKP 305

Query: 328 IDSQRCVQGFDNTAFIMGTSSTLFNQFLLRINSTNLHLPGFITKLATHFLKDISQDFNDV 387
            +++RC+ GFD+ +FIMGTSS+LFN+F +  +S   +   ++  L++  +K I ++ ND+
Sbjct: 306 -ETERCINGFDDASFIMGTSSSLFNEFTMSNDSAVAYT--YLNTLSSTLVKGIDKENNDI 362

Query: 388 ATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVFAIDN 447
           A Y PNPFK + ++D+NYT SIV+S SL+LVDGGED + IP +PL+++ERDLDI+FAID 
Sbjct: 363 AMYAPNPFKGSKYVDSNYTTSIVDSDSLFLVDGGEDLQGIPFVPLLKQERDLDIIFAIDV 422

Query: 448 SMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGCDAHNLT 507
             +    +P G  ++ T+ERQF +QG+GMAFPYVP   TFVNLGL  KP+F+GCDA+NLT
Sbjct: 423 DTETSDNYPAGGPMMKTYERQFSKQGKGMAFPYVPDMTTFVNLGLGGKPSFYGCDANNLT 482

Query: 508 DLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDDPDFLGC 567
           DLEYIPPL++Y+PN  +SF SN S FKL+Y   +R  MI N FE  TRNN T+D D++ C
Sbjct: 483 DLEYIPPLIVYIPNSYHSFESNVSTFKLNYNYSERVGMIRNAFEATTRNNLTEDADYVTC 542

Query: 568 IGCAIIRRKQQSLNLTLPEGCNTCFTNYCWNGTLDTTP 605
           +GCAIIRRKQQSLNLTLP+ C+ CFTNYCWNGT+D TP
Sbjct: 543 VGCAIIRRKQQSLNLTLPDICDKCFTNYCWNGTIDNTP 580

>Scas_92.0d
          Length = 236

 Score =  285 bits (730), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 171/230 (74%), Gaps = 3/230 (1%)

Query: 235 VWGRALSYKFFPSL-YRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNAT 293
           ++G  L    F  L   GG AYTWS+LR++ VF   +MPFPISVADGRYPG++V+NLNAT
Sbjct: 2   MFGAVLYRMIFSQLCLNGGDAYTWSTLREADVFKNAEMPFPISVADGRYPGTQVINLNAT 61

Query: 294 VFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQ 353
           VFEFNPFEMGSWD SL  FT+VK+LGT V+ G P    +C+ GFDNT FIMGTSS+LFNQ
Sbjct: 62  VFEFNPFEMGSWDRSLRAFTNVKYLGTKVNNGTPETKGQCIAGFDNTGFIMGTSSSLFNQ 121

Query: 354 FLLRINSTNLHLPGFITKLATHFLKDISQDFNDVATYHPNPFKDANFIDANYTKSIVNSK 413
           FLL++N+T   LP FI KLA  FL  +S D++D+A Y PNPFK    +  NYT+SIV S+
Sbjct: 122 FLLQLNTTG--LPSFIYKLANKFLTGLSDDYDDIALYAPNPFKGTGHVVENYTRSIVESE 179

Query: 414 SLYLVDGGEDDENIPLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSLVH 463
            LYLVDGGED +NIPL+PL+Q ER+LD++FA+DNS D    WP+G    H
Sbjct: 180 ILYLVDGGEDGQNIPLVPLLQEERELDVIFALDNSADTNQYWPNGFEFHH 229

>Sklu_2442.19 YNL012W, Contig c2442 32274-34028 reverse complement
          Length = 584

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 144/434 (33%), Positives = 214/434 (49%), Gaps = 55/434 (12%)

Query: 204 KNIFKSARRWDHISDALQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDS 263
           KN  ++   + ++   ++ K+  GF  S  D WGRAL  K    L           L + 
Sbjct: 167 KNFRQTLEFYINLHFEVRPKKIKGFHLSFTDYWGRALMKKMSSHLSNSQSMSMSMLLENC 226

Query: 264 PVFTEGQMPFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVS 323
             F E ++PFPI V++ +   SK +     VFEF PFE GSWD  LN F  +K+LG+ + 
Sbjct: 227 RNFKEFKVPFPIIVSNCKNSPSKTV-----VFEFTPFEFGSWDEYLNEFIKLKYLGSKIV 281

