Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_644.1127227212741e-179
YOL009C (MDM12)2712687429e-99
CAGL0E02365g2572577211e-95
Sklu_2419.42992496744e-88
Kwal_56.224972802596631e-86
ACL013C2632386438e-84
KLLA0C06028g3052396433e-83
Scas_638.2445564920.001
CAGL0D05698g43160790.046
AAL166C444123770.098
KLLA0F15796g434142750.17
CAGL0L09625g28068730.24
Kwal_33.15169442133730.26
YBR067C (TIP1)21089690.71
Scas_705.42767116691.0
YLL006W (MMM1)42656671.4
KLLA0B04708g149087671.7
Sklu_2275.545469671.8
KLLA0D05929g409131652.8
Scas_719.381428126653.0
YML072C1545140644.4
Scas_688.623997625.6
Scas_717.4098893627.4
CAGL0A02112g54859619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_644.11
         (272 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_644.11                                                           495   e-179
YOL009C (MDM12) [4807] chr15 complement(309324..310139) Mitochon...   290   9e-99
CAGL0E02365g complement(226360..227133) similar to sp|Q92328 Sac...   282   1e-95
Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement        264   4e-88
Kwal_56.22497                                                         259   1e-86
ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH] (335717..3...   252   8e-84
KLLA0C06028g complement(532044..532961) some similarities with s...   252   3e-83
Scas_638.24                                                            40   0.001
CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces c...    35   0.046
AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315...    34   0.098
KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces...    33   0.17 
CAGL0L09625g complement(1031563..1032405) similar to sp|P38637 S...    33   0.24 
Kwal_33.15169                                                          33   0.26 
YBR067C (TIP1) [257] chr2 complement(372063..372695) Cold- and h...    31   0.71 
Scas_705.42                                                            31   1.0  
YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential f...    30   1.4  
KLLA0B04708g complement(425404..429876) similar to sp|Q03640 Sac...    30   1.7  
Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement         30   1.8  
KLLA0D05929g 507555..508784 highly similar to sp|P07267 Saccharo...    30   2.8  
Scas_719.38                                                            30   3.0  
YML072C (TCB3) [3897] chr13 complement(124730..129367) Protein c...    29   4.4  
Scas_688.6                                                             28   5.6  
Scas_717.40                                                            28   7.4  
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    28   9.6  

>Scas_644.11
          Length = 272

 Score =  495 bits (1274), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 250/272 (91%), Positives = 250/272 (91%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT
Sbjct: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60

Query: 61  DPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEFIK 120
           DPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEFIK
Sbjct: 61  DPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEFIK 120

Query: 121 LPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKKPF 180
           LPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKKPF
Sbjct: 121 LPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKKPF 180

Query: 181 ERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLDLXX 240
           ERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLDL  
Sbjct: 181 ERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLDLSG 240

Query: 241 XXXXXXXXXXXXXXXXXXXXQSDGGSDETSIS 272
                               QSDGGSDETSIS
Sbjct: 241 DNNEEESIGGEEEEGTGDEIQSDGGSDETSIS 272

>YOL009C (MDM12) [4807] chr15 complement(309324..310139)
           Mitochondrial inheritance protein which may function in
           a complex with Mdm10p at the mitochondrial surface [816
           bp, 271 aa]
          Length = 271

 Score =  290 bits (742), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 141/268 (52%), Positives = 187/268 (69%), Gaps = 32/268 (11%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MSF+INWS + SD  +++ ++ HL+SYLQN  LPS+V+NL++ DF  G + P I LKEIT
Sbjct: 1   MSFDINWSTLESDNRLNDLIRKHLNSYLQNTQLPSYVSNLRVLDFDLGKVGPAITLKEIT 60

Query: 61  DPLPDFYESVNE----------------------GLVEGDEG--------WTIPSPSDTQ 90
           DPL +FY+S+ E                        +   EG          +PSP+D Q
Sbjct: 61  DPLDEFYDSIREEADQETEENNDNKEDSEHICPDRTIANHEGPKDDFEAPVVMPSPNDIQ 120

Query: 91  FLIEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSIL 150
           FL+EVEYKGDL VT+  +LVLNYP ++F+ LP+KL++++IG HSLC+VA L+KQ+F+S L
Sbjct: 121 FLLEVEYKGDLLVTIGADLVLNYPVEKFMTLPVKLSISDIGLHSLCIVACLSKQLFLSFL 180

