Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_644.651051021730.0
YOL013C (HRD1)5514368311e-105
CAGL0E02299g5454157714e-96
Kwal_56.225225134846451e-77
KLLA0C05874g5534173908e-41
ACL019C5753383784e-39
Scas_248.12602492894e-29
YKL034W (TUL1)758571272e-07
Sklu_2102.1751571211e-06
KLLA0F25674g757581192e-06
AFR275W753641193e-06
Kwal_26.8099750571193e-06
YBR062C115641093e-06
AGR034W159661114e-06
CAGL0L01947g757571174e-06
Kwal_27.10546104801022e-05
Scas_625.4761571113e-05
KLLA0E03960g704761113e-05
Scas_705.41428531022e-04
CAGL0H10274g11458934e-04
KLLA0F12166g152880970.001
AER390W31660930.002
CAGL0K08052g30550930.002
Sklu_1676.310160860.003
CAGL0K02563g58651930.003
ABR104W32870920.003
CAGL0E01441g71727920.004
Scas_713.4557027920.004
Scas_573.9150247920.005
Sklu_2317.249351910.005
Sklu_2432.9147549910.007
Kwal_56.2390058978900.007
Scas_625.1127472880.008
KLLA0E16720g30553880.009
CAGL0M08690g32846880.010
Kwal_26.809052063870.014
CAGL0B05049g147027880.014
YDR265W (PEX10)33763860.016
Sklu_2416.811048810.017
KLLA0F18458g14057820.018
Kwal_55.1999915257820.019
Kwal_55.2205411148800.019
Scas_615.1333070850.020
YDR143C (SAN1)61035860.023
CAGL0I04576g14988810.027
YHL010C58547840.036
Scas_585.5*10948780.038
ADL181W10844770.045
Kwal_14.1287151847830.053
Kwal_55.2120627564810.057
AAL030C153946830.059
YOL133W (HRT1)12148770.064
KLLA0F25740g51747810.075
Scas_560.6*11838750.11
KLLA0C15697g30449780.17
YLR247C155626790.18
YPR093C28827760.23
Kwal_56.2311213527730.26
YOL138C134145770.26
KLLA0E07139g11048720.26
YMR247C156249770.32
Kwal_26.803066030750.40
KLLA0E17787g16227720.51
Sklu_2337.232250740.54
CAGL0L06336g60049740.56
AAL039C283125730.62
Scas_696.17156449740.66
Kwal_47.1685027388720.73
ABL058C154649730.79
CAGL0B02013g112033730.81
CAGL0H02651g154448730.90
Kwal_27.12327157449730.93
KLLA0E18601g65028720.97
Kwal_56.2354396552711.3
Sklu_1785.333131701.5
KLLA0E06435g96564711.5
AER016C14727671.9
KLLA0C08756g42745692.0
Kwal_27.1041930031692.1
Scas_610.17130586683.1
YDR103W (STE5)91732683.1
KLLA0E05742g122885683.1
KLLA0E07568g33165673.5
CAGL0F04609g131186683.6
CAGL0E03355g153548683.7
CAGL0H07315g28963663.9
Sklu_2416.2135332674.6
AAL146W190063665.6
CAGL0J03586g41158656.0
KLLA0E21043g132126666.5
Sklu_2418.6129779658.0
KLLA0C14542g32673648.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_644.6
         (510 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_644.6                                                            841   0.0  
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...   324   e-105
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...   301   4e-96
Kwal_56.22522                                                         253   1e-77
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...   154   8e-41
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...   150   4e-39
Scas_248.1                                                            115   4e-29
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    54   2e-07
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          51   1e-06
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    50   2e-06
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    50   3e-06
Kwal_26.8099                                                           50   3e-06
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...    47   3e-06
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....    47   4e-06
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    50   4e-06
Kwal_27.10546                                                          44   2e-05
Scas_625.4                                                             47   3e-05
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    47   3e-05
Scas_705.41                                                            44   2e-04
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...    40   4e-04
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    42   0.001
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    40   0.002
CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06...    40   0.002
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         38   0.003
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    40   0.003
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    40   0.003
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    40   0.004
Scas_713.45                                                            40   0.004
Scas_573.9                                                             40   0.005
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            40   0.005
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              40   0.007
Kwal_56.23900                                                          39   0.007
Scas_625.11                                                            39   0.008
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    39   0.009
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    39   0.010
Kwal_26.8090                                                           38   0.014
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    39   0.014
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    38   0.016
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          36   0.017
KLLA0F18458g complement(1697871..1698293) some similarities with...    36   0.018
Kwal_55.19999                                                          36   0.019
Kwal_55.22054                                                          35   0.019
Scas_615.13                                                            37   0.020
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    38   0.023
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    36   0.027
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    37   0.036
Scas_585.5*                                                            35   0.038
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    34   0.045
Kwal_14.1287                                                           37   0.053
Kwal_55.21206                                                          36   0.057
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    37   0.059
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    34   0.064
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    36   0.075
Scas_560.6*                                                            33   0.11 
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    35   0.17 
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    35   0.18 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    34   0.23 
Kwal_56.23112                                                          33   0.26 
YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible...    34   0.26 
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    32   0.26 
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    34   0.32 
Kwal_26.8030                                                           33   0.40 
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    32   0.51 
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         33   0.54 
CAGL0L06336g 713059..714861 some similarities with sp|P32917 Sac...    33   0.56 
AAL039C [148] [Homologous to ScYDR313C (PIB1) - SH] (273886..274...    33   0.62 
Scas_696.17                                                            33   0.66 
Kwal_47.16850                                                          32   0.73 
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    33   0.79 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    33   0.81 
CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces c...    33   0.90 
Kwal_27.12327                                                          33   0.93 
KLLA0E18601g complement(1645113..1647065) some similarities with...    32   0.97 
Kwal_56.23543                                                          32   1.3  
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         32   1.5  
KLLA0E06435g complement(581935..584832) similar to sp|P38164 Sac...    32   1.5  
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    30   1.9  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    31   2.0  
Kwal_27.10419                                                          31   2.1  
Scas_610.17                                                            31   3.1  
YDR103W (STE5) [952] chr4 (658344..661097) Pheromone pathway sca...    31   3.1  
KLLA0E05742g 515081..518767 weakly similar to sp|P34216 Saccharo...    31   3.1  
KLLA0E07568g 685564..686559 weakly similar to sp|Q04370 Saccharo...    30   3.5  
CAGL0F04609g 463702..467637 similar to sp|P34216 Saccharomyces c...    31   3.6  
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    31   3.7  
CAGL0H07315g <715897..716766 similar to tr|Q06651 Saccharomyces ...    30   3.9  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          30   4.6  
AAL146W [41] [Homologous to ScYGR184C (UBR1) - SH] complement(92...    30   5.6  
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    30   6.0  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    30   6.5  
Sklu_2418.6 YBL047C, Contig c2418 10006-13899 reverse complement       30   8.0  
KLLA0C14542g 1272215..1273195 weakly similar to sgd|S0002721 Sac...    29   8.4  