Query: 324 AGKPIDSQRCVQGFDNTAFIMGTSSTLFNQFLLRI-----NSTNLHLPGFITKLAT---H 375
           +GK     RC  GFD+  FI  TSS++FN  L+ +     NS+   L      ++T    
Sbjct: 282 SGKTF---RCFNGFDDIGFISATSSSIFNNVLVYVWQMAANSSKETLKAIRAIMSTFGLR 338

Query: 376 FLKDI-SQDFN-------DVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENI 427
            +KD+ ++D         D A Y PNPF     ++   TK       LYLVDGGE+ ENI
Sbjct: 339 LVKDMGAKDVPNNPLTRPDYALYRPNPFYKLLTVNNELTKE----NHLYLVDGGENGENI 394

Query: 428 PLLPLIQRERDLDIVFAIDNSMDMKLAWPDGSSL------VHTFERQFVRQGQGMA---- 477
           P+ PL+  +R LD++FA+D+S D    +P+G+ L       H  +       +G+     
Sbjct: 395 PIRPLLLPQRKLDVIFALDSSSDSN-NYPNGTILRNLYNNFHNGQESLNITREGITSNID 453

Query: 478 -FPYVPGTDTFVNLGLNQKPTFFGCD----------AHNLTDLEYIPPLVIYLPNKQYSF 526
             PY+P + +FV   L  +P  FGC            +  T+   +PP+VIY  N  +S+
Sbjct: 454 LLPYIPNSKSFVEQQLFSRPVAFGCHLSSYHVREQYVNKTTESTNLPPIVIYYANYHHSY 513

Query: 527 PSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLT--L 584
            SN S FK SY   +   M+ NG +I     F  +  +  C+GC II+R+      T  L
Sbjct: 514 SSNTSTFKQSYNSSEIEGMLRNGQDIF---GFDANNTYHKCLGCIIIKREYDRRQTTAEL 570

Query: 585 PEGCNTCFTNYCWN 598
           PE C+ C+ +YC+N
Sbjct: 571 PEFCHQCYQDYCFN 584

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 44/102 (43%), Gaps = 26/102 (25%)

Query: 125 MLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTLAYNNWTSVQSIIDN 184
           MLTG+G +  M+                   Y+SG SGG+W++ +L          I+ +
Sbjct: 1   MLTGSGFITKMEE----------YGLLDCLAYISGLSGGSWILTSL----------ILHD 40

Query: 185 FN-ESDSIWDLSESIVS-----PGGKNIFKSARRWDHISDAL 220
           FN +S   W L +S++        G   F S+   D I+D +
Sbjct: 41  FNFKSLQKWKLDDSLLKGVPNFEVGNKDFVSSVDVDAINDIM 82

>AAL027W [160] [Homologous to ScYNL012W (SPO1) - SH]
           complement(295617..297395) [1779 bp, 592 aa]
          Length = 592

 Score =  210 bits (534), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 136/412 (33%), Positives = 208/412 (50%), Gaps = 51/412 (12%)

Query: 220 LQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVAD 279
           ++ K+  GF  S  D WGRAL  K +  +    ++        S +    + P PI +A+
Sbjct: 199 VRPKKIMGFPVSFTDYWGRALWKKIY--VNESMISSMSELFARSEITNNYEAPLPIIIAN 256

Query: 280 GRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDN 339
                 K  +L   VFEF PFE GSW+  L  F ++K+LG+N + G    +Q CVQGFD+
Sbjct: 257 -----CKNEDLVNAVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGV---AQSCVQGFDD 308

Query: 340 TAFIMGTSSTLFNQFLLRI----NSTNLHLPGFITKLATHF---LKDISQDF----NDVA 388
             FI  TSS+LFN  L+      + ++L     I  L + F   LK+    F    +D A
Sbjct: 309 IGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNKPNSFFGTRSDFA 368

Query: 389 TYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVFAIDNS 448
            + PNPF     +D+  T    NS  LYLVDGGED ENIPL P +Q ER +D++FA+D+S
Sbjct: 369 LFQPNPFYRYPGVDSPLT----NSDKLYLVDGGEDGENIPLRPFLQPERQVDLIFALDSS 424