Query: 151 CDVSDPILDEQNSEPLLDPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVG 210
           CDVSDP LD+  +  +LDP G  +A  KP ERISI+RSM I+TEIG+QYQG+GS L++VG
Sbjct: 181 CDVSDPALDDNQT--VLDPKGPILAATKPLERISIVRSMKIETEIGEQYQGQGSVLRSVG 238

Query: 211 KLEQFLLEKFKDLLRKEIAWPSWINLDL 238
           +LEQFL   FKD LRKE+AWPSWINLD 
Sbjct: 239 ELEQFLFTIFKDFLRKELAWPSWINLDF 266

>CAGL0E02365g complement(226360..227133) similar to sp|Q92328
           Saccharomyces cerevisiae YOL009c MDM12, start by
           similarity
          Length = 257

 Score =  282 bits (721), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 131/257 (50%), Positives = 185/257 (71%), Gaps = 21/257 (8%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MSF INW ++ SD+ ++  +++ L+ Y Q + LPS+V  +++ DF FG IAP I L+EI+
Sbjct: 1   MSFEINWEKLSSDSDLTSNIREGLNGYFQELELPSYVRAIELVDFGFGKIAPNITLREIS 60

Query: 61  DPLPDFYESVNEGLVE-------------------GDEGWTIPSPSDTQFLIEVEYKGDL 101
            PL DFY++VNE   E                   G+E       +DTQFLIE EYKGD+
Sbjct: 61  SPLQDFYDAVNEEYEEDNETSSEMHGRDGQNVGESGEEAVVEKKETDTQFLIEFEYKGDM 120

Query: 102 FVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQ 161
            +T++ ELVLNYP + F+ LP+K++++NIG HSLCLV+YLAKQ+F+S+LCDVSDP+LD+ 
Sbjct: 121 SLTLTAELVLNYPVERFMTLPLKISISNIGLHSLCLVSYLAKQVFISMLCDVSDPVLDDV 180

Query: 162 NSEPLLDPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFK 221
           +   +LDPNG  +   KP ERISIIRSM I+TEIG +++ +GSTL++VG+LE+F+++K K
Sbjct: 181 DC--VLDPNGPVLLANKPLERISIIRSMKIETEIGDRFKDDGSTLRSVGQLEEFIVQKLK 238

Query: 222 DLLRKEIAWPSWINLDL 238
           D LRKE+AWPSW+NLD 
Sbjct: 239 DFLRKELAWPSWVNLDF 255

>Sklu_2419.4 YOL009C, Contig c2419 5114-6013 reverse complement
          Length = 299

 Score =  264 bits (674), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 180/249 (72%), Gaps = 15/249 (6%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MSF INW ++  D  I++++KD  + +L+++SLPS+VNN+++T+FS G I P I LK+I 
Sbjct: 19  MSFEINWDKLQEDTRINQSIKDFFNDHLRSISLPSYVNNVQVTNFSLGNIPPHITLKQID 78

Query: 61  DPLPDFYESV----NEGL------VEGDEGWTI---PSPSDTQFLIEVEYKGDLFVTMSG 107
           DPL +FY  +    NE +      +E D    I      +D QFL+E++YKGD+ + +  
Sbjct: 79  DPLEEFYGYISKESNEKIESTSDEIEHDPQCPIVMDGKQNDIQFLVEIDYKGDMLIEVGA 138

Query: 108 ELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLL 167
           ELVLNYPS  F+ LP+KL++++IG HSLCL+AYL+KQ+F+S LCDVSDPILD  NSE +L
Sbjct: 139 ELVLNYPSPTFMTLPVKLSISDIGMHSLCLIAYLSKQLFISFLCDVSDPILD--NSESIL 196

Query: 168 DPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKE 227
           D NG     K+  ERIS+IRS+ I +EIG+   GEGSTL++VGKLEQFL+E F++ LRKE
Sbjct: 197 DTNGPNFMSKRSLERISLIRSIKIQSEIGEYKDGEGSTLRSVGKLEQFLVEIFRNALRKE 256

Query: 228 IAWPSWINL 236
            AWPSWINL
Sbjct: 257 AAWPSWINL 265

>Kwal_56.22497
          Length = 280

 Score =  259 bits (663), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 175/259 (67%), Gaps = 23/259 (8%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MSF INW  +G D  ++ ++KD L+S+LQ++SLPS+V +L++TDF  G   P I L+EI+
Sbjct: 1   MSFEINWESLGEDPIVNNSIKDFLNSHLQSISLPSYVGSLRVTDFCLGCTPPKITLREIS 60