>Scas_644.6
          Length = 510

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/510 (84%), Positives = 430/510 (84%)

Query: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXX 60
           MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVM            
Sbjct: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALL 60

Query: 61  XXXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120
                           EQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF
Sbjct: 61  LWKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120

Query: 121 YWILKDRLEFLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           YWILKDRLEFLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN
Sbjct: 121 YWILKDRLEFLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
           STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFA           HSILSLYEIYK
Sbjct: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK 240

Query: 241 SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300
           SNQYDQLNA              TPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL
Sbjct: 241 SNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL 360
           NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL
Sbjct: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL 360

Query: 361 LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPATXXXX 420
           LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPAT    
Sbjct: 361 LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPATAADA 420

Query: 421 XXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNNTWYSFPITHINKDKSVISFEL 480
                    Q              IQETLEPEEASIDNNTWYSFPITHINKDKSVISFEL
Sbjct: 421 DVDVDVAAAQPPSTSSSPSIPHSPIQETLEPEEASIDNNTWYSFPITHINKDKSVISFEL 480

Query: 481 RDDKESSETVQLIRETKTENVIIPDDHIHT 510
           RDDKESSETVQLIRETKTENVIIPDDHIHT
Sbjct: 481 RDDKESSETVQLIRETKTENVIIPDDHIHT 510

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 174/436 (39%), Positives = 249/436 (57%), Gaps = 53/436 (12%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           + RR QL  F  + Y+LT  C+ ++   S SFL ++LKLN+GFN+M              
Sbjct: 4   ENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EHI ERLPFTIIN +F+S++F+E++F T+AF+G +LLY+K+F+W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           ILKDRLE L+QS N + ++   IFS+F  NL++L+ ++ Q+I  CI         +Y N 
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCI-------SSIYTNQ 176

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKS 241
            S ++S                     +YL+  MEF             + L+ +E Y+S
Sbjct: 177 KSDIES-------------------TSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRS 217

Query: 242 -----NQYDQLNAXXXXXXXXXXXXXXTPA------------DFNGLENKFIYEKIIDLF 284
                N+ + +                 P              F GLE KF+YEK ID+F
Sbjct: 218 QQSLSNENNHIVHGDPTDENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVF 277

Query: 285 TRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPE 344
           TR L T +H+S+ +P  +PM++LKD++WD+++LYQ+   L++I +NNK LD  L  +  E
Sbjct: 278 TRFLKTALHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVE 337

Query: 345 DLQDS---DNVCIVCMDDLL------SEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
            LQ+S   DN+CI+CMD+L+      + ++K KK KRLPCGH LHLSCLKNWMERSQTCP
Sbjct: 338 QLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCP 397

Query: 396 ICRLPVFDESGNVKES 411
           ICRLPVFDE GNV ++
Sbjct: 398 ICRLPVFDEKGNVVQT 413

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score =  301 bits (771), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 171/415 (41%), Positives = 240/415 (57%), Gaps = 21/415 (5%)

Query: 5   RRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXXX 64
            + + + FTAI YVLTI C+I++   S SFL ++LKL++GFN++                
Sbjct: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65

Query: 65  XXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWIL 124
                       E EHI ERLPF +IN IF+ + FNEK+F T+A    +LLYMK+F+WIL
Sbjct: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125

Query: 125 KDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTS 183
           +DRL+ L+Q  N +      + +++  NL++L  I+  +I  C+   Y     ++   T+
Sbjct: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185

Query: 184 ILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSNQ 243
            +  ++   SP +  A         IY+M AMEF            ++ L  YE + S +
Sbjct: 186 SI--VLGGGSPLTQRAL--------IYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRK 235