Query: 449 MDMKLAWPDGSSLVHTFERQFVRQGQGMA------------FPYVPGTDTFVNLGLNQKP 496
              ++ +P G  L + ++      G                 PY+P  + F   GL ++P
Sbjct: 425 SG-RINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAKGLLKRP 483

Query: 497 TFFGC--DAHNLTDLE------YIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISN 548
             FGC  +++++ +         +PP+V Y  N+  ++ SN S FKL Y   + + M+ N
Sbjct: 484 VAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSEVQGMLEN 543

Query: 549 GFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLT--LPEGCNTCFTNYCWN 598
           G  + T +N T    +  C+GC +++R   ++N +  LP  C  CF  YC+N
Sbjct: 544 GASLFTHDNNT---AYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN 592

>Kwal_0.173
          Length = 507

 Score =  204 bits (518), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/419 (32%), Positives = 210/419 (50%), Gaps = 64/419 (15%)

Query: 220 LQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGV-AYTWSSLRDSPVFTEGQMPFPISVA 278
           ++ K+ +GF  S  D WG AL     P+   G + A+   S R    F   ++P PI VA
Sbjct: 113 VKSKKLSGFPISFTDYWGEALVTSIAPTHTTGSISAFADKSQR----FQRYEVPLPIFVA 168

Query: 279 DGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFD 338
           +      K  NL   VFEF PFE GSW  ++  F  +++LG+ ++AG P   Q+C+ GFD
Sbjct: 169 N-----CKNDNLRNAVFEFTPFEFGSWT-NMRLFIPLRYLGSQITAGTP---QKCIIGFD 219

Query: 339 NTAFIMGTSSTLFNQFLLRINSTNLHLPGFITK-----------LATHFLKDISQDFNDV 387
              F+  TSS+LFN  L+ +   +L  P   T+           L  H    +S+   ++
Sbjct: 220 EVGFVTATSSSLFNSVLMYV--WHLVAPSLDTRKAVRAIFSTFGLGIHKTTTVSKGEANI 277

Query: 388 ------ATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDI 441
                 A Y PNPF    +     +  +     LYLVDGGED ENIP+ PL+  ER LD+
Sbjct: 278 MSHPEYAIYQPNPF----YKHPATSDVLAKHNQLYLVDGGEDGENIPIGPLLIPERKLDV 333

Query: 442 VFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPY-----VPGTDTFVNLGLNQKP 496
           +FA+D+S D+  ++P+G+ L + ++  +         PY     +P ++ FV   L  +P
Sbjct: 334 IFALDSSSDV-CSFPNGTMLWNFYQNNYGHSSSKSNTPYQLLPLIPSSEEFVARRLLSRP 392

Query: 497 TFFGCD------------AHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRA 544
             FGC               N + LE +PP++IY  N  +SF SN S FKL Y++ +   
Sbjct: 393 VAFGCHMESYPTLNSTNWVRNSSHLE-LPPILIYHANANHSFASNLSTFKLKYSKIEVEQ 451

Query: 545 MISNGFEIATRNNFTDDPDFLGCIGCAIIRRK-QQSLNL----TLPEGCNTCFTNYCWN 598
           M+ NG  I +   F D P +  C+ C +++R   +S+ L     LP  C+ CF+ YC+N
Sbjct: 452 MLRNGKHIFS---FDDRPKYKRCLACLLVKRNYDRSIILGEEVRLPFFCDVCFSEYCYN 507

>YNL012W (SPO1) [4573] chr14 (609684..609788,609873..611663)
           Meiosis-specific protein with similarity to
           phospholipase B enzymes [1896 bp, 631 aa]
          Length = 631

 Score =  179 bits (453), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 196/399 (49%), Gaps = 47/399 (11%)

Query: 220 LQDKQKAGFDTSLADVWGRALSYKFFPSLYRG-GVAYTWSSLRDS-PVFTEGQMPFPISV 277
           ++ K+  GF  S  D WG+A+  +   +       ++++S L +S   F E  +P PI V
Sbjct: 260 IKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVPIPIFV 319