Query: 61  DPLPDFYESV-NEGLVEGDEGWTI--------------------PSPSDTQFLIEVEYKG 99
           +PL +FYE + NE L +  E  +                      S SD QFL+E++YKG
Sbjct: 61  NPLEEFYEHISNERLADEIEASSSNLRGEDHFHGENDDSGKDEKDSDSDLQFLVEIDYKG 120

Query: 100 DLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILD 159
           D+ +T+S EL LNYPS  F+ LP+KL ++++G H+LCLVAYL+KQ+F+S LCDV+DPILD
Sbjct: 121 DMLITVSAELALNYPSPHFMTLPVKLTISDLGMHALCLVAYLSKQLFISFLCDVADPILD 180

Query: 160 EQNSEPLLDPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEK 219
            Q S   +D         +  ERIS+IRS+ ID+EIG+Q   EGS L++VG+LEQFLLE 
Sbjct: 181 AQESN--IDTGSAAFLGNRSLERISLIRSIKIDSEIGEQNSAEGSVLRSVGRLEQFLLEV 238

Query: 220 FKDLLRKEIAWPSWINLDL 238
           F+ +L+ E AWPSWINLD 
Sbjct: 239 FRTILKTEAAWPSWINLDF 257

>ACL013C [1036] [Homologous to ScYOL009C (MDM12) - SH]
           (335717..336511) [795 bp, 264 aa]
          Length = 263

 Score =  252 bits (643), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 126/238 (52%), Positives = 169/238 (71%), Gaps = 8/238 (3%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MSF+INW++I  D++I++  +  L+ +L+++ LPS+V+N+K+TDF  G I P I LK+I 
Sbjct: 1   MSFDINWNKINEDSTINQRARAFLNEHLESLQLPSYVSNIKMTDFKLGTIPPRITLKQID 60

Query: 61  DPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEFIK 120
           +PL DFYE++        EG +I    D QFL+EV+YKGD+ + +S ELVLNYPS  F++
Sbjct: 61  NPLDDFYEALRL------EGASIGGRDDVQFLMEVDYKGDMLIELSAELVLNYPSPNFMQ 114

Query: 121 LPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKKPF 180
           LP+KL +++I  HSLCLVAYL +Q+F+S L  VSD  LD  N E  LD NG      K  
Sbjct: 115 LPVKLTISDIAIHSLCLVAYLQRQLFISFLGHVSDHALD--NVESPLDSNGPAFLGSKAV 172

Query: 181 ERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLDL 238
           ERIS+IRS+ I TEIG Q   EG+ L++VGKLEQFL + FK+LLRKE AWPSWINLD 
Sbjct: 173 ERISLIRSIKIQTEIGPQDLSEGTILRSVGKLEQFLSDVFKNLLRKEAAWPSWINLDF 230

>KLLA0C06028g complement(532044..532961) some similarities with
           sp|Q92328 Saccharomyces cerevisiae YOL009c MDM12
           involved in mitochondrial inheritance singleton,
           hypothetical start
          Length = 305

 Score =  252 bits (643), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 173/239 (72%), Gaps = 7/239 (2%)

Query: 1   MSFNINWSEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEIT 60
           MS  I+W  I  D S+++ VKD L+S LQ   LPS+VNNLK+T+F  G + P +ILK++ 
Sbjct: 1   MSVEIDWDNIRGDLSVNQGVKDFLNSRLQEFELPSYVNNLKVTNFDLGTMPPNVILKQMD 60

Query: 61  DPLPDFYESVNEGLVEGD--EGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEF 118
           DPL +FY  +   L EGD  +       +D Q L+E++YKGD+ + +S +LVLNYPS +F
Sbjct: 61  DPLDEFYSYL---LQEGDISKEAAKDKNTDVQLLVELDYKGDMSIELSADLVLNYPSPQF 117

Query: 119 IKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQNSEPLLDPNGTFMAPKK 178
           + LP+KL +++IG H LCL+AYL KQ+F+S LCDVSDP+L  +N +  +DP+G     K+
Sbjct: 118 MILPVKLRISDIGMHCLCLLAYLKKQLFISFLCDVSDPLL--ENDKLQVDPSGPNFMGKR 175

Query: 179 PFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKFKDLLRKEIAWPSWINLD 237
             ERIS+IR++ I TE+GQ  QGEGS L++VGKLE+FL++ F++L+RKE AWPSWI+LD
Sbjct: 176 ALERISLIRNIKIHTELGQLDQGEGSVLRSVGKLEEFLVDLFRNLIRKEAAWPSWIDLD 234

