Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_644.1051251225920.0
YMR004W (MVP1)51145013890.0
Sklu_2419.353148713740.0
CAGL0J11704g50948513291e-180
KLLA0C06006g51242712501e-168
ACL014C52445712461e-167
Kwal_56.2249952739512341e-165
KLLA0C10967g400791362e-08
Kwal_23.2896421771362e-08
Scas_690.22428981263e-07
ACR074W410831211e-06
CAGL0G06424g164971071e-05
YOR357C (GRD19)162751052e-05
Scas_663.191691081053e-05
ADR211W600981086e-05
CAGL0J01001g4301541066e-05
ADR390C163741017e-05
YOR069W (VPS5)6751101077e-05
Kwal_26.68581601071017e-05
KLLA0F16643g6651031069e-05
Scas_613.216491201022e-04
ADR192C60399970.001
Sklu_2428.664773950.002
CAGL0L10472g638117920.004
YJL036W (SNX4)423172900.007
Kwal_23.343861475890.010
Scas_580.318380850.012
Kwal_47.18601622100860.021
KLLA0E09141g63634850.032
Scas_698.3269973840.037
YDL113C (ATG20)64035830.055
CAGL0I01144g17385790.059
Sklu_1971.416567790.060
Kwal_55.2174562972820.061
Sklu_2404.316360790.064
Scas_322.217667790.064
KLLA0A03718g16469770.096
YHR105W (YPT35)21487780.13
CAGL0H10428g753109790.15
Scas_712.3335798750.41
CAGL0I07095g32672740.42
Sklu_2221.567179740.55
Sklu_2219.263432720.90
Kwal_55.2153315967691.1
Scas_714.5863678711.2
Sklu_2167.434992701.6
Kwal_47.1907934583701.7
Sklu_1899.259580701.9
ACR219W60980692.5
KLLA0D01958g1128180683.1
AER438C34879673.7
KLLA0A01672g346103664.4
Sklu_2442.6364127664.4
KLLA0C15543g98253665.7
KLLA0D04906g362141656.0
Scas_717.60d16770637.6
YML104C (MDM1)112791658.1
Sklu_1262.1283186648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_644.10
         (512 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_644.10                                                          1003   0.0  
YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required fo...   539   0.0  
Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement        533   0.0  
CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces...   516   e-180
KLLA0C06006g complement(530169..531707) similar to sp|P40959 Sac...   486   e-168
ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH] (333900..33...   484   e-167
Kwal_56.22499                                                         479   e-165
KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces c...    57   2e-08
Kwal_23.2896                                                           57   2e-08
Scas_690.22                                                            53   3e-07
ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH] complement(...    51   1e-06
CAGL0G06424g complement(621136..621630) highly similar to sp|Q08...    46   1e-05
YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protei...    45   2e-05
Scas_663.19                                                            45   3e-05
ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -...    46   6e-05
CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces cer...    45   6e-05
ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH] (1410245.....    44   7e-05
YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorti...    46   7e-05
Kwal_26.6858                                                           44   7e-05
KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces...    45   9e-05
Scas_613.21                                                            44   2e-04
ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)...    42   0.001
Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement        41   0.002
CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces...    40   0.004
YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sort...    39   0.007
Kwal_23.3438                                                           39   0.010
Scas_580.3                                                             37   0.012
Kwal_47.18601                                                          38   0.021
KLLA0E09141g complement(817829..819739) similar to sgd|S0002271 ...    37   0.032
Scas_698.32                                                            37   0.037
YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein th...    37   0.055
CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces cer...    35   0.059
Sklu_1971.4 YHR105W, Contig c1971 6476-6973                            35   0.060
Kwal_55.21745                                                          36   0.061
Sklu_2404.3 YOR357C, Contig c2404 1457-1948                            35   0.064
Scas_322.2                                                             35   0.064
KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces c...    34   0.096
YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may pl...    35   0.13 
CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces...    35   0.15 
Scas_712.33                                                            33   0.41 
CAGL0I07095g 682556..683536 weakly similar to sp|P32912 Saccharo...    33   0.42 
Sklu_2221.5 YDR425W, Contig c2221 7089-9104                            33   0.55 
Sklu_2219.2 YDL113C, Contig c2219 4054-5958                            32   0.90 
Kwal_55.21533                                                          31   1.1  
Scas_714.58                                                            32   1.2  
Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement         32   1.6  
Kwal_47.19079                                                          32   1.7  
Sklu_1899.2 YLR060W, Contig c1899 2604-4391                            32   1.9  
ACR219W [1266] [Homologous to ScYLR060W (FRS1) - SH] complement(...    31   2.5  
KLLA0D01958g complement(167629..171015) similar to sp|Q01846 Sac...    31   3.1  
AER438C [2938] [Homologous to ScYGL212W (VAM7) - SH] (1474934..1...    30   3.7  
KLLA0A01672g 147876..148916 weakly similar to sp|P32912 Saccharo...    30   4.4  
Sklu_2442.6 YCL018W, Contig c2442 9111-10205                           30   4.4  
KLLA0C15543g 1349181..1352129 similar to sgd|S0006301 Saccharomy...    30   5.7  
KLLA0D04906g 420903..421991 gi|417243|sp|P23390|LEU3_KLULA Kluyv...    30   6.0  
Scas_717.60d                                                           29   7.6  
YML104C (MDM1) [3867] chr13 complement(58939..62322) Intermediat...    30   8.1  
Sklu_1262.1 YPR061C, Contig c1262 1479-2330                            29   8.1  

>Scas_644.10
          Length = 512

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/512 (95%), Positives = 488/512 (95%)

Query: 1   MNTFGDDVDPWGSRXXXXXXXXXXXXXXXXXXXXXXXXATITTGLNAVSLSGDGDLFNSK 60
           MNTFGDDVDPWGSR                        ATITTGLNAVSLSGDGDLFNSK
Sbjct: 1   MNTFGDDVDPWGSRAATNEWAEEATTTTQYPTNEQTTPATITTGLNAVSLSGDGDLFNSK 60

Query: 61  TDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSELDQSELFGQWCDQ 120
           TDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSELDQSELFGQWCDQ
Sbjct: 61  TDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSELDQSELFGQWCDQ 120

Query: 121 IRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWL 180
           IRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWL
Sbjct: 121 IRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWL 180

Query: 181 QETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTF 240
           QETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTF
Sbjct: 181 QETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTF 240

Query: 241 LTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRI 300
           LTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRI
Sbjct: 241 LTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRI 300

Query: 301 CILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNK 360
           CILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNK
Sbjct: 301 CILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNK 360

Query: 361 TQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLE 420
           TQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLE
Sbjct: 361 TQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLE 420

Query: 421 AMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQ 480
           AMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQ
Sbjct: 421 AMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQ 480

Query: 481 DWSKLNASFVGINLNEWEKLEEQLEDMPLGQN 512
           DWSKLNASFVGINLNEWEKLEEQLEDMPLGQN
Sbjct: 481 DWSKLNASFVGINLNEWEKLEEQLEDMPLGQN 512

>YMR004W (MVP1) [3969] chr13 (274017..275552) Protein required for
           sorting proteins to the vacuole, interacts genetically
           with Vps1p [1536 bp, 511 aa]
          Length = 511

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/450 (59%), Positives = 348/450 (77%), Gaps = 3/450 (0%)

Query: 62  DILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSELDQSELFGQWCDQI 121
           D+LE+ +W ++  +P   T +    PNI   ++   +  + +Q+ E  +++L   W + +
Sbjct: 64  DVLEESIWDDSR-NPLGATGMSQT-PNIAANETVIDKNDARDQNIEESEADLLD-WTNNV 120