Query: 278 ADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGF 337
           A+      K   L+  +FEF PFE GSW+  L  F  + +LG+ + +GK   +++C+  F
Sbjct: 320 AN-----CKNGLLSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGK---AEKCINNF 371

Query: 338 DNTAFIMGTSSTLFNQFLL----------RINSTNLHLPGFITKLATHFLKDISQDFN-- 385
           D+  FI  TSS++FN  L+          R     L++   I  L    +  IS+D +  
Sbjct: 372 DDLGFITATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSISKDSSRL 431

Query: 386 --DVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVF 443
             D A Y PNPF    ++       + N   LYLVDGGED ENIPL  L+  ER+LD++F
Sbjct: 432 ETDYAVYQPNPF----YLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVIPERELDVIF 487

Query: 444 AIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPTFFGCDA 503
            +D+S D+   +P+GS L   FE+      + + + +     TF +      P   GC+A
Sbjct: 488 VLDSSSDID-NYPNGSKLKRIFEK---LDEENVHYQFPNNVKTFTH------PIVIGCNA 537

Query: 504 HNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIATRNNFTDDPD 563
              T  +   P++IY  N  +   SN S FK++Y + +  +M+  G     R  F++D D
Sbjct: 538 TKRTGHDSFLPIIIYHANANHGNASNTSTFKITYNQSEVSSMLPTG-----RGVFSNDYD 592

Query: 564 --FLGCIGCAIIRRKQQSL--NLTLPEGCNTCFTNYCWN 598
             +  C+GC + +R    L         C  CF +YC++
Sbjct: 593 LYYKNCLGCILTKRTMDRLPRKKKFSPFCLQCFKDYCYS 631

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 72/151 (47%), Gaps = 29/151 (19%)

Query: 50  LIREAD-SISHNESLWLQKRMQNTREPLLQFXXXXXXXXXXXXXFDTAALLSSLMGSDSA 108
           LIREA   +   E+L+L+K+   T+  L+QF                A   S        
Sbjct: 30  LIREAKHELCPEETLYLKKKKIKTKNKLIQFLKS----------LTEAKFSSKFYKRVLK 79

Query: 109 SQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVG 168
             PKIGIA+SGGGYRSML G G ++ M++              + + Y++G SGG+W++ 
Sbjct: 80  DPPKIGIAISGGGYRSMLVGTGFISQMND----------YGLFEYSDYIAGLSGGSWILM 129

Query: 169 TLAYNNWTSVQSIIDNFNESDSIWDLSESIV 199
            L   N+  V+S++         WDL E ++
Sbjct: 130 DLVVQNF-EVKSLLQE-------WDLEEDLL 152

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score =  177 bits (450), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 137/413 (33%), Positives = 202/413 (48%), Gaps = 53/413 (12%)

Query: 220 LQDKQKAGFDTSLADVWGRALSYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVAD 279
           ++ K++AGF  SL D  G+AL  +  P+  +  +    S+   S  F +   P P+ VA+
Sbjct: 287 VRQKKEAGFPISLTDYLGQALLDRL-PAQKQDHLK-QLSNFVQSESFKKFDAPIPVFVAN 344

Query: 280 GRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQGFDN 339
            +   SK   L+  VFEF PFE GSW  +++ F   K+LG+    GK     +CV GFDN
Sbjct: 345 AK--TSKGPELHNVVFEFTPFEFGSWHLNVSKFISTKYLGSTALKGK---LTKCVNGFDN 399

Query: 340 TAFIMGTSSTLFNQFLLRI---NSTNLHLPGFITKLATHFLKDISQDFN----DVATYHP 392
             FI  TSS+LFN  L  I    +TN+     +  + T F       FN    D A Y P
Sbjct: 400 LGFITATSSSLFNNALFYIWKTVTTNIESNEKLKAIKTIF-GVFGVGFNAIRSDYAIYQP 458

Query: 393 NPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRERDLDIVFAIDNSMDMK 452
           NPF    + D      I ++  L+LVDGGED ENIPL  L    R  D++F +D+S D K
Sbjct: 459 NPF----YKDPEVLNLISDTSQLFLVDGGEDGENIPLRSLFISGRQNDVIFIVDSSSD-K 513