>Scas_638.24
          Length = 455

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%)

Query: 90  QFLIEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSI 149
           Q  I+++    L   +  EL+LNYP   F  LPIKL V  + F     V++   + F+S 
Sbjct: 289 QAKIDIDMNDRLAFGVETELMLNYPRAAFATLPIKLNVAIVRFQGCLNVSFTTAEDFISK 348

Query: 150 LCDV 153
             D 
Sbjct: 349 SSDT 352

>CAGL0D05698g 541045..542340 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1, start by similarity
          Length = 431

 Score = 35.0 bits (79), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 84  PSPSDTQF--LIEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYL 141
           P+ SD +    I+++    +   MS  L+LNYP +    LPI LAV+ + F + CL   L
Sbjct: 265 PNSSDKKLEAKIDIDLNDKITFGMSTRLLLNYPKKCTAALPIDLAVSMVRFQA-CLTVSL 323

>AAL166C [21] [Homologous to ScYLL006W (MMM1) - SH] (50981..52315)
           [1335 bp, 444 aa]
          Length = 444

 Score = 34.3 bits (77), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 51/123 (41%), Gaps = 19/123 (15%)

Query: 33  LPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFYESVNEGLVEGDEGWTIPSPSDTQFL 92
           LP++++ +KIT+   G   P      I    P     +N+  +E                
Sbjct: 247 LPNYLDAVKITELDIGDDFPIFSNCRIKYSPP-----LNKKRLEAK-------------- 287

Query: 93  IEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCD 152
           I+++    L + +   L++NYP      LP+KL V+ + F +   V+    + FV  +  
Sbjct: 288 IDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTVSLTTAEEFVPTMAA 347

Query: 153 VSD 155
            +D
Sbjct: 348 TTD 350

>KLLA0F15796g 1459596..1460900 similar to sp|P41800 Saccharomyces
           cerevisiae YLL006w MMM1 required for mitochondrial shape
           and structure singleton, start by similarity
          Length = 434

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 60/142 (42%), Gaps = 27/142 (19%)

Query: 33  LPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFYESVNEGLVEGDEGWTIPSPSDTQFL 92
           LP +++ +KIT+   G   P       ++ +  +  + N+  +E                
Sbjct: 237 LPQYLDQIKITEVDIGDDFPIF-----SNCIIQYSPNSNKKRLEAK-------------- 277

Query: 93  IEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCD 152
           I+++    L + +  +L+LNYP      LPIKL V+ + F +   V+    + FV     
Sbjct: 278 IDIDLSDRLALGIETKLLLNYPKPFSAALPIKLTVSIVRFQACLTVSLTTDEQFV----- 332

Query: 153 VSDPILDEQNSEPLLDPNGTFM 174
              P  +E N + + +  G ++
Sbjct: 333 ---PTSEETNDDEMGNDKGYYL 351

>CAGL0L09625g complement(1031563..1032405) similar to sp|P38637
           Saccharomyces cerevisiae YIR011c STS1, hypothetical
           start
          Length = 280

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%)

Query: 161 QNSEPLLDPNGTFMAPKKPFERISIIRSMNIDTEIGQQYQGEGSTLKNVGKLEQFLLEKF 220
           +   P L+  G  + P++  E +S  + M++  E+ +Q+   GST +      QF  EK+
Sbjct: 33  RKRRPALNVQGQPLPPQRSLEMMSKDQLMSVLMEVMRQHPEVGSTFQAKVSSYQFASEKY 92

Query: 221 KDLLRKEI 228
           + LL+ ++
Sbjct: 93  QQLLKGKV 100

>Kwal_33.15169
          Length = 442

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 60/133 (45%), Gaps = 21/133 (15%)

Query: 15  SISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFYESVNEGL 74
           +I  ++ D++S   ++  LP +++++KIT+   G   P      I      +  + N+  
Sbjct: 232 NIVHSLNDYISR--KSEELPQYLDSIKITELDIGEDFPIFSNCRIQ-----YSPNSNKQR 284

Query: 75  VEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHS 134
           +E                I+++    L + +  +L++NYP      LP++L V+ + F +
Sbjct: 285 LEAK--------------IDIDLSDRLALGIETKLLINYPKPFTAALPVQLTVSVVRFQA 330

Query: 135 LCLVAYLAKQIFV 147
              V+  A + FV
Sbjct: 331 CLTVSLTAAEEFV 343