Query: 122 RKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQ 181
           RK+Y PL  DII IEEIPEREGLLFKH NY VKHLI LP    +++  VVRRYSDFLWL+
Sbjct: 121 RKTYRPLDADIIIIEEIPEREGLLFKHANYLVKHLIALPSTSPSEERTVVRRYSDFLWLR 180

Query: 182 ETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFL 241
           E LL+RYPFRM+PELPPK++GSQ AD++FL+KRR GL RFINLVMKHP    DDLVLTFL
Sbjct: 181 EILLKRYPFRMIPELPPKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLSNDDLVLTFL 240

Query: 242 TVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRIC 301
           TV T+L++WRKQA++DTS+EF DK+I+  F+KMW K  +EQWN AAS I+ +ME+W RI 
Sbjct: 241 TVRTDLTSWRKQATYDTSNEFADKKISQEFMKMWKKEFAEQWNQAASCIDTSMELWYRIT 300

Query: 302 ILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNKT 361
           +L+ERHE+++ QM HE++ F +LV++ S +TP LYP++Q+DT+LDINN+ SIIKKHL  T
Sbjct: 301 LLLERHEKRIMQMVHERNFFETLVDNFSEVTPKLYPVQQNDTILDINNNLSIIKKHLETT 360

Query: 362 QDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLEA 421
             I +    +   +L PKFK+FTDILLSLR LFERYKIMA NN+ +LQRHV LN+EKLE+
Sbjct: 361 SSICKQETEEISGTLSPKFKIFTDILLSLRSLFERYKIMAANNVVELQRHVELNKEKLES 420

Query: 422 MKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQD 481
           MKGKPD +G EYDRIK  I +D++SI EQ NRAWL+R+CILEEFTIFQETQF++TRAFQD
Sbjct: 421 MKGKPDVSGAEYDRIKKIIQKDRRSIIEQSNRAWLIRQCILEEFTIFQETQFLITRAFQD 480

Query: 482 WSKLNASFVGINLNEWEKLEEQLEDMPLGQ 511
           W+KLN++  G+ LNEWEKL   + DMP+ +
Sbjct: 481 WAKLNSNHAGLKLNEWEKLVTSIMDMPISR 510

>Sklu_2419.3 YMR004W, Contig c2419 3267-4862 reverse complement
          Length = 531

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/487 (51%), Positives = 347/487 (71%), Gaps = 15/487 (3%)

Query: 39  ATITTGLNAVSLSGDG-----------DLFNSKTD---ILEQRVWGEAPPDPTPNTVVPI 84
           AT+++ +N +SL+ D            +LFN+  +   ++E  +W + P     + ++P 
Sbjct: 45  ATLSSRMNDISLTVDASNTQVGDFSSTNLFNNHRNGESVMEHSIWEDHPKQSNADVMIPS 104

Query: 85  IEPNINQPQSGPTQGQSHEQSSELDQSELFGQWCDQIRKSYNPLGPDIITIEEIPEREGL 144
               +    S P    +  +S++    ++   W + +R +YNPL  DI+ +EEIPEREG+
Sbjct: 105 EPVLVGNVLSDPLNASTSNKSTDDVFDDVLATWIEAVRTTYNPLSTDIVIVEEIPEREGI 164

Query: 145 LFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQ 204
           LFKHTNY VKHLI LP  D + D  V+RRYSDF+WLQE LL++YPFRM+PELPPKK+GS 
Sbjct: 165 LFKHTNYLVKHLIVLPDTDPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPELPPKKIGSH 224

Query: 205 IADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEFID 264
            AD+ FL KRR+GL RFINLVMKHPV   DDLVLTFLTVPT+LS WRKQAS+DT++EF D
Sbjct: 225 SADRAFLLKRRRGLSRFINLVMKHPVLNHDDLVLTFLTVPTDLSGWRKQASYDTTEEFTD 284

Query: 265 KRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFGSL 324
           K+I+ SF+KMW K ++EQWN A S I+  +E W++I +LVER+ R+LKQ++ ++++F S+
Sbjct: 285 KKISKSFMKMWRKELAEQWNEADSKIDLALETWAKITVLVERYSRRLKQISEDRTLFESI 344

Query: 325 VNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKLFT 384
           VN+ +   P+LYPI + DT+ DIN H  II KHL+    +      +T  +LL KFK+F 
Sbjct: 345 VNEFTQTAPSLYPINK-DTIEDINAHTGIITKHLSDCNQLTSKEIEETHLNLLVKFKIFI 403

Query: 385 DILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLEAMKGKPDANGVEYDRIKMSITRDK 444
           D++ SL+GLFERYKI+A NNI QLQR V LN E +  MKGKPD  G EYD++K ++ RDK
Sbjct: 404 DMIFSLKGLFERYKILAGNNIAQLQRRVELNIETMNNMKGKPDVRGAEYDKVKQAVQRDK 463

Query: 445 KSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQDWSKLNASFVGINLNEWEKLEEQL 504
           ++I+EQ+NR+WL+R+CILEEFTIFQETQF++T +FQ+W+KLN  +  +N NEWE+L + L
Sbjct: 464 RTIAEQMNRSWLIRECILEEFTIFQETQFVITHSFQEWAKLNMKYADLNSNEWERLFDSL 523

Query: 505 EDMPLGQ 511
           E MP+ +
Sbjct: 524 ETMPISR 530

>CAGL0J11704g 1138009..1139538 similar to sp|P40959 Saccharomyces
           cerevisiae YMR004w MVP1 required for vacuolar protein
           sorting, hypothetical start
          Length = 509

 Score =  516 bits (1329), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 253/485 (52%), Positives = 349/485 (71%), Gaps = 20/485 (4%)

Query: 40  TITTGLNAVSLSGDGDLFNSKTDILEQRVWGEAPPDPTPNTVVPIIEP--------NINQ 91
           +++  L+ + L+ D    N+    L + +WG       PN V   +E         N N+
Sbjct: 31  SLSNSLSGLQLNED---INTVRANLTESIWG-TERTGAPNNVETGLEAKDSLNVSTNFNE 86

Query: 92  PQSG---PTQGQSH--EQSSELDQSELFGQWCDQIRKSYNPLGPDIITIEEIPEREGLLF 146
             +    PT   S+  EQ+S    +E    W +++RK+YNP   DII+IEEIPEREGLLF
Sbjct: 87  LNTAILSPTSSTSNIEEQNS---FTESLESWINEVRKTYNPQQLDIISIEEIPEREGLLF 143

Query: 147 KHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA 206
           KH NYSVKHLI+LP  +  K+  VVRRYSDFLWLQE LL+RYPFRM+P+LPPKK+GSQ  
Sbjct: 144 KHANYSVKHLIDLPNTEPPKNRTVVRRYSDFLWLQEVLLKRYPFRMIPDLPPKKIGSQNL 203

Query: 207 DKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEFIDKR 266
           D +FL KRR GL +FINLVMKHP   KDDLVLTFLTVPT+L++WRKQ S+DT+DEF DKR
Sbjct: 204 DPVFLNKRRIGLSKFINLVMKHPKLSKDDLVLTFLTVPTDLTSWRKQVSYDTADEFTDKR 263

Query: 267 IAASFVKMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFGSLVN 326
           I+  FVK+W K ++E WNN A+ I+  ++ W++I ILV+RHE++L+ +A+E+ I   L++
Sbjct: 264 ISKDFVKIWKKDLAEIWNNTANCIDELIDKWTKISILVDRHEKRLQIIANERKIMNDLIH 323

Query: 327 DLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKLFTDI 386
           D+ NLT ++YPI+Q+ T+LDIN+  ++I KH+ KT +     A  T   +LPKF+++TDI
Sbjct: 324 DVGNLTKSVYPIDQNPTILDINSGMTVISKHIEKTNENYNQQALDTKQKVLPKFRMYTDI 383