Query: 244 YDQLNAXXXXXXXXXXXXXXTPAD--FNGLENKFIYEKIIDLFTRSLMTMIHISLALPLN 301
           + Q N                  D  FNGLE KF+YEK+ID+ TR L T++H+ +A+ LN
Sbjct: 236 FSQNNPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLN 295

Query: 302 LPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS---DNVCIVCMD 358
           LP++++KDI  D+  LY N K L  I KN+K LD+KLP M  +DL +    DNVCIVCMD
Sbjct: 296 LPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMD 355

Query: 359 DLLSE-----EHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV 408
           +L+SE     +   KK K+LPCGH LHLSCLKNWMERSQTCPICRLPVFDE+G +
Sbjct: 356 ELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEI 410

>Kwal_56.22522
          Length = 513

 Score =  253 bits (645), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/484 (30%), Positives = 235/484 (48%), Gaps = 57/484 (11%)

Query: 2   LQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXX 61
           ++ +R Q  A+    Y      II +  +S SFL LS +L +G N++             
Sbjct: 3   VRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGVLL 62

Query: 62  XXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFY 121
                          E EHI ERL FTI+N  F+S+ F+E  F+++  +   L+++K+F+
Sbjct: 63  WKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKVFH 122

Query: 122 WILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           W+L+DRLE + Q ++ + + +R + S+F+ N+ +L  ++ Q+ K CI     F +  +  
Sbjct: 123 WVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF-- 180

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
                     YSS  S H            LM A+EFA            SI++L E+Y+
Sbjct: 181 ----------YSSSLSVH------------LMFAVEFAMLLVDVTEVAMKSIINLVEVYQ 218

Query: 241 SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300
             +    +                  D+ GLE KF+YEK++ L  +     +HI L +P 
Sbjct: 219 CKRSFARDGE----------------DYTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPF 262

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDN-VCIVCMDD 359
           ++P+++ KDI+WD  +++   K L    K+N+ +D KLPD+    L  SD+ +CIVCMDD
Sbjct: 263 SMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQLAASDDKMCIVCMDD 322

Query: 360 LLSEE---HKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV-----KES 411
           +L+     + K+K KRLPC H LHL CLK+WMERSQTCPICR+PVFD+ GNV     + +
Sbjct: 323 MLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVVVTSDQTN 382

Query: 412 ERPATXXXXXXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNNTWYSFPITHINK 471
            +P T                            I  T  P         WY+FP   ++ 
Sbjct: 383 NQPGTSSAVESTADET---STAATTSVSSQSSSIAVTDVPSH----QRGWYAFPTVQVHD 435

Query: 472 DKSV 475
           + S+
Sbjct: 436 EGSI 439

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score =  154 bits (390), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 114/417 (27%), Positives = 188/417 (45%), Gaps = 46/417 (11%)

Query: 8   QLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXXXXXX 67
           + IA++ + Y      +      S S+LH   K+ +G + M                   
Sbjct: 25  KFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIH 84

Query: 68  XXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWILKDR 127
                    E EHI+ER+ +T+I  +   +  N      M  +  + +  +  +WILKDR
Sbjct: 85  MLFGQLRLIEYEHILERISYTVITLLLSCSSMN-GLISVMQIHCVLFVCCRTLHWILKDR 143

Query: 128 LEFLIQSN------TNYSVSRFIFSKFYL----NLIILSTINLQLIKTCIPLNYEF--LK 175
           +E   Q+N       +  +SRF+F+   L     +I+   +N  L K+ I + Y    + 
Sbjct: 144 MEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVTYTLFIIS 203

Query: 176 KLYLNSTSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSL 235
           +  +  T +LQ ++               G+N   L      A             ++  
Sbjct: 204 QYAILGTDLLQVILRT-------------GLNLFELSTIQNRARIRRNADHHVDEPVI-- 248

Query: 236 YEIYKSNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHIS 295
                 N  ++ NA                    GLE KFIYEK+ID+F  ++  +I  +
Sbjct: 249 ------NHEERPNAVAIEEDEDEDEENA------GLEGKFIYEKLIDVFISTVKVIIKFA 296

Query: 296 LALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSD-NVCI 354
            +      M+V   ++W+ I+ +++ + L++  K++K+LD+ L D     ++  + ++CI
Sbjct: 297 SSFSTGRVMMV--TVLWEAITTFKSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICI 354

Query: 355 VCMDDLLSEEHKK---KKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV 408
           VCM+D L    +K   KK K LPC H LHLSCLKNW+ RS TCPICRLP+FDE+GNV
Sbjct: 355 VCMEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNV 411

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score =  150 bits (378), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 159/338 (47%), Gaps = 45/338 (13%)

Query: 77  EQEHIMERLPFTIINFIFISTMFNEKFF---ITMAFYGFILLYMKIFYWILKDRLEFLIQ 133
           E +HI ERL   ++    I     + +    +T+ FY   L    + +W+L+DR++F+ Q
Sbjct: 78  EYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRDRMDFVFQ 133

Query: 134 -SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTSILQSLINYS 192
              T+ S+   + S+F  +L++L  ++ +++K C+                         
Sbjct: 134 VHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCV------------------------- 168

Query: 193 SPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSNQYDQLNAXXX 252
                  +N +   + +YLMLA+ FA            + L+L+E+ +S +    N    
Sbjct: 169 -----QNTNVDGKRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSAN---- 219