Query: 453 LAWPDGSSLVHTFER--QFVRQGQGMAF----------PYVPGTDTFV--NLGLNQKPTF 498
              PD + L  T++       Q + +A           PY+P ++  +  N  L+  P  
Sbjct: 514 ENLPDMTKLRDTYDDIIHVEEQKRIVALKNEIWEMDLMPYIPTSEELLAANFSLST-PIA 572

Query: 499 FGC-----DAHNLTDL--------EYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAM 545
           FGC     +   LTD           +PP++IY  N   +F SN S FKL+YT+++   M
Sbjct: 573 FGCHLQSYNTKRLTDTLITKETSSASLPPILIYHGNIPITFQSNTSTFKLNYTKDEYNGM 632

Query: 546 ISNGFEIATRNNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYCWN 598
           ++NG  +   NN     ++L C+GC ++ R+ Q L   +   C+ C    C+N
Sbjct: 633 LNNGHHLF--NNDDTQGEYLQCLGCVMLLRQNQEL---VSSFCDACIRKVCYN 680

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 36/150 (24%)

Query: 24  APSNSYAPSYMDCKQ--ALGSAFNEDFSLIREADSISHNESLWLQKRMQNTREPLLQFXX 81
           A ++ YAP  +DC +  +L +A NE  S +         E  +L KR +  +    +F  
Sbjct: 16  AIASLYAPVNVDCPKDLSLRAAKNEKLSAL---------EFDYLSKRTEVIKGKFEKF-- 64

Query: 82  XXXXXXXXXXXFDTAALLSSLMGSDSASQPKIGIAVSGGGYRSMLTGAGILAAMDNRTRG 141
                      ++  A+    +  DS   P+I +A+SGGG+RSML  +G +  M      
Sbjct: 65  -----------YEDLAIPG--INVDSLQFPRIAVAISGGGFRSMLISSGFVLGM------ 105

Query: 142 AQHHXXXXXXQSTTYLSGASGGNWLVGTLA 171
            Q H      + T+Y++G SGG+W +  L 
Sbjct: 106 -QQH---GLWECTSYVAGISGGSWTLLKLV 131

>CAGL0H03575g 331303..332847 similar to sp|P53541 Saccharomyces
           cerevisiae YNL012w SPO1, start by similarity
          Length = 514

 Score =  162 bits (411), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 117/401 (29%), Positives = 199/401 (49%), Gaps = 55/401 (13%)

Query: 220 LQDKQKAGFDTSLADVWGRAL----SYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPI 275
           ++ K+  GF  S  D W +AL     Y+  P+     + Y+  S+R S  F    +P PI
Sbjct: 143 IRSKRINGFPISFTDYWAQALVQNIKYRQLPT----HLTYS-KSVRTSNYFKNYLVPIPI 197

Query: 276 SVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQRCVQ 335
            VA+ R        L   +FEF P+E GSW+  L  F ++++LG+ +  G    S +C +
Sbjct: 198 IVANCRNGF-----LKNVIFEFTPWEFGSWEQVLGLFVNIEYLGSRIINGV---SHQCYK 249

Query: 336 GFDNTAFIMGTSSTLFNQFLLRI-----NSTNLHLPGFITKLA------THF---LKDIS 381
           G D+  FI  TSS++FN  L+ +      S+   +    T LA      T F   L+  S
Sbjct: 250 GLDDLGFIAATSSSIFNNALIYVWKLASKSSKDAIAAVKTVLAVFGLGTTKFESALQTSS 309

Query: 382 QDF----NDVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLIQRER 437
           Q       D A Y  NPF    +  +N    +  +  LYLVDGGED ENIP+  L+   R
Sbjct: 310 QITAALDTDYAVYRHNPF----YKYSNIKNELAQNDYLYLVDGGEDGENIPIRTLV--PR 363

Query: 438 DLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLNQKPT 497
           ++D++  +D+S D K  + +G  L     +  +++ +G+ + Y     T       ++PT
Sbjct: 364 NVDMIMIMDSSSDKK-NYANGDKLKIVLNQ--MKEKEGIYYRYPTKIVTS-----QKRPT 415