>YBR067C (TIP1) [257] chr2 complement(372063..372695) Cold- and
           heat-shock induced mannoprotein of the cell wall, member
           of the seripauperin (PAU) family [633 bp, 210 aa]
          Length = 210

 Score = 31.2 bits (69), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 35  SFVNNLKITDFSFGAIAP-TIILKEITDPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLI 93
           S + +L + D S    A    I+ +I   L D+      GL  G+ G+ IPS   + +  
Sbjct: 11  SAIASLAVADTSAAETAELQAIIGDINSHLSDYL-----GLETGNSGFQIPSDVLSVYQQ 65

Query: 94  EVEYKGDLFVTMSGELVLNYPSQEFIKLP 122
            + Y  D + T+  EL  +  ++  +KLP
Sbjct: 66  VMTYTDDAYTTLFSELDFDAITKTIVKLP 94

>Scas_705.42
          Length = 767

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 53/116 (45%), Gaps = 26/116 (22%)

Query: 15  SISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFYESVNEGL 74
           ++++A+ + +   L  ++ P F++NL + +   G  AP I         P   E   EGL
Sbjct: 302 TLNKALLEKVHKKLNKINKPGFLDNLVVEEIDVGTSAPFIT-------NPSLREISPEGL 354

Query: 75  VEGDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGELVLNY-----PSQEFIKLPIKL 125
                         T+  + ++YKG+L V +S ++ +N      P +  ++L IK+
Sbjct: 355 --------------TKIALNLQYKGNLSVIISTKVNINLGSRFKPREVSVQLAIKV 396

>YLL006W (MMM1) [3413] chr12 (136585..137865) Protein essential for
           establishment and maintenance of mitochondrial shape and
           structure, involved in coupling mitochondria to the
           actin cytoskeleton, required for maintenance of
           mitochondrial genome [1281 bp, 426 aa]
          Length = 426

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 93  IEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVS 148
           I+++    L + +  +L+LNYP      LPI L V+ + F +   V+    + F S
Sbjct: 278 IDIDLNDHLTLGVETKLLLNYPKPGIAALPINLVVSIVRFQACLTVSLTNAEEFAS 333

>KLLA0B04708g complement(425404..429876) similar to sp|Q03640
           Saccharomyces cerevisiae YML072c, start by similarity
          Length = 1490

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query: 16  ISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFYESVNEGLV 75
           +S+ VKD ++  L  V+    ++ L + +F+ G  APTI      D +   Y    +G+V
Sbjct: 260 LSQQVKDAVNPQLAGVAPGYGIDALSLNEFTLGTKAPTI------DAIKS-YTKKGDGVV 312

Query: 76  EGDEGWTIP-SPSDTQFLIEVEYKGDL 101
           E D  WT+  +P+D   +   E K  +
Sbjct: 313 EMD--WTVSFTPNDESNMTPKEAKNKI 337

>Sklu_2275.5 YLL006W, Contig c2275 7968-9332 reverse complement
          Length = 454

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%)

Query: 93  IEVEYKGDLFVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCD 152
           I+++    L + +  +L++NYP      LP++L V+ + F +   V+    + FV     
Sbjct: 297 IDIDLSDRLALGIETKLLMNYPKPFTAALPVQLTVSIVRFQACLTVSLTTDEEFVPTSAT 356

Query: 153 VSDPILDEQ 161
             D I +E+
Sbjct: 357 GYDAIDNEK 365

>KLLA0D05929g 507555..508784 highly similar to sp|P07267
           Saccharomyces cerevisiae YPL154c PEP4 aspartyl protease,
           start by similarity
          Length = 409

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 51/131 (38%), Gaps = 17/131 (12%)

Query: 103 VTMSGELVLN-----YPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPI 157
           V   GE  LN     YP + F K  + + V   G HS+ L  YL  Q F  I    S P 
Sbjct: 49  VAQLGEKYLNSFQRAYPQESFSKDNVDVFVAPEGSHSVPLTNYLNAQYFTEITLG-SPP- 106

Query: 158 LDEQNSEPLLDPNGTFM-APKKPFERISIIRSMNIDTEIGQQYQGEGSTLK---NVGKLE 213
              Q+ + +LD   + +  P      ++       D E    Y+  GS        G LE
Sbjct: 107 ---QSFKVILDTGSSNLWVPSAECGSLACFLHTKYDHEASSTYKANGSEFAIQYGSGSLE 163