Query: 253 XXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDIIW 312
                         +   LE K+IYE + DL    L  ++ I   + +   + V+  I  
Sbjct: 220 LVYEGGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFV 279

Query: 313 DLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKK---K 369
             I   ++  +++   KNNK L  KL D+  E L D+D++CI+CMDD+L      K   +
Sbjct: 280 RSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRR 339

Query: 370 AKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGN 407
           AK LPCGH LH  CLK+WMERSQTCPICRL VF    N
Sbjct: 340 AKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377

>Scas_248.1
          Length = 260

 Score =  115 bits (289), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 125/249 (50%), Gaps = 33/249 (13%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           Q RR Q I ++   Y   I  + +S   S +FL  ++KL +G N++              
Sbjct: 39  QNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLW 98

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EH+ ERL FTI+N IF+S+MF E+ F+T+  +  +L+++K+F+W
Sbjct: 99  KLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHW 158

Query: 123 ILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           ILKDRLEF+ Q +N N ++ + +FS+F  NL+ L++++ Q+++ C+            NS
Sbjct: 159 ILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLS-----------NS 207

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK- 240
            S  Q    ++S S             +YLM  ++FA           H +++  E+Y+ 
Sbjct: 208 ISNDQ----WTSSS-------------VYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRL 250

Query: 241 ---SNQYDQ 246
              ++ YD+
Sbjct: 251 QSHNSHYDE 259

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK  +   +  PC H  H SCL+NWM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK      +  PCGH  H  CL++WM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 352 VCIVCMDDLL-----SEEHKKKKAKRL---PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           VC +CM D+      +EE  K  A+     PC H  H  CL+NWM     CP+CR P+
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCRAPL 754

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 349 SDNVCI---VCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPIC 397
           +DN C+   +CM +L      + E HK      +  PC H  H  CL+NWM     CP+C
Sbjct: 687 NDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVC 746

Query: 398 RLPV 401
           R P+
Sbjct: 747 RAPL 750

>Kwal_26.8099
          Length = 750

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 353 CIVCMD------DLLSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM       D + E HK  K   +  PC H  H  CL++WM     CP+CR P+
Sbjct: 691 CAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTC 394
           + LP +  + L+ +DN C +C  + L +E+       LP C H   L CL  W+ RS TC
Sbjct: 28  ASLPRINKKKLKATDN-CSICYTNYLEDEYPL--VVELPHCHHKFDLECLSVWLSRSTTC 84

Query: 395 PICR 398
           P+CR
Sbjct: 85  PLCR 88

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 338 LPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPI 396
           LP +  + L + DN C +C    L +E+       LP CGH   L C+  W+ RS TCP+
Sbjct: 76  LPRVPKKRLAEGDN-CAICCCGYLEDEYPL--VVELPNCGHTFDLQCVSVWLSRSTTCPM 132

Query: 397 CRLPVF 402
           CR  V 
Sbjct: 133 CRSDVL 138

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM +       L E H+  K   +  PC H  H SCL++WM     CP+CR P+
Sbjct: 698 CAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>Kwal_27.10546
          Length = 104

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 334 LDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQ 392
           +DS LP +    L+D++   I C +     + K      LP C H   L C+  W+ +S+
Sbjct: 18  IDS-LPRVEKGKLKDAEACSICCCN---YRDDKYPLVVELPHCNHRFDLECVAVWLSKSR 73

Query: 393 TCPICRLPVFDESGNVKESE 412
           TCP+CR  V     NV  S+
Sbjct: 74  TCPLCRDDVLSHKPNVDVSQ 93

>Scas_625.4
          Length = 761

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++        E H   +   +  PC H  H  CL+NWM     CP+CR P+
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 329 KNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM 388
           ++++ +D++LPD  PE             +D  +  H    A  LPCGH     CL  W 
Sbjct: 178 ESDQRVDNELPD--PESSAHHTGEQEGGQEDTPTYGHS---ATVLPCGHVFGRECLYKWT 232

Query: 389 ERSQTCPICRLPVFDE 404
               +CPICR P+  E
Sbjct: 233 TEHNSCPICRAPILSE 248

>Scas_705.41
          Length = 428

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 348 DSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQT--CPICR 398
           + DN+C +C DDL   +  + K K  PC H  H  C++ W   S    CP+CR
Sbjct: 7   EGDNICPICFDDLNDTDILQGKLK--PCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPICR 398
           IP+    SD+ C +C  + +++E+       LP CGH     C+  W+ ++ TCP+CR
Sbjct: 32  IPQKKLKSDDTCPICCSNFIADEYPL--VVELPHCGHKFDFECVSMWLTKNTTCPMCR 87

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 320  NCKILFQILKNNKNLDSKLPDMIPEDLQDSDNV-CIVCMDDLLSEEHKKKKAKRLPCGHF 378
            NCK++  +    + LD+     +   + + +N+ C VC  D+ +          L CGHF
Sbjct: 1176 NCKVINNLESRVRYLDT--LGQLKTAIANGENISCAVCYSDIYT-------GSILKCGHF 1226

Query: 379  LHLSCLKNWMERSQTCPICR 398
                C+ +W +++ +CP+C+
Sbjct: 1227 FCKDCVTHWFKKNTSCPMCK 1246

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 339 PDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           P++ P  + +    CI+C+ D+            LPCGH    +C+  W      CP+CR
Sbjct: 253 PEIFP-FISEQSRKCILCLADMTDPSC-------LPCGHMFCWACVMQWCNERNECPLCR 304