Query: 498 FFGCDAHNLTDLEYIPPLVIYLPNKQYSFP--SNQSAFKLSYTEEQRRAMISNGFEIATR 555
             GC     +D + + P+++Y PN + S    +N S FK+ YT E+++ +I +G+ + T 
Sbjct: 416 IIGCKPPRTSDTK-LAPILVYYPNSERSSTQVTNTSTFKMIYTSEEQQLLIDHGYTLVTG 474

Query: 556 NNFTDDPDFLGCIGCAIIRRKQQSLNLTLPEGCNTCFTNYC 596
           +    + D+  C+ C +++R     ++  P+ C+ C++ YC
Sbjct: 475 HG---EHDYQKCMACILVKRSYDQASIIPPKQCSICYSKYC 512

>Scas_695.10
          Length = 553

 Score =  162 bits (411), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/382 (31%), Positives = 188/382 (49%), Gaps = 61/382 (15%)

Query: 220 LQDKQKAGFDTSLADVWGRAL-------SYKFFPSLYRGGVAYTWSSLRDSPV-FTEGQM 271
           ++ K+  GF  S  D WG AL         KF  S +   V++  S L +S + F++ + 
Sbjct: 184 VRTKKIQGFFVSFTDYWGEALLKRLNNKDKKF--SAFANTVSF--SKLIESNLKFSKFEA 239

Query: 272 PFPISVADGRYPGSKVLNLNATVFEFNPFEMGSWDPSLNTFTDVKFLGTNVSAGKPIDSQ 331
           P PI VA+ R        L   +FEF+PFE GSW+  L  F  + +LG+ +  G    ++
Sbjct: 240 PIPIFVANNRNG-----RLKNVIFEFSPFEFGSWEKMLRLFVKLPYLGSKIVNGT---AK 291

Query: 332 RCVQGFDNTAFIMGTSSTLFNQFLL----RINSTNLHLPGFITKLATHF----LKDISQD 383
            C + FD+  FI  TSS++FN  L+    +++ ++L     +  +   F     KD ++ 
Sbjct: 292 ICYKEFDDIGFITATSSSIFNNVLIFIWQKMSRSSLEAMKSVKAVMGLFGLIGTKDSTKP 351

Query: 384 FN----------DVATYHPNPFKDANFIDANYTKSIVNSKSLYLVDGGEDDENIPLLPLI 433
                       D A Y+ NPF    F   N   ++     LYLVDGGED ENIPL  LI
Sbjct: 352 LTLSNTAIAPETDYAVYYHNPF----FRYPNIDNALTKDDHLYLVDGGEDGENIPLRSLI 407

Query: 434 QRERDLDIVFAIDNSMDMKLAWPDGSSLVHTFERQFVRQGQGMAFPYVPGTDTFVNLGLN 493
             ER +D++FAID+S D+   + +G+ L+ T  R   + G     P +            
Sbjct: 408 IPERKVDVIFAIDSSSDVN-NYANGTKLI-TILRHLEKLGYHYKIPKISKKRI------- 458

Query: 494 QKPTFFGCDAHNLTDLEYIPPLVIYLPNKQYSFPSNQSAFKLSYTEEQRRAMISNGFEIA 553
             P  FGC+A +L       P++IY  N ++S+PSN S FK++Y E +  AM+ NG +I 
Sbjct: 459 NHPLIFGCNAPSL-------PIIIYHANTEHSYPSNTSTFKVTYNETEVGAMLQNGMDIF 511

Query: 554 TRNNFTDDPDFLGCIGCAIIRR 575
             N   ++  +  C+GC + +R
Sbjct: 512 NDN---ENIYYQNCLGCILSKR 530

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 18/89 (20%)

Query: 111 PKIGIAVSGGGYRSMLTGAGILAAMDNRTRGAQHHXXXXXXQSTTYLSGASGGNWLVGTL 170
           P IG+A+SGGGYRSMLTG G +  M  +                +YLSG SGG+W++  L
Sbjct: 9   PNIGVALSGGGYRSMLTGTGFILGMQEK----------GLWDCVSYLSGLSGGSWVLMDL 58

Query: 171 AYNNWTSVQSIIDNFNESDSIWDLSESIV 199
             NN+ ++  +I+N       WDL+E ++
Sbjct: 59  IVNNF-NITKMINN-------WDLTEGLL 79

>Kwal_56.24139
          Length = 463

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 33/134 (24%)