Query: 387 LLSLRGLFERYKIMATNNIPQLQRHVVLNREKLEAMKGKPDANGVEYDRIKMSITRDKKS 446
           L +L+ +FERYK++ATNN+  LQ+H+ LN +KLE MKGKPDA+G EYDRIK +I +D+K 
Sbjct: 384 LRALKNVFERYKMLATNNVSMLQKHIDLNLQKLEDMKGKPDASGQEYDRIKTTIRKDRKI 443

Query: 447 ISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQDWSKLNASFVGINLNEWEKLEEQLED 506
           + EQ NRAWL+R+CILEEFTIFQETQFM+T  FQ+W+K+ +++  +NLNEWE +   + +
Sbjct: 444 MYEQSNRAWLIRECILEEFTIFQETQFMITGCFQEWAKVQSTYSSLNLNEWENVTNHILE 503

Query: 507 MPLGQ 511
           MPL +
Sbjct: 504 MPLSR 508

>KLLA0C06006g complement(530169..531707) similar to sp|P40959
           Saccharomyces cerevisiae YMR004w MVP1 required for
           vacuolar protein sorting singleton, start by similarity
          Length = 512

 Score =  486 bits (1250), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 311/427 (72%), Gaps = 5/427 (1%)

Query: 87  PNINQP-QSGPTQGQSHEQSSELDQ---SELFGQWCDQIRKSYNPLGPDIITIEEIPERE 142
           PNI    Q    +G +  Q+++  Q   ++ +  W + +RK+Y PL  DI+++EEIPERE
Sbjct: 84  PNIGSTTQETDIRGVNRFQATDTPQYAANDEYKNWVESVRKTYFPLAEDIVSVEEIPERE 143

Query: 143 GLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLG 202
           GL+FKHTNY VKHL  LP  D + D  VVRRYSDF WLQ+ LLR+YPFRMVPELPPKK+G
Sbjct: 144 GLVFKHTNYLVKHLTPLPNTDPSDDRTVVRRYSDFDWLQDVLLRKYPFRMVPELPPKKIG 203

Query: 203 SQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEF 262
           SQ AD +FL KRRKGL RFINLVMKHPV + DDLVLTFLTVPT+LS WRKQA +DT+DEF
Sbjct: 204 SQNADPLFLAKRRKGLSRFINLVMKHPVLRSDDLVLTFLTVPTDLSGWRKQAHYDTTDEF 263

Query: 263 IDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFG 322
            DK I++SF+ +W K  SEQWN A   I+  ++ W ++ +L+ER+E+++KQ+AHE+ + G
Sbjct: 264 TDKHISSSFMNLWRKEFSEQWNKADERIDIALDTWVKVTVLIERYEKRMKQVAHERKLLG 323

Query: 323 SLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKL 382
            ++N + + T  LYP + + TV  IN    +I +HLN   D+ +    +  + L  +FK 
Sbjct: 324 QILNAIPDTTEALYP-QSTATVSQINEGVGLIVEHLNSCADVIERENEEVDSGLSVRFKA 382

Query: 383 FTDILLSLRGLFERYKIMATNNIPQLQRHVVLNREKLEAMKGKPDANGVEYDRIKMSITR 442
           F D++++L+GLFERYK+MA NNIPQLQR V +N+E+L  ++  PD  G EYDR+K SI+R
Sbjct: 383 FIDVIIALKGLFERYKMMAGNNIPQLQRRVEINQERLNTLESNPDVKGAEYDRVKQSISR 442

Query: 443 DKKSISEQLNRAWLVRKCILEEFTIFQETQFMLTRAFQDWSKLNASFVGINLNEWEKLEE 502
           DK+SI +Q+NR+WL+R+CILEEFTIF ETQF++T  FQ W ++N  +   N++ WEK+ +
Sbjct: 443 DKRSILDQMNRSWLIRECILEEFTIFHETQFLITDCFQRWIEINLRYTNNNVDNWEKICK 502

Query: 503 QLEDMPL 509
           +L DMPL
Sbjct: 503 KLRDMPL 509

>ACL014C [1035] [Homologous to ScYMR004W (MVP1) - SH]
           (333900..335474) [1575 bp, 524 aa]
          Length = 524

 Score =  484 bits (1246), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 317/457 (69%), Gaps = 9/457 (1%)

Query: 56  LFNSKTDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSELDQSELFG 115
           ++   T  LEQ VWG APP     ++  +           P   QS     EL  SE   
Sbjct: 77  MYEPGTPALEQTVWG-APPSQLDASISGL------DTSMAPVASQS-SMCDEL-HSEDLE 127

Query: 116 QWCDQIRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYS 175
            W +  RK+YNPL  +I+ +EEIPEREG+LFKHTNY VKHL+ LP  + + +  V+RRYS
Sbjct: 128 NWMNSRRKTYNPLAKNIVVVEEIPEREGILFKHTNYLVKHLVVLPNTNPSSNQTVIRRYS 187

Query: 176 DFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDD 235
           DF WLQE LL++YPFRM+PELPPKK+G+Q AD IFL +RRKGL RFINLV+ HPV ++DD
Sbjct: 188 DFNWLQEVLLKKYPFRMIPELPPKKIGAQNADPIFLARRRKGLCRFINLVIMHPVLKQDD 247

Query: 236 LVLTFLTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERTME 295
           LVLTFLTVPT+L +WRKQA++DT++EF D++I  +F+ +WHK +S QWN A + I+  +E
Sbjct: 248 LVLTFLTVPTDLGSWRKQANYDTTEEFTDQKIDKAFISLWHKELSNQWNKADAKIDELLE 307

Query: 296 IWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSIIK 355
            W +  +LVER+ER+++Q++ E+ + G ++ + ++ +  LYP+E+     DIN+H S I 
Sbjct: 308 SWIKTSVLVERYERRMRQVSEERRLLGRVIEEFADNSVTLYPLEEGHLFHDINSHISTIS 367

Query: 356 KHLNKTQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVVLN 415
           KHLN   D ++    +    L  KFK F DI+++L+G+F+RYKIMA NNI  LQR V +N
Sbjct: 368 KHLNSLADTSKKERQEVEEHLSVKFKTFIDIIIALKGVFDRYKIMAGNNIAHLQRRVEIN 427

Query: 416 REKLEAMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQFML 475
            +KL++M+  PD  G EYD+++ +I RDK++I+EQLNR+WL+RKCILEEF IFQETQF +
Sbjct: 428 MDKLQSMESNPDVKGAEYDKLRQTIQRDKRTIAEQLNRSWLIRKCILEEFVIFQETQFCI 487

Query: 476 TRAFQDWSKLNASFVGINLNEWEKLEEQLEDMPLGQN 512
           T  FQ+W+K++  +       WEK+   L+DMPL ++
Sbjct: 488 THVFQEWAKMHVKYANETTESWEKVYANLQDMPLSRS 524

>Kwal_56.22499
          Length = 527

 Score =  479 bits (1234), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 210/395 (53%), Positives = 294/395 (74%), Gaps = 1/395 (0%)

Query: 114 FGQWCDQIRKSYNPLGPDIITIEEIPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRR 173
           F  W + +RKSYNPL  DII +EE+PEREGLLFKHTNY V+HLI+LP    + D  V+RR
Sbjct: 130 FESWSEAVRKSYNPLVADIIVVEELPEREGLLFKHTNYLVRHLIDLPDTSPSSDRSVIRR 189

Query: 174 YSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQK 233
           YSDF+WLQE LL++YPFRM+P+LPPK++GS   D +F  KRR GL RFINLV+KHPVF+K
Sbjct: 190 YSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHTTDPVFSIKRRNGLSRFINLVVKHPVFKK 249