>CAGL0K08052g complement(800162..801079) weakly similar to tr|Q06834
           Saccharomyces cerevisiae YPR093c, hypothetical start
          Length = 305

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICRL 399
           VC +C++D+     K   +   PCGH  H  C++ W   ++   CP+CR+
Sbjct: 5   VCAICLEDICG---KSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDES 405
           + +S   CI+C+ ++       K     PCGH    +C+ NW +    CP+CR     +S
Sbjct: 44  INESSRKCILCLTEM-------KDPSCAPCGHIFCWNCIINWCKERSECPLCRQKCLKQS 96

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVF 402
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 246 TCPVCLERMDSE---TTGLITIPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 14/70 (20%)

Query: 332 KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWME-- 389
           K++ S +    P+D       C +C + + S        + +PCGH  HL+C++ W    
Sbjct: 3   KHISSHIAMGCPQD------ECSICWESMPS-----GVGRLMPCGHEYHLACIRKWFHLH 51

Query: 390 -RSQTCPICR 398
             +++CP+CR
Sbjct: 52  SGNRSCPVCR 61

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           ++PCGH    SCL  W     +CP+CR
Sbjct: 292 KIPCGHIFGRSCLYEWTRLENSCPLCR 318

>Scas_713.45
          Length = 570

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           +LPCGH     CL  W +   TCP+CR
Sbjct: 232 KLPCGHIFGRECLYRWCKLENTCPLCR 258

>Scas_573.9
          Length = 1502

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRL 399
            C +C+ D+            L CGHF    C+ +W++  + CP+C++
Sbjct: 1191 CSICLQDI-------SLGSMLKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 363 EEHKKKKAK-------RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           EEHK+K +        +L CGH     C+  W +   +CPICR  +    G
Sbjct: 122 EEHKEKPSPEYKHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 172

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPV 401
            C VC +++            + CGHF   SC+  W++   TCP+C+  V
Sbjct: 1165 CAVCFNEIFV-------GSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1206

>Kwal_56.23900
          Length = 589

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 30/78 (38%), Gaps = 3/78 (3%)

Query: 329 KNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM 388
           +N    D +     PE  Q  DN      DD     +K    + LPC H     C++ W 
Sbjct: 184 QNGPANDGETASSPPEQEQPKDNEN--SGDDQGKVTYKHSPVQ-LPCSHVFGRECIRQWT 240

Query: 389 ERSQTCPICRLPVFDESG 406
               TCPICR  +    G
Sbjct: 241 NLHNTCPICRANIVGADG 258

>Scas_625.11
          Length = 274

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 337 KLPDMIPEDLQDSDNVCIVCM----DDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS 391
           +LP     +L +S + C +C     DD  +E         LP C H  H  C+K W++++
Sbjct: 194 QLPRTNCAELSNSSDECPICRIAYSDDFETE------ITCLPNCSHHFHFECIKLWLQKN 247

Query: 392 QTCPICRLPVFD 403
             CP+CR  V +
Sbjct: 248 SLCPLCRDNVME 259

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +++    C++C++ +L            PCGH     C+  W    Q CP+CR
Sbjct: 248 IKEDSRKCVLCLNYMLDPSAT-------PCGHLFCWDCIMEWTLERQECPLCR 293

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           CI+C+ ++            LPCGH     C+ +W + +  CP+CR
Sbjct: 277 CILCLMEMTDPSC-------LPCGHVFCWDCITDWTKENPECPLCR 315

>Kwal_26.8090
          Length = 520

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 337 KLPDMIPEDLQDSD-NVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
           K P    +++QD++   C VC++ L SE         +PC H  H  CL  W +    CP
Sbjct: 210 KDPFTAKKEVQDTELPTCPVCLERLDSE---VTGLATIPCQHTFHCVCLNKWGD--NRCP 264

Query: 396 ICR 398
           +CR
Sbjct: 265 VCR 267

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 375  CGHFLHLSCLKNWMERSQTCPICRLPV 401
            CGH    SC+ +W++  +TCP+C+ P 
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 12/63 (19%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
           ++LP  IPE    +   CI+C+ ++             PCGH    SCL +W +    CP
Sbjct: 274 NQLP-FIPE----ASRKCILCLMNMSDPSCA-------PCGHLFCWSCLMSWCKERPECP 321

Query: 396 ICR 398
           +CR
Sbjct: 322 LCR 324

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 35.8 bits (81), Expect = 0.017,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 55  CIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPLDNQP 102

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score = 36.2 bits (82), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +P     +++ C +C  + L + +    AK   C H   L CL  W++ + TCP+CR
Sbjct: 60  VPNSKLKAEDTCAICQCNFLDDPYPLV-AKVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>Kwal_55.19999
          Length = 152

 Score = 36.2 bits (82), Expect = 0.019,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 11/57 (19%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           IP D +     CI+C+  +L            PCGH     CL +W      CP+CR
Sbjct: 95  IPSDSRK----CILCLGFMLDPSCA-------PCGHVFCWKCLLSWCNERPECPLCR 140

>Kwal_55.22054
          Length = 111

 Score = 35.4 bits (80), Expect = 0.019,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 56  CIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPLDNQP 103