Query: 238 RALSYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNA--TVF 295
           + L ++F+  +Y+G   +  S                  V +GRYP  ++LNL+   +V 
Sbjct: 188 KRLKHRFWTEVYQGAKLFYLSG-----------------VINGRYPDREILNLSRFISVM 230

Query: 296 EFNPFEMGSWDPSL--NTFTDVKFLGTNVSAGKPIDSQRCVQGFDNTAFIMGTSSTLFNQ 353
           +F P +  +  P L  +  TD+       + GK ID +  + G+            L   
Sbjct: 231 KFRPLKWRNEHPYLLADRITDITHPELLETQGKQIDRKVALYGY------------LHGT 278

Query: 354 FLLRINSTNLHLPG 367
            L  +    +HLPG
Sbjct: 279 PLSAVPGVRVHLPG 292

>Scas_690.1*
          Length = 636

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 21/104 (20%)

Query: 238 RALSYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNA--TVF 295
           + L ++F+  +Y+G   +  S                  V +GRYP  ++LNL+   +V 
Sbjct: 188 KRLKHRFWTEVYQGAKLFYLSG-----------------VINGRYPDREILNLSRFISVM 230

Query: 296 EFNPFEMGSWDPSL--NTFTDVKFLGTNVSAGKPIDSQRCVQGF 337
           +F P +  +  P L  +  TD+       + GK ID +  + G+
Sbjct: 231 KFRPLKWRNEHPYLLADRITDLTHPELIETQGKQIDRKVAIYGY 274

>YPL217C (BMS1) [5232] chr16 complement(139619..143170) Protein
           involved rRNA processing and 40S ribosomal subunit
           biogenesis, contains a GTP-binding domain, and interacts
           genetically with BMH1 [3552 bp, 1183 aa]
          Length = 1183

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 21/104 (20%)

Query: 238 RALSYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNA--TVF 295
           + L ++F+  +Y+G   +  S                  V +GRYP  ++LNL+   +V 
Sbjct: 188 KRLKHRFWTEVYQGAKLFYLSG-----------------VINGRYPDREILNLSRFISVM 230

Query: 296 EFNPFEMGSWDPSL--NTFTDVKFLGTNVSAGKPIDSQRCVQGF 337
           +F P +  +  P +  + FTD+       + G  ID +  + G+
Sbjct: 231 KFRPLKWRNEHPYMLADRFTDLTHPELIETQGLQIDRKVAIYGY 274

>KLLA0B02068g complement(179493..182996) similar to sgd|S0006138
           Saccharomyces cerevisiae YPL217c BMS1, start by
           similarity
          Length = 1167

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 21/104 (20%)

Query: 238 RALSYKFFPSLYRGGVAYTWSSLRDSPVFTEGQMPFPISVADGRYPGSKVLNLNA--TVF 295
           ++L ++F+  +Y+G   +  S                  V +GRYP  ++LNL+   +V 
Sbjct: 188 KSLKHRFWTEVYQGAKLFYLSG-----------------VINGRYPDREILNLSRFISVM 230

Query: 296 EFNPFEMGSWDPSL--NTFTDVKFLGTNVSAGKPIDSQRCVQGF 337
           +F P +  +  P L  +  +D+       S G  ID +  + G+
Sbjct: 231 KFRPLQWRNEHPYLLADRISDLTHPELLQSKGMHIDRKVAIYGY 274

>CAGL0F02541g 248281..250173 similar to sp|Q04177 Saccharomyces
           cerevisiae YDR398w, hypothetical start
          Length = 630

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 9/57 (15%)

Query: 184 NFNESDSIW--DLSESIVSPGGKNIFKSARRWDHISDALQD-------KQKAGFDTS 231
           NFN+S S++  D++ +     G     S   + H++ A+QD       K+KAG DTS
Sbjct: 335 NFNDSRSLYGNDVASTKAYKEGNATITSGDNYRHVTQAIQDWEKELQEKEKAGEDTS 391

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,336,213
Number of extensions: 1059868
Number of successful extensions: 2486
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2457
Number of HSP's successfully gapped: 33
Length of query: 704
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 595
Effective length of database: 12,822,747
Effective search space: 7629534465
Effective search space used: 7629534465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)