Query: 234 DDLVLTFLTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQWNNAASSIERT 293
           DDLVLTFLTVPT+L  WRKQAS+DTSDEF D++++ +FVKMWHKG++E+WN A ++I+  
Sbjct: 250 DDLVLTFLTVPTDLLGWRKQASYDTSDEFTDRKVSVTFVKMWHKGLAERWNEADANIDTA 309

Query: 294 MEIWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDTVLDINNHFSI 353
           +E+W++I +L++R+ER++  +A ++ I  S+++  +   P+L+  +   T + I +H   
Sbjct: 310 LELWAKITVLIDRYERRMAFIAQDRDILRSMLDQFTEGMPHLFNSDDGSTNV-IGDHLGR 368

Query: 354 IKKHLNKTQDIAQDNATKTCNSLLPKFKLFTDILLSLRGLFERYKIMATNNIPQLQRHVV 413
           + KH     ++      + C  L P+F+ FTD LL+L+GLFERYK MA NN+PQLQR + 
Sbjct: 369 VSKHFGSCNELVSQENQEACKELSPRFRTFTDTLLALKGLFERYKAMAGNNVPQLQRRIE 428

Query: 414 LNREKLEAMKGKPDANGVEYDRIKMSITRDKKSISEQLNRAWLVRKCILEEFTIFQETQF 473
           +N ++LE MK KPD  G EYDR+K SI RD+K+I+EQ+NR+WLVR+CIL+E+  FQE QF
Sbjct: 429 VNSDRLEQMKDKPDLKGAEYDRVKQSIQRDRKAIAEQMNRSWLVRECILQEYVYFQEAQF 488

Query: 474 MLTRAFQDWSKLNASFVGINLNEWEKLEEQLEDMP 508
           +++  FQ W  LN  +  +N NEW+KL + ++ MP
Sbjct: 489 LISDIFQRWVLLNMKYYELNSNEWDKLLQDVQSMP 523

>KLLA0C10967g 943312..944514 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4 singleton, hypothetical start
          Length = 400

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 48/79 (60%), Gaps = 4/79 (5%)

Query: 168 NCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA-DKI---FLEKRRKGLLRFIN 223
           NCVVRRY+DF+ L + L+  +P  +VP LP KK+ + ++ D+    F +KR + L  F+ 
Sbjct: 50  NCVVRRYNDFVLLHQILINDHPALLVPPLPDKKVLNYLSGDRFSHSFTQKRCRSLQTFMR 109

Query: 224 LVMKHPVFQKDDLVLTFLT 242
            ++ H    K  ++ TFLT
Sbjct: 110 RLLSHSELSKSRILETFLT 128

>Kwal_23.2896
          Length = 421

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 4/77 (5%)

Query: 169 CVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA----DKIFLEKRRKGLLRFINL 224
            V RRYSDFL LQ  L + +P  ++P LP KK+   IA     + F +KR   L  F+  
Sbjct: 69  VVHRRYSDFLLLQSILSQDHPTCVIPPLPDKKVFQYIAGDRFSQSFTQKRCHSLQNFLRR 128

Query: 225 VMKHPVFQKDDLVLTFL 241
           + +HP+  K  +++TFL
Sbjct: 129 ISEHPILSKSQVLMTFL 145

>Scas_690.22
          Length = 428

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 52/98 (53%), Gaps = 6/98 (6%)

Query: 163 DSAKDNCVV-RRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA----DKIFLEKRRKG 217
           DSA +  VV RRYSD + L + L+  +P  ++P LP KK+   IA     + F +KR   
Sbjct: 69  DSATEIIVVHRRYSDLVLLHDILMNDHPTCIIPPLPDKKVLQYIAGDRFSQRFTQKRCHS 128

Query: 218 LLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQAS 255
           L  F+  V  HP+  K  ++ TFL +  +   +RK  S
Sbjct: 129 LQNFLRRVSLHPILSKSKILETFL-IDADWDAYRKSLS 165

>ACR074W [1121] [Homologous to ScYJL036W (SNX4) - SH]
           complement(496156..497388) [1233 bp, 410 aa]
          Length = 410

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 4/83 (4%)

Query: 164 SAKDNCVV--RRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA--DKIFLEKRRKGLL 219
           S +D+  V  RRYSDF+ L + L   YP  +VP LP KK+ + +    + F +KR   L 
Sbjct: 47  SGEDDITVVHRRYSDFVLLYQILANDYPACIVPPLPDKKVLNYLDRFSQSFTQKRCHSLQ 106

Query: 220 RFINLVMKHPVFQKDDLVLTFLT 242
            F+  + +HPV  +  ++ TFL 
Sbjct: 107 NFLQRLAQHPVLSQSKILHTFLV 129

>CAGL0G06424g complement(621136..621630) highly similar to sp|Q08826
           Saccharomyces cerevisiae YOR357c GRD19, hypothetical
           start
          Length = 164

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 8/97 (8%)

Query: 148 HTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRY-----PFRMVPELPPK-KL 201
           +T+Y +     LP     + + V RRYSDF + ++ LL+       P  +VP LP K  L
Sbjct: 59  YTDYEIICRTNLP-NFHKRASRVRRRYSDFEFFRKCLLKEISMLNNPRVVVPHLPGKIYL 117

Query: 202 GSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVL 238
            ++ +D++ +E+RR+GL R++ +V  HP+ Q     L
Sbjct: 118 SNRFSDEV-IEERRQGLNRWMQIVAGHPLLQSGSKTL 153

>YOR357C (GRD19) [5134] chr15 complement(1009220..1009708) Protein
           involved in retrieval of late Golgi membrane proteins
           from the prevacuolar compartment [489 bp, 162 aa]
          Length = 162

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 170 VVRRYSDFLWLQETLLRR-----YPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINL 224
           V RRYSDF + ++ L++      +P  MVP LP K L S       +E+RR+GL  ++  
Sbjct: 78  VRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQS 137

Query: 225 VMKHPVFQKDDLVLT 239
           V  HP+ Q    VL 
Sbjct: 138 VAGHPLLQSGSKVLV 152

>Scas_663.19
          Length = 169

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 9/108 (8%)

Query: 138 IPEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRR------YPFR 191
           IP  +  +F  T+Y +     LP   S +++ V RRYSDF + ++ LL+       +P  
Sbjct: 55  IPNGDQNMF--TDYEIVCHTNLPNFKS-RNSKVRRRYSDFEFFKKCLLKEISMFTNHPRI 111

Query: 192 MVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLT 239
           M+P LP K   +   +   +E+R +GL +++  V  HP+ Q    VL 
Sbjct: 112 MIPHLPGKIFLNNRFNPEVIEERMQGLDKWLKTVAGHPLLQSGSKVLV 159

>ADR211W [1952] [Homologous to ScYOR069W (VPS5) - SH; ScYKR078W -
           SH] complement(1072310..1074112) [1803 bp, 600 aa]
          Length = 600

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 6/98 (6%)

Query: 146 FKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPK-KLGSQ 204
           F H  YSV+    L G     +  V RRY DF WL   L   +  +++P  P K K+G  
Sbjct: 219 FSHVEYSVRTRSPLVGD---AEVSVQRRYRDFRWLYRQLQSNHWGKVIPPPPDKQKVGRF 275

Query: 205 IADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLT 242
             D  F+E RR  + R +  + ++   Q D   L FLT
Sbjct: 276 KQD--FIENRRFQMERMLQRIAQNAALQNDQDFLLFLT 311

>CAGL0J01001g 98637..99929 similar to sp|P47057 Saccharomyces
           cerevisiae YJL036w SNX4, hypothetical start
          Length = 430

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 74/154 (48%), Gaps = 15/154 (9%)

Query: 162 QDSAKDNCVV--RRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA----DKIFLEKRR 215
           Q ++ D+ +V  RRY+D + L + L   +P  ++P LP KK+   IA     + F ++R 
Sbjct: 70  QKASFDDIIVVHRRYNDVVLLHDILQNDHPTCIIPPLPDKKVLQYIAGDRFGRRFTQRRC 129