Query: 214 QFLLEKFKDLL 224
            ++    +DLL
Sbjct: 164 GYVS---RDLL 171

>Scas_719.38
          Length = 1428

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 48/126 (38%), Gaps = 8/126 (6%)

Query: 42   ITDFSFGAIAPTIILKEITDPLPDFYESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDL 101
            +T    G+  P +   E+ DP    Y + + G +E D     P     ++ I  E   D 
Sbjct: 1198 LTSIITGSFYPNVARVELPDPK---YLATSSGAIEKD-----PEAKLIKYWIRSEEYQDK 1249

Query: 102  FVTMSGELVLNYPSQEFIKLPIKLAVTNIGFHSLCLVAYLAKQIFVSILCDVSDPILDEQ 161
               +  EL       + + LP+    + I   S+   + +       +L D   P+L E 
Sbjct: 1250 LYALKHELKDKQHKVDSVSLPLPATRSFIHPSSVLFTSNIVNDEDAKLLTDYDQPVLKEF 1309

Query: 162  NSEPLL 167
             S P+L
Sbjct: 1310 TSAPIL 1315

>YML072C (TCB3) [3897] chr13 complement(124730..129367) Protein
           containing two C2 domains, which may be involved in
           calcium-dependent phospholipid binding, has low
           similarity to uncharacterized C. albicans Orf6.5286p
           [4638 bp, 1545 aa]
          Length = 1545

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 26/140 (18%)

Query: 16  ISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFYESVNEGLV 75
           +S+ VKD+++  L  V+    ++ L I +F+ G+ APTI  K I       Y    +  V
Sbjct: 294 LSQQVKDNVNPQLAGVAPGYGIDALAIDEFTLGSKAPTI--KGIKS-----YTKTGKNTV 346

Query: 76  EGDEGWTIP-SPSDTQFLIEVEYK-------------GDLFVTMSGELV---LNYPSQEF 118
           E D  W+   +PSD   +   E +             G  FV+ +  ++   +N   +  
Sbjct: 347 EMD--WSFAFTPSDVSDMTATEAREKINPKISLGVTLGKSFVSKTMPILVEDINVAGKMR 404

Query: 119 IKLPIKLAVTNIGFHSLCLV 138
           IK+    A  NI   SL L+
Sbjct: 405 IKVEFGKAFPNIKIVSLQLL 424

>Scas_688.6
          Length = 239

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 16/97 (16%)

Query: 8   SEIGSDASISEAVKDHLSSYLQNVSLPSFVNNLKITDFSFGAIAPTIILKEITDPLPDFY 67
           SEI  +  +SE++K ++SSY++            I  FS GA   TII  +IT+ +P   
Sbjct: 78  SEISHELDLSESIK-YVSSYIKENGPYD-----GIVGFSQGAALSTIITNKITELVPGHP 131

Query: 68  ESVNEGLVEGDEGWTIPSPSDTQFLIEVEYKGDLFVT 104
           E     ++ G   +T P P         E+KG+L +T
Sbjct: 132 EFKVSVIISG-YSFTEPDP---------EHKGELRIT 158

>Scas_717.40
          Length = 988

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 39/93 (41%), Gaps = 23/93 (24%)

Query: 30  NVSLPSFVNNLKITDFSFGAIAPT----------IILKEITDPL---PDFYESVNEGLVE 76
           N SL +F+N +   D++F   A T          + L    +PL    DFY+        
Sbjct: 108 NKSLANFMNAMTGHDYTFFPFATTNAKDFNNLRDVYLDATLNPLLKQEDFYQ-------- 159

Query: 77  GDEGWTIPSPSDTQFLIEVEYKGDLFVTMSGEL 109
             EGW +   + T     + +KG ++  M G++
Sbjct: 160 --EGWRLEHDTVTDVTTPIVFKGVVYNEMKGQV 190

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 149 ILCDVSDPILDEQNSEPLLDP-NGTFMAPKKPFER------ISIIRSMNIDTEIGQQYQ 200
           +LC     IL++  + PL+   N  F APK PF R      I  ++  +I  E G++++
Sbjct: 356 VLCKTVQYILEDPIAGPLVKQLNPDFQAPKMPFMRLEYKDAIEWLKEHDIKNEDGEEFK 414

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,585,551
Number of extensions: 370596
Number of successful extensions: 1160
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1146
Number of HSP's successfully gapped: 31
Length of query: 272
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 172
Effective length of database: 13,134,309
Effective search space: 2259101148
Effective search space used: 2259101148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)