>Scas_615.13
          Length = 330

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 330 NNKNL-DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM 388
           N+ NL D ++   IPED +     CI+C+  +             PCGH     C+ +W 
Sbjct: 260 NHLNLSDKEIFPFIPEDARK----CILCLAYMTDPSCS-------PCGHIFCWECILDWC 308

Query: 389 ERSQTCPICR 398
           +    CP+CR
Sbjct: 309 KERPECPLCR 318

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           +LPCGH     C+  W     +CP+CR  + +  G
Sbjct: 254 KLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG 288

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 35.8 bits (81), Expect = 0.027,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 36/88 (40%), Gaps = 24/88 (27%)

Query: 324 LFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP--------- 374
           ++ I KN   LD  + D       + ++VC +C     +  H      R P         
Sbjct: 15  VWDIPKNEDRLDESMAD-------EDEDVCGICR----ASYHAPCPNCRYPGESCAIVLG 63

Query: 375 -CGHFLHLSCLKNWMERSQT---CPICR 398
            CGH  H+ C+  W++   +   CP+CR
Sbjct: 64  RCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 37.0 bits (84), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR
Sbjct: 239 TCPVCLERMDSE---TTGLVTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>Scas_585.5*
          Length = 109

 Score = 34.7 bits (78), Expect = 0.038,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 54  CIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQP 101

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 34.3 bits (77), Expect = 0.045,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           CI C  + +++   +  A    C H  HL C+  W+     CP+
Sbjct: 53  CIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>Kwal_14.1287
          Length = 1518

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRL 399
            C +C+ ++            + CGHF    C+ +W++   +CP+C++
Sbjct: 1189 CTICLGEIY-------MGSVIKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>Kwal_55.21206
          Length = 275

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 7/64 (10%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMER-SQTC 394
           SK+  + P    DS   C +C +D     +K      L C H  H  C+  W+ R S  C
Sbjct: 105 SKVESLGPG--ADSRTTCAICQEDF----NKLNNVCLLGCNHVFHTYCIDQWICRNSACC 158

Query: 395 PICR 398
           P+C+
Sbjct: 159 PLCK 162

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C +C+ D+            +  GHF    C+ +W+E  Q+CP+C+
Sbjct: 1219 CTICLCDICD-------GAIIGRGHFYCQECISSWLETKQSCPLCK 1257

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 34.3 bits (77), Expect = 0.064,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 113

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +C VC++ L SE          PC H  H  CL  W  ++  CP+CR
Sbjct: 214 MCPVCLEKLDSE---VTGLVTTPCQHTFHCKCLDQW--KNGNCPVCR 255

>Scas_560.6*
          Length = 118

 Score = 33.5 bits (75), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 375 CGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESE 412
           C H   L C+  W+ +S TCP+CR  V +   N+  S+
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSK 107

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
           Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICR 398
           +C +C++ +    ++  + + LPC H  H+SC++ W   S    CP CR
Sbjct: 4   ICGICLESM----NETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICR 398
            + CGH+   SC+  W+     CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 375 CGHFLHLSCLKNWMERS--QTCPICRL 399
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>Kwal_56.23112
          Length = 135

 Score = 32.7 bits (73), Expect = 0.26,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 375 CGHFLHLSCLKNWMERSQT---CPICR 398
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>YOL138C (YOL138C) [4686] chr15 complement(61324..65349) Possible
            component of a glycogen synthase kinase, homozygous
            diploid null mutant accumulates glycogen [4026 bp, 1341
            aa]
          Length = 1341

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM--ERSQTCP 395
            C++C   L     KK     LPCGH  H  C++ W   E  Q CP
Sbjct: 1293 CVLCERPL-----KKLTMVILPCGHEGHFQCIQEWFLDENEQECP 1332

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
           cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 32.3 bits (72), Expect = 0.26,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 19/48 (39%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           C+ C  +       +  A    C H  HL C+  W++    CP+   P
Sbjct: 55  CVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPLDNKP 102

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1508 CAICYS-ILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCR 1555

>Kwal_26.8030
          Length = 660

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 32.3 bits (72), Expect = 0.51,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 375 CGHFLHLSCLKNWMERSQT---CPICR 398
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICRL 399
            C +C++ L      +   + + C H  HL C++ W   SQ   CP CR+
Sbjct: 5   TCSICLEAL-----GQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>CAGL0L06336g 713059..714861 some similarities with sp|P32917
           Saccharomyces cerevisiae YDR103w STE5 pheromone signal
           transduction pathway protein, hypothetical start
          Length = 600

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 350 DNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +++C +C D+ ++ +   +K   L CGH  H+ CL  ++  S   PIC+
Sbjct: 37  NHICTLC-DEPIAYKSGGEKVIELECGHMCHMDCLMLFV-NSTALPICK 83

>AAL039C [148] [Homologous to ScYDR313C (PIB1) - SH]
           (273886..274737) [852 bp, 283 aa]
          Length = 283

 Score = 32.7 bits (73), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 45/125 (36%), Gaps = 31/125 (24%)

Query: 266 ADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILF 325
           AD +G       E + +   R+     H+    P   PM             YQN +IL 
Sbjct: 164 ADLSGDPEDTAAEHVQNCIARATSVQQHLVCESPG--PMS------------YQN-RILV 208

Query: 326 QILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLK 385
            I+        +LP+            C +C +D+       +K  RL C    H  C++
Sbjct: 209 SIVPGYTEGGGRLPE------------CPICFEDM----EPGQKVGRLECLCVFHNECIQ 252