Query: 216 KGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASF---DTSDEFIDKRIAASFV 272
             L  F+  V +HP+     ++  FL V  E   +RK  +    +   E +   +  +F 
Sbjct: 130 HSLQNFLRRVSQHPILSTSKVLEIFL-VGNEWDTYRKNIAGTLQNAQKEDVTDAVMNAFK 188

Query: 273 KMWHKG-----ISEQWNNAASSIERTMEIWSRIC 301
           K+ ++      I ++ +   +S+ R  +++ R+ 
Sbjct: 189 KVHNQNEEFTEIRDRSDKLDNSVNRINKVFHRVV 222

>ADR390C [2131] [Homologous to ScYOR357C (GRD19) - SH]
           (1410245..1410736) [492 bp, 163 aa]
          Length = 163

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 170 VVRRYSDFLWLQETLLRR-----YPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINL 224
           V RRYSDF + +  L +      +P  ++P LP K L ++      +E+RR+GL ++++ 
Sbjct: 79  VRRRYSDFEFFKRCLFKELSLSAHPRVVIPALPGKILWARRFHDEVIEERREGLAQWLST 138

Query: 225 VMKHPVFQKDDLVL 238
           V  HP+ Q    VL
Sbjct: 139 VAGHPLLQSGSKVL 152

>YOR069W (VPS5) [4876] chr15 (453769..455796) Member of the sorting
           nexin family involved in Golgi retention and vacuolar
           sorting [2028 bp, 675 aa]
          Length = 675

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 10/110 (9%)

Query: 148 HTNYSV---KHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQ 204
           H  Y+V     L+EL      K   V RRY DF WL   L   +  +++P  PP+K    
Sbjct: 298 HVEYTVISESSLLEL------KYAQVSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQSVG 350

Query: 205 IADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQA 254
              + F+E RR  +   +  + + PV QKD   L FLT     S  +K+A
Sbjct: 351 SFKENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLTSDDFSSESKKRA 400

>Kwal_26.6858
          Length = 160

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 60/107 (56%), Gaps = 11/107 (10%)

Query: 139 PEREGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRR-----YPFRMV 193
           P++ G+   +T+Y V     +P   S + + V RRYS+F   ++ L++      +P  +V
Sbjct: 49  PDQHGM---YTDYEVICRTNVPA-FSKRMSKVRRRYSEFELFRKCLIKELSLSSHPKVVV 104

Query: 194 PELPPK-KLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLT 239
           P LP K  LG++  D++ +E+R++GL +++  V  HP+ Q    VL 
Sbjct: 105 PHLPGKILLGNRFNDEV-IEERKQGLNKWLVAVAGHPLLQSGSKVLV 150

>KLLA0F16643g 1533628..1535625 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w VPS5 involved in Golgi retention and
           vacuolar sorting, start by similarity
          Length = 665

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 165 AKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINL 224
            K   V RRY DF WL   L   +  +++P  PP+K       + F+E RR  + R +  
Sbjct: 301 GKPTRVKRRYRDFRWLYRQLQHNHWGKIIPP-PPEKQAVGRFKQDFIENRRAQMERMLQH 359

Query: 225 VMKHPVFQKDDLVLTFLTVP--TELSNWRKQ-----ASFDTSD 260
           +  + V QKD+  + FLT    ++ S  R+Q     AS D++D
Sbjct: 360 IASNHVLQKDEDFILFLTSEKWSQESKVREQISGSKASHDSND 402

>Scas_613.21
          Length = 649

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 36/120 (30%)

Query: 166 KDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK----LGSQIA--------------- 206
           +D CV RRYSDF  L+  L+R +P  ++P +P K+     G  IA               
Sbjct: 200 RDVCVRRRYSDFESLRNVLVRLFPITLIPPIPEKESIKTYGKAIAGSSSKYQLPSDPAGS 259

Query: 207 ---------------DKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWR 251
                          D+  +  R + L +F+N ++++P   K  ++  FL  P   SNW+
Sbjct: 260 VDLTLSVINGSVNNRDEKLIRHRIRMLTQFLNKLLQNPEIMKTTIISDFLN-PNN-SNWK 317

>ADR192C [1933] [Homologous to ScYDR425W - SH] (1037233..1039044)
           [1812 bp, 603 aa]
          Length = 603

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 22/99 (22%)

Query: 150 NYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK--------- 200
           NY++ + I   G+       V RRYS+F  L++ L R  P  ++P +P K          
Sbjct: 142 NYAIGYTIAYEGRQ------VTRRYSEFDSLRQALARLLPTVIIPPIPSKHPLIRYFLNP 195

Query: 201 LGSQIADKIFLEKRRKGLLRFINL------VMKHPVFQK 233
           L ++  D   +EKRR+ L RF+N       + +H VFQK
Sbjct: 196 LNAE-NDIRIIEKRRRLLSRFLNNCHDITDIREHTVFQK 233

>Sklu_2428.6 YOR069W, Contig c2428 9095-11038 reverse complement
          Length = 647

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHP 229
           V RRY DF WL   L      R++P  P K+   +  +  F+E RR  + R +  +    
Sbjct: 287 VKRRYRDFRWLYRQLQNNNWGRIIPPPPEKQTVGRFKED-FIESRRFQMERMLKKISSDS 345

Query: 230 VFQKDDLVLTFLT 242
           + QKD+  + FLT
Sbjct: 346 ILQKDEDFIMFLT 358

>CAGL0L10472g 1117867..1119783 similar to sp|Q92331 Saccharomyces
           cerevisiae YOR069w, start by similarity
          Length = 638

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 50/117 (42%), Gaps = 9/117 (7%)

Query: 144 LLFKHTNYSVKHLIEL--PGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKL 201
           L   H  Y+V    EL  P Q     N V RRY DF WL   L   +  +++P  PP+K 
Sbjct: 253 LTSSHIKYTVNAESELLSPNQ-----NQVSRRYRDFRWLYRQLQNNHWGKVIPP-PPEKQ 306

Query: 202 GSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDT 258
                   F+E RR  L   +  +      Q+D+    FLT     +   K+ S++T
Sbjct: 307 TVGTFQPEFVETRRLQLQTMLRRIANDSDLQRDEHFHMFLTSDN-FAEDSKRVSYET 362

>YJL036W (SNX4) [2875] chr10 (378741..380012) Putative nexin sorting
           protein, possibly involved in proteasome function [1272
           bp, 423 aa]
          Length = 423

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 80/172 (46%), Gaps = 15/172 (8%)

Query: 169 CVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIA----DKIFLEKRRKGLLRFINL 224
            V RRYSD L L + LL R+P  ++P LP KK+   IA     + F +KR   L  F+  
Sbjct: 74  VVHRRYSDLLLLHDILLNRFPTCIIPPLPDKKVFQYIAGDRFSQRFTQKRCHSLQNFLRR 133

Query: 225 VMKHPVFQKDDLVLTFLTVPTELSNWRK--QASFD-TSDEFIDKRIAASFVKMWHKGISE 281
           V  HP   +  +  TFL V  +  + RK  Q S     DE  D  + A   K  HK   E
Sbjct: 134 VSLHPDLSQSKVFKTFL-VSKDWESHRKVLQDSLQPNKDEVTDAFMNA--FKTVHKQNEE 190

Query: 282 --QWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNL 331
             +    +  ++RT+   ++I  L  +  +K   M+ + +  GS + +L  L
Sbjct: 191 FTEIREKSDKLDRTV---TKIDKLFHKVVKKNDSMSEDYTKLGSNLQELQEL 239

>Kwal_23.3438
          Length = 614

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 11/75 (14%)

