Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_643.24d78478434090.0
YOR322C81867217170.0
CAGL0F00737g79569714550.0
KLLA0A04103g78567213251e-172
ACR291C68455610671e-135
Kwal_26.71001781552255e-21
Scas_30.1d72541283e-09
YNL287W (SEC21)935102712.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_643.24d
         (784 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_643.24d                                                         1317   0.0  
YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protei...   665   0.0  
CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces cer...   565   0.0  
KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyce...   514   e-172
ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981) [...   415   e-135
Kwal_26.7100                                                           91   5e-21
Scas_30.1d                                                             54   3e-09
YNL287W (SEC21) [4324] chr14 (91992..94799) Coatomer (COPI) comp...    32   2.3  

>Scas_643.24d
          Length = 784

 Score = 1317 bits (3409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/784 (84%), Positives = 660/784 (84%)

Query: 1   VGYLGGTDTGNNSVDSVTKLTRPTMAHYVDRXXXXXXXXXXXXXXTVVSPPLENIISIQG 60
           VGYLGGTDTGNNSVDSVTKLTRPTMAHYVDR              TVVSPPLENIISIQG
Sbjct: 1   VGYLGGTDTGNNSVDSVTKLTRPTMAHYVDRNNSISGSSNSNGLNTVVSPPLENIISIQG 60

Query: 61  NVPLLNQSNSSTQILTPNNTREVRMHSVSQVLDTDRITQXRKMLPFAKLAQSSSIKSLNP 120
           NVPLLNQSNSSTQILTPNNTREVRMHSVSQVLDTDRITQ RKMLPFAKLAQSSSIKSLNP
Sbjct: 61  NVPLLNQSNSSTQILTPNNTREVRMHSVSQVLDTDRITQ*RKMLPFAKLAQSSSIKSLNP 120

Query: 121 SKNVATEHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKP 180
           SKNVATEHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKP
Sbjct: 121 SKNVATEHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKP 180

Query: 181 SKSAPQKSPRPGRRKSAIGSTLSTTFSQLAVXXXXXXXXXXXXXXXXXXXNTKIMNGYTK 240
           SKSAPQKSPRPGRRKSAIGSTLSTTFSQLAV                   NTKIMNGYTK
Sbjct: 