Query: 386 NWMER 390
            W+ER
Sbjct: 253 MWLER 257

>Scas_696.17
          Length = 1564

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K   K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1510 CAICYS-ILHAVDRKLPTKTCPTCKNKFHGACLYKWFRSSGNNTCPLCR 1557

>Kwal_47.16850
          Length = 273

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 18/88 (20%)

Query: 118 KIFYWILKDRLEFLI--------------QSNTNYSVSRFIFSKFYLNLIILSTINLQLI 163
           +IF W+L+  L+F+               Q  T+YS++  + S  YL LIIL  +   + 
Sbjct: 17  RIFLWVLRC-LQFMTSVATVGLLAYVMDTQGTTSYSLAISVISVVYLILIILIPVEANVY 75

Query: 164 KTCIPLNYEF-LKKLYLNSTSILQSLIN 190
             C+ L +EF +  L+L +  I+Q +I+
Sbjct: 76  AVCV-LVFEFVVASLWLGA-CIVQGIIS 101

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W + S   TCP+CR
Sbjct: 1492 CAICYS-ILHVVDRKLPSKVCPTCSNRFHGACLYKWFKSSGNNTCPLCR 1539

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharomyces
            cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 375  CGHFLHLSCLKNWMERSQTCPI---CRLP-VFD 403
            C H LHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c, start by similarity
          Length = 1544

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   L + + K        C +  H +CL  W   S   TCP+CR
Sbjct: 1490 CAICYSILHAVDRKLPTKTCSTCKNKFHGACLYKWFRSSGNNTCPLCR 1537

>Kwal_27.12327
          Length = 1574

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1520 CAICYS-ILHAVDRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCR 1567

>KLLA0E18601g complement(1645113..1647065) some similarities with
           ca|CA2706|IPF11006 Candida albicans unknown function,
           hypothetical start
          Length = 650

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           PCGH +H  C   +++ S  CP C + V
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSV 417

>Kwal_56.23543
          Length = 965

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 7/52 (13%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTC------PICR 398
           C +C++  +S     +K   L CGH +H  CL  + E   +C      P CR
Sbjct: 162 CCLCLE-YISCRTVGEKVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 4/31 (12%)

Query: 375 CGHFLHLSCLKNWMERSQ----TCPICRLPV 401
           CGH     C+ NW+  +     TCP CR  V
Sbjct: 9   CGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>KLLA0E06435g complement(581935..584832) similar to sp|P38164
           Saccharomyces cerevisiae YBL104c singleton, hypothetical
           start
          Length = 965

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 342 IPEDLQDSDNVCIVCMDD--LLSEEHKKKKAKR-------LPCGHFLHLSCLKNWMERSQ 392
           +P  +  + N C V +DD   ++E  ++K+ K        L C H +H    + W ER  
Sbjct: 893 LPIVINGTTNSCEVRIDDDAKINEVKERKRLKMNEWFSFCLKCNHGMHAGHAEEWFERHS 952

Query: 393 TCPI 396
            CP+
Sbjct: 953 ICPV 956

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
           (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 375 CGHFLHLSCLKNWMERSQT---CPICR 398
           C H  H+ C+  W+  S +   CP+CR
Sbjct: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPIC 397
           C +C D L       K +   PCGH     C++ ++++   CP+C
Sbjct: 32  CHICKDFL-------KASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>Kwal_27.10419
          Length = 300

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)

Query: 375 CGHFLHLSCLKNWMERSQ----TCPICRLPV 401
           CGH     C+ NW+  +     TCP CR P+
Sbjct: 9   CGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>Scas_610.17
          Length = 1305

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query: 272 ENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDI---IWDLISLYQNCK------ 322
           E K  ++ I D   ++    +   + +P  +   + +D    +WDL  ++ N K      
Sbjct: 243 EKKQQFDAIFDSLDKNHEGALTADILVPFFVSSKLSQDTLATVWDLADIHNNAKFTKLEF 302

Query: 323 --ILFQILKNNKNLDSKLPDMIPEDL 346
              +F I K N  +D  LPD++P+ L
Sbjct: 303 AIAMFLIQKKNSGID--LPDVVPDQL 326

>YDR103W (STE5) [952] chr4 (658344..661097) Pheromone pathway
           scaffolding protein involved in a complex with Fus3p,
           Ste7p, and Ste11p [2754 bp, 917 aa]
          Length = 917

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCL 384
           C +C D+ +S   K +K   L CGH  H  CL
Sbjct: 177 CTLC-DEPISNRRKGEKIIELACGHLSHQECL 207

>KLLA0E05742g 515081..518767 weakly similar to sp|P34216
           Saccharomyces cerevisiae YBL047c singleton, start by
           similarity
          Length = 1228

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 271 LENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDI---IWDLISLYQN---CKIL 324
           LE K  ++ I D   +     +  ++ +P  L   + +D+   +WDL  ++ +    K+ 
Sbjct: 309 LEKKQQFDAIFDSLDKEKKGSLGSNVLVPFFLTSKLGQDVLATVWDLADIHNSPVFTKVE 368

Query: 325 FQI---LKNNKNLDSKLPDMIPEDL 346
           F I   L   KN   +LPD++P+ L
Sbjct: 369 FAIAMFLIQKKNAGIELPDVVPDQL 393

>KLLA0E07568g 685564..686559 weakly similar to sp|Q04370
           Saccharomyces cerevisiae YMR026c PEX12 required for
           biogenesis of peroxisomes - peroxin singleton, start by
           similarity
          Length = 331