Query: 127 PLGPDIITIEEIPE-REGLLFKHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLL 185
           PL  D + I E  +  EG    +  Y++K+           D  V RRYSDF  L++ L+
Sbjct: 135 PLSGDKVYILEASKASEGQGRTYIAYTIKY----------GDKVVKRRYSDFESLRKILI 184

Query: 186 RRYPFRMVPELPPKK 200
           + +P  ++P +P K+
Sbjct: 185 KLFPMSLIPPIPEKQ 199

>Scas_580.3
          Length = 183

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 10/80 (12%)

Query: 172 RRYSDFLWLQETLLRRYPFRM-VPELPPK-------KLGSQIADKIFLEKRRKGLLRFIN 223
           +RYSDF+  + +++ +   RM +P LPP        K      DK +L KRR+GL RF+ 
Sbjct: 102 KRYSDFVAFRNSIMNKLGDRMEIPSLPPGVPWYDSWKYQDVNFDKKWLAKRRRGLERFLE 161

Query: 224 LVM--KHPVFQKDDLVLTFL 241
            V+  +  V    + + TFL
Sbjct: 162 QVLLDRELVLLAKNEIRTFL 181

>Kwal_47.18601
          Length = 622

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 20/100 (20%)

Query: 148 HTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK------L 201
           +  Y++ + IE  G+       VVRRYS+F  L+  L R  P  +VP +P K       L
Sbjct: 137 YGKYAIGYTIEFAGKH------VVRRYSEFDTLRHALHRLLPTVIVPPIPSKHPLIRYFL 190

Query: 202 GSQIADK-IFLEKRRKGLLRF-------INLVMKHPVFQK 233
               A+K I + +RRK LL         ++ + +H VF K
Sbjct: 191 NPLSAEKDIRIIERRKRLLSLFLSNCYAVSEIREHIVFSK 230

>KLLA0E09141g complement(817829..819739) similar to sgd|S0002271
           Saccharomyces cerevisiae YDL113c, start by similarity
          Length = 636

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 167 DNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK 200
           D+ V RRYSDF  L++ L++ +P  ++P +P K+
Sbjct: 190 DSIVKRRYSDFESLRKVLVKLFPISLIPPIPEKQ 223

>Scas_698.32
          Length = 699

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHP 229
           V RRY DF WL   L   +  +++P  PP+K       + F+E RR  +   +  +    
Sbjct: 337 VYRRYRDFRWLYRQLQNNHWGKIIPP-PPEKQAVGRFKQDFIENRRLQMENMLQTIASSD 395

Query: 230 VFQKDDLVLTFLT 242
             Q D   + FLT
Sbjct: 396 SLQNDSDFILFLT 408

>YDL113C (ATG20) [756] chr4 complement(256633..258555) Protein that
           may play a role in vesicular transport, has similarity
           to human SNX1 [1923 bp, 640 aa]
          Length = 640

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 166 KDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK 200
           +++ V RRYSDF  L+  L+R +P  ++P +P K+
Sbjct: 185 ENSTVQRRYSDFESLRSILIRLFPMTLIPPIPEKQ 219

>CAGL0I01144g 95410..95931 similar to sp|P38815 Saccharomyces
           cerevisiae YHR105w, start by similarity
          Length = 173

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 41/85 (48%), Gaps = 15/85 (17%)

Query: 172 RRYSDFLWLQETLLRRYPFRM------VPELPPK-------KLGSQIADKIFLEKRRKGL 218
           +RYSDF+  +  LL R   +       +PELPP        K      +K +L  RRKGL
Sbjct: 85  KRYSDFVEFRNALLDRVRTKRPASVSEIPELPPPVKWYYSWKYNEINLNKEWLANRRKGL 144

Query: 219 LRFINLVM--KHPVFQKDDLVLTFL 241
             FIN V+   + V    DLV+ FL
Sbjct: 145 ELFINQVLLNGNIVDIAKDLVIQFL 169

>Sklu_1971.4 YHR105W, Contig c1971 6476-6973
          Length = 165

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 10/67 (14%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRM---VPELPPK-------KLGSQIADKIFLEKRRKGLL 219
           + +RYSDF  L+  L++  P  +   +P LPPK       +      DK +L KRR GL 
Sbjct: 80  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 139

Query: 220 RFINLVM 226
            F+N V+
Sbjct: 140 YFLNQVL 146

>Kwal_55.21745
          Length = 629

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHP 229
           V RRY DF WL   L   +  +++P  P K+   +  D  F+E RR  + R +  + +  
Sbjct: 272 VQRRYRDFRWLYRQLQNNHWGKIIPPPPEKQTVGRFKDD-FIENRRFQMERMLTKISQDK 330

Query: 230 VFQKDDLVLTFL 241
             Q+D   + FL
Sbjct: 331 DLQEDVDFVMFL 342

>Sklu_2404.3 YOR357C, Contig c2404 1457-1948
          Length = 163

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 180 LQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLVLT 239
           ++E  L  +P  +VP LP K L S   +   +E+RR+GL +++  V  HP+ Q    VL 
Sbjct: 94  VKELALSSHPRVVVPHLPGKILLSNRFNDEIIEERRQGLQQWLLNVAGHPLLQSGSKVLV 153

>Scas_322.2
          Length = 176

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 10/67 (14%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRM---VPELPPK-------KLGSQIADKIFLEKRRKGLL 219
           + +RYSDF  L+  L++  P  +   +P LPPK       +      DK +L KRR GL 
Sbjct: 91  LYKRYSDFENLRNRLIQALPSELHQSIPSLPPKVRWYESWRYQDVNFDKKWLAKRRAGLE 150

Query: 220 RFINLVM 226
            F+N V+
Sbjct: 151 YFLNQVL 157

>KLLA0A03718g 334828..335322 similar to sp|Q08826 Saccharomyces
           cerevisiae YOR357c GRD19 singleton, start by similarity
          Length = 164

 Score = 34.3 bits (77), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 178 LWLQETLLRRYPFRMVPELPPKKLGSQIADKIFLEKRRKGLLRFINLVMKHPVFQKDDLV 237
           L ++E  L  +P   V  LP K L S       +E+RR+GL +++  V  HP+ Q    V
Sbjct: 93  LLIKELQLSNHPKVSVQHLPGKILLSNRFSDAVIEERRQGLNKWLASVAGHPLLQTGSKV 152

Query: 238 LT-FLTVPT 245
           L  F+  PT
Sbjct: 153 LVRFIQDPT 161

>YHR105W (YPT35) [2393] chr8 (324768..325412) Protein that may play
           a role in vesicular transport, has similarity to Grd19p,
           bacterial helix-turn-helix regulator protein of the argR
           group, and human SNX1 [645 bp, 214 aa]
          Length = 214

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 17/87 (19%)

Query: 172 RRYSDFLWLQETLLRRY----PFRM----VPELPPK-------KLGSQIADKIFLEKRRK 216
           +RYSDF+ L+E LL R     P ++    +P LPP        K      +K +L KR++
Sbjct: 121 KRYSDFVRLRENLLTRIKTAKPEKLNCLQIPHLPPSVQWYSSWKYQEVNLNKDWLAKRQR 180

Query: 217 GLLRFINLVMKHP--VFQKDDLVLTFL 241
           GL  F+N ++ +   V    D+++ FL
Sbjct: 181 GLEYFLNHIILNSSLVEMTKDILIQFL 207

>CAGL0H10428g 1016374..1018635 similar to tr|Q07528 Saccharomyces
           cerevisiae YDL113c, hypothetical start
          Length = 753

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 21/109 (19%)

Query: 97  TQGQSHEQSSELDQSEL--FGQWCDQIRKSYNPLGPD---IITIEEIPEREGLLFKHTNY 151
           T   S E SS L+ + +  FG       KSY         I+  +++ E +   F     
Sbjct: 254 TNKHSKESSSALNNANMKSFGNAV----KSYTKKSGKHVRILEAKKVSEGQSRTF----- 304

Query: 152 SVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK 200
            V + I+  G        V RRYSDF  L+  L++ +P  ++P +P K+
Sbjct: 305 -VAYFIKYNGH------MVRRRYSDFESLRSILVKLFPLMVIPPIPEKE 346

>Scas_712.33
          Length = 357

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 48/98 (48%), Gaps = 12/98 (12%)

Query: 166 KDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKLG---------SQIADKIFLEKRRK 216
           +D  + +R+S+FL L+  L + +   +  ELP +  G         +   D +  E+RR 
Sbjct: 48  EDRHIYKRFSEFLELKRRLEKEFNSELPYELPSRHHGPIFNVWTRSTTSIDPVITEERRI 107

Query: 217 GLLRFINLVMKHPV---FQKDDLVLTFLTVPTELSNWR 251
            L +F++ ++       ++  +LV  FL +P   +++R
Sbjct: 108 QLAKFVSDMLNDSFDTKWKNSELVRVFLQLPLNWNDYR 145

>CAGL0I07095g 682556..683536 weakly similar to sp|P32912
           Saccharomyces cerevisiae YGL212w VAM7 vacuolar
           morphogenesis protein, start by similarity
          Length = 326

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 6/72 (8%)

Query: 161 GQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKKL----GSQIA--DKIFLEKR 214
           GQ+  ++  V RRYS+FL L++ L       +  E PP+ L    GS+    DK  +E+R
Sbjct: 40  GQEELRETTVWRRYSEFLALKKELESSCGCDIPYEFPPRTLWFGGGSKTGGTDKKVIEER 99

Query: 215 RKGLLRFINLVM 226
           +  L  F++ ++
Sbjct: 100 KVKLADFMSELL 111

>Sklu_2221.5 YDR425W, Contig c2221 7089-9104
          Length = 671

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 16/79 (20%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRMVPELPPKK---------LGSQIADKIFLEKRRKGLLR 220
           V RRYS+F  L++ L R  P  ++P +P K          L ++   KI ++KR++ L  
Sbjct: 209 VTRRYSEFDTLRQALCRLLPSVIIPPIPSKHPLIKYFLNPLNAENDVKI-IDKRKRLLTS 267

Query: 221 FINL------VMKHPVFQK 233
           F+N       + +H VF+K
Sbjct: 268 FLNSCYYTDEIKEHVVFKK 286

>Sklu_2219.2 YDL113C, Contig c2219 4054-5958
          Length = 634

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 169 CVVRRYSDFLWLQETLLRRYPFRMVPELPPKK 200
            V RRYS+F  L++ L++ +P  ++P +P K+
Sbjct: 188 TVRRRYSEFESLRKILVKLFPMTLIPPIPEKQ 219

>Kwal_55.21533
          Length = 159

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRM---VPELPPK-------KLGSQIADKIFLEKRRKGLL 219
           + +RYSDF+  +E L+     ++   +P LPPK       +         +L +RR GL 
Sbjct: 74  IYKRYSDFVRFREELMATLSPKLRTGIPALPPKLSWFDSWRYDDANFKSAWLARRRAGLE 133

Query: 220 RFINLVM 226
            F+N V+
Sbjct: 134 FFLNQVL 140

>Scas_714.58
          Length = 636

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 14/78 (17%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRMVPELPPKK-LGSQIADKI-------FLEKRRKGLLRF 221
           V RRYS+F  L + L R  P  ++P +P K  L + + + I        ++KR++    F
Sbjct: 197 VTRRYSEFDSLYQVLKRLLPTIVIPPIPTKHPLINYLINPINVNNDTKIIDKRKRKFNSF 256

Query: 222 IN------LVMKHPVFQK 233
           +N       +  H VFQK
Sbjct: 257 LNNCNDIPEIRNHVVFQK 274

>Sklu_2167.4 YGL212W, Contig c2167 6607-7656 reverse complement
          Length = 349

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 170 VVRRYSDFLWLQETLLRRYPFRMVPELPPKKLG-----SQIADKIFLEKRRKGLLRFINL 224
           V RR+S+F+ L++ L + +   +  ELPP+  G     S   D   +++R+  L  F+  
Sbjct: 43  VSRRFSEFVSLKKQLEQEFNAELPYELPPRHYGFWNKSSHSCDPQVIQERKSKLSTFLLD 102

Query: 225 VMKHPV---FQKDDLVLTFLTVPTELSNWRKQ 253
           ++       ++K   +  FL +P    NW  Q
Sbjct: 103 LLNDSFDTRWKKSPFLCHFLQLP---GNWDTQ 131

>Kwal_47.19079
          Length = 345

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 172 RRYSDFLWLQETLLRRYPFRMVPELPPKKLG-----SQIADKIFLEKRRKGLLRFINLVM 226
           RR+SDF+ L++ L +     +  ELPP++       S   D   +E+R K L  F++ ++
Sbjct: 46  RRFSDFVKLKKDLEQEVGSELPYELPPRRFNKWMRPSGSCDPDVIEERVKELSTFLHDLL 105

Query: 227 KHPV---FQKDDLVLTFLTVPTE 246
                  ++K   V  FL +P++
Sbjct: 106 NDSFDTRWKKSPYVCHFLQIPSD 128

>Sklu_1899.2 YLR060W, Contig c1899 2604-4391
          Length = 595

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 190 FRMVPELPPKKL-GSQIADKIFLEKRRKGLLRFINLVMKHPV----FQKDDLVLTFLTVP 244
           F+ +P    K+L G+QI       +++  L RF++++   PV    F  DD   T  ++P
Sbjct: 167 FKFIPLNQHKELTGAQIIQMYKQPEQKNNLGRFVHIIEDSPVYPVIFDSDD---TVCSLP 223

Query: 245 TELSNWRKQASFDTSDEFID 264
             +++ R + S DT + FI+
Sbjct: 224 PLINSERSKISLDTRNVFIE 243

>ACR219W [1266] [Homologous to ScYLR060W (FRS1) - SH]
           complement(736515..738344) [1830 bp, 609 aa]
          Length = 609

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 8/80 (10%)

Query: 190 FRMVPELPPKKL-GSQIADKIFLEKRRKGLLRFINLVMKHPV----FQKDDLVLTFLTVP 244
           F+ VP    K+L G ++ D     +++  L RF++++   PV    F   D V    ++P
Sbjct: 167 FKFVPLFQSKELTGKEVVDLYKTPEQKNNLGRFVHIIENSPVYPVIFDSQDQV---CSLP 223

Query: 245 TELSNWRKQASFDTSDEFID 264
             +++ R + S DT + FI+
Sbjct: 224 PLINSERSKISIDTRNVFIE 243

>KLLA0D01958g complement(167629..171015) similar to sp|Q01846
           Saccharomyces cerevisiae YML104c MDM1 intermediate
           filament protein singleton, start by similarity
          Length = 1128

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 75/180 (41%), Gaps = 15/180 (8%)

Query: 172 RRYSDFLWLQETLLRRYPFRM--------VPELPPKKLGSQIADKIFLEKRRKGLLRFIN 223
           RR+S+F  L   L ++YP  +         PE     L   ++  +  E+RRK L  ++ 
Sbjct: 815 RRFSEFYRLNSYLKKKYPGVVSYLQNSNGFPERVKMSLKYHVSKTLLYEERRKRLEYYMQ 874

Query: 224 LVMKHPVFQKDDLVLTFLTVPTELSNWRKQASFDTSDEFIDKRIAASFVKMWHKGISEQW 283
            ++K     +D+    +L   T++SN  K    +  ++  DKR +   +K     + E  
Sbjct: 875 ELLKIREVCQDEYFRKYL---TDVSNTFKVKE-NLEEDVEDKRRSMVLLKT-DNTVGEVT 929