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 338 LPDMIPE-DLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           LP +  E D  D+ +VC +C +++        +   +  G+  +L C K W+    TC  
Sbjct: 265 LPGVASEVDNNDTTDVCPLCGEEI-------TEPAMISSGYVANLECAKKWVSTENTCFA 317

Query: 397 CRLPV 401
             +P+
Sbjct: 318 TGVPI 322

>CAGL0F04609g 463702..467637 similar to sp|P34216 Saccharomyces
           cerevisiae YBL047c, start by similarity
          Length = 1311

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query: 272 ENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDI---IWDLISLYQNCK------ 322
           E K  ++ I D   ++    +   + +P  L   + ++    +WDL  ++ N +      
Sbjct: 276 EKKAQFDAIFDALDKNHAGALGSQILVPFFLSSKLSQETLASVWDLADIHNNAEFTKLEF 335

Query: 323 --ILFQILKNNKNLDSKLPDMIPEDL 346
              +F I K N  +D  LPD+IP +L
Sbjct: 336 AIAMFLIQKKNSGID--LPDVIPNEL 359

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
            Saccharomyces cerevisiae YLL015w BPT1, hypothetical start
          Length = 1535

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 445  IQETLEPEEASIDNNTWYSFPITHINKDKSVISFELRDDKESSETVQL 492
            I+  L+P E   D++ W++  ++H+      I+ E+ DD E S+  +L
Sbjct: 1367 IRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEINDDSEYSDRSRL 1414

>CAGL0H07315g <715897..716766 similar to tr|Q06651 Saccharomyces
           cerevisiae YDR313c PIB1
          Length = 289

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 5/63 (7%)

Query: 331 NKNLDSKLPDMI-PEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWME 389
           N+ L  K+P    PE+       C +C ++++  E    K  RL C    H SC+K+W  
Sbjct: 211 NRMLVYKIPTTTAPENEPQGYQECPICFEEMVPGE----KVGRLECLCVYHYSCIKSWFR 266

Query: 390 RSQ 392
           + +
Sbjct: 267 KKR 269

>Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement
          Length = 1353

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%)

Query: 373  LPCGHFLHLSCLKNWM--ERSQTCPICRLPVF 402
            L CGH  H  C K W   E  Q CP   L V 
Sbjct: 1321 LNCGHEGHFECFKKWFLEENMQECPGGCLGVL 1352

>AAL146W [41] [Homologous to ScYGR184C (UBR1) - SH]
            complement(92509..98211) [5703 bp, 1900 aa]
          Length = 1900

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 12/63 (19%)

Query: 346  LQDSDNVCIVCMDDL----LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ------TCP 395
            + D DN+     DDL    L E  K      + C H +H  C + ++++ +       CP
Sbjct: 1235 VNDDDNLTF--YDDLKLYSLQEARKGSTTTFVSCNHIIHYECFRRYIQKKRFSNNLFICP 1292

Query: 396  ICR 398
            +C+
Sbjct: 1293 LCQ 1295

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 342 IPEDLQDSDNV--CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPIC 397
           +P+ LQ+ D++  C +C D L       K     PCGH     C++ ++     CP+C
Sbjct: 15  VPQ-LQELDDLLRCHICKDFL-------KNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomyces
            cerevisiae YOL138c, hypothetical start
          Length = 1321

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 2/26 (7%)

Query: 373  LPCGHFLHLSCLKNWM--ERSQTCPI 396
            L CGH  H  CLK W   E    CP+
Sbjct: 1289 LNCGHEGHFECLKKWFFDENMDVCPL 1314

>Sklu_2418.6 YBL047C, Contig c2418 10006-13899 reverse complement
          Length = 1297

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 11/79 (13%)

Query: 276 IYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCK--------ILFQI 327
           I++ +    T SL + + +   L   L    L   +WDL  ++ N +         +F I
Sbjct: 273 IFDSLDKFKTGSLNSQVLVPFFLTSRLSQETLA-TVWDLADIHNNAEFTKVEFAIAMFLI 331

Query: 328 LKNNKNLDSKLPDMIPEDL 346
            K N  +D  LPD++P+ L
Sbjct: 332 QKKNNGVD--LPDVVPDQL 348

>KLLA0C14542g 1272215..1273195 weakly similar to sgd|S0002721
           Saccharomyces cerevisiae YDR313c PIB1
           phosphatidylinositol(3)-phosphate binding protein, start
           by similarity
          Length = 326

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 20/73 (27%)

Query: 318 YQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGH 377
           YQN  +++QI KN  N+                  C +C +++       +K  RL C  
Sbjct: 242 YQNRMLVYQIPKNATNIQE----------------CPICFEEMAP----GQKVGRLECLC 281

Query: 378 FLHLSCLKNWMER 390
             H  C+K+W ++
Sbjct: 282 VFHYHCIKSWFKK 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,484,459
Number of extensions: 588778
Number of successful extensions: 2577
Number of sequences better than 10.0: 110
Number of HSP's gapped: 2625
Number of HSP's successfully gapped: 112
Length of query: 510
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 404
Effective length of database: 12,926,601
Effective search space: 5222346804
Effective search space used: 5222346804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)