Query: 284 NNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFGSLVNDLSNLTPNLYPIEQSDT 343
           N +A   +        +       ER     A+  +  G+LV  +  L  + + + QS+T
Sbjct: 930 NVSAGRFDDPKSFSDELDFF--EDERNFHSGANGSNNTGTLVKPICELFISFFALNQSNT 987

>AER438C [2938] [Homologous to ScYGL212W (VAM7) - SH]
           (1474934..1475980) [1047 bp, 348 aa]
          Length = 348

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 149 TNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPKK-----LGS 203
           T   V+H     G +SA +    RR+S+FL L+  L R +   +  + P +K     + S
Sbjct: 26  TRVRVQH-----GSESAVEYKCRRRFSEFLQLKLDLEREFDAEIPYDFPARKFNLWNMKS 80

Query: 204 QIADKIFLEKRRKGLLRFI 222
           +  D   +++RR+ L  F+
Sbjct: 81  RSCDPAVVDERRERLTSFL 99

>KLLA0A01672g 147876..148916 weakly similar to sp|P32912
           Saccharomyces cerevisiae YGL212w VAM7 vacuolar
           morphogenesis protein singleton, start by similarity
          Length = 346

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 48/103 (46%), Gaps = 10/103 (9%)

Query: 172 RRYSDFLWLQETLLRRYPFRMVPELPPKKL----GSQIADKIFLEKRRKGLLRFINLVMK 227
           RR+ DFL L++ L       +  ELP ++L     +   D   +E+RR  L +F++ ++ 
Sbjct: 44  RRFKDFLQLKKQLEYECSGELPYELPGRRLLWSRTANSCDPDVVEERRVKLRQFLSDLLN 103

Query: 228 HPV---FQKDDLVLTFLTVPTELSNWRKQASFDTSDEFIDKRI 267
                 ++   LV  FL +P     W  ++S  + + F  + I
Sbjct: 104 DSFETKWRNSSLVAQFLNLP---EGWYIKSSTKSGNSFTKETI 143

>Sklu_2442.6 YCL018W, Contig c2442 9111-10205
          Length = 364

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/127 (17%), Positives = 54/127 (42%), Gaps = 7/127 (5%)

Query: 263 IDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFG 322
           +DK    +  ++W K + E   N   ++    ++     +++ +   KL  +    ++FG
Sbjct: 190 LDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKSPTKLNGIVITSNMFG 249

Query: 323 SLVNDLSNLTP---NLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQDN----ATKTCNS 375
            +++D +++ P    L P     ++ D N  F + +       D+ ++     AT    +
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLPKNKVNPIATILSAA 309

Query: 376 LLPKFKL 382
           ++ K  L
Sbjct: 310 MMLKLSL 316

>KLLA0C15543g 1349181..1352129 similar to sgd|S0006301 Saccharomyces
           cerevisiae YPR097w, start by similarity
          Length = 982

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 147 KHTNYSVKHLIELPGQDSAKDNCVVRRYSDFLWLQETLLRRYPFRMVPELPPK 199
           +H +Y    +I +  +D A    V + Y DF  L + L   YP + +P+LP K
Sbjct: 265 RHQSY---FMIRVRKEDPATTVFVYKTYEDFKRLAKDLKTGYPGKKLPQLPHK 314

>KLLA0D04906g 420903..421991 gi|417243|sp|P23390|LEU3_KLULA
           Kluyveromyces lactis 3-isopropylmalate dehydrogenase
           (Beta-IPM dehydrogenase) (IMDH) (3-IPM-DH), start by
           similarity
          Length = 362

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/141 (18%), Positives = 56/141 (39%), Gaps = 5/141 (3%)

Query: 263 IDKRIAASFVKMWHKGISEQWNNAASSIERTMEIWSRICILVERHERKLKQMAHEQSIFG 322
           +DK    +  ++W K + E        +    ++     +++ +   KL  +    ++FG
Sbjct: 188 LDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSPTKLNGVVITNNMFG 247

Query: 323 SLVNDLSNLTP---NLYPIEQSDTVLDINNHFSIIKKHLNKTQDIAQD--NATKTCNSLL 377
            +++D +++ P    L P     ++ D N  F + +       D+  +  N   T  S  
Sbjct: 248 DIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPANKVNPIATILSAA 307

Query: 378 PKFKLFTDILLSLRGLFERYK 398
              KL  D++   R L E  +
Sbjct: 308 MMLKLSLDLVEEGRALEEAVR 328

>Scas_717.60d
          Length = 167

 Score = 28.9 bits (63), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 57  FNSKTDILEQRVWGEAPPDPTPNTVVPIIEPNINQPQSGPTQGQSHEQSSE-LDQSELFG 115
           FN +  IL +R +      P    ++ ++E N N+ +S   +GQS + S E L  +ELF 
Sbjct: 47  FNKEDLILIEREY------PGLTKIIQVVEQNRNEVESFTDEGQSADSSCEILTSNELFN 100

Query: 116 QWCDQIRKSY 125
             C +  K++
Sbjct: 101 --CKECSKAF 108

>YML104C (MDM1) [3867] chr13 complement(58939..62322) Intermediate
           filament protein involved in organelle inheritance and
           in the regulation of mitochondrial morphology [3384 bp,
           1127 aa]
          Length = 1127

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 8/91 (8%)

Query: 161 GQDSAKDNCVVRRYSDFLWLQETLLRRYP--FRMVPELPPKK----LGSQIADKIFLEKR 214
           GQ S+ D  + RRY++F  L   L + +    R + +L P K    L   +   +  E+R
Sbjct: 814 GQVSSWD--MARRYNEFFELNTYLKKNFRDLMRQLQDLFPSKVKMSLKYHVTKTLLYEER 871

Query: 215 RKGLLRFINLVMKHPVFQKDDLVLTFLTVPT 245
           ++ L +++  ++      +D++   FLT PT
Sbjct: 872 KQKLEKYLRELLSISEICEDNIFRRFLTDPT 902

>Sklu_1262.1 YPR061C, Contig c1262 1479-2330
          Length = 283

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 74/186 (39%), Gaps = 36/186 (19%)

Query: 346 DINNHFSIIKKHLNKTQDIAQDNATKTCNSLLPKFKLFT---DILLSLR--GLFERYKIM 400
           DI+N+ +I+    +   DI  D+ T T    L +FK+     D+L   R  G+++RYK  
Sbjct: 72  DISNNITILATKPHHHTDITGDSPTLTTADKLYRFKVLNEAYDLLTDSRRKGIYDRYKTG 131

Query: 401 ATNNIPQLQRHVVLNREKLEAMKGKPDA-------NGVEYDRIKMSITRDKKSISEQLNR 453
            ++  P      V +     A     D        N   ++ +      D+K IS  +  
Sbjct: 132 WSHG-PVAFSSHVSSYASSNAGATSNDYHSNSDYWNAGTWEDVNNLGKTDQKKISAWMIL 190

Query: 454 AWLVRKCILEEFTIF---------------QETQFMLTRAFQDWSKLNASFVGINLNEWE 498
           AW+    +  EFT                  ET+  LT+A+ ++        G++ ++W 
Sbjct: 191 AWMCGLFVCVEFTALLTRIEETINQKNFTHDETEKDLTQAYINY--------GLDTDKWS 242

Query: 499 KLEEQL 504
           +L   L
Sbjct: 243 RLRRFL 248

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,783,004
Number of extensions: 726455
Number of successful extensions: 2384
Number of sequences better than 10.0: 83
Number of HSP's gapped: 2412
Number of HSP's successfully gapped: 83
Length of query: 512
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 406
Effective length of database: 12,926,601
Effective search space: 5248200006
Effective search space used: 5248200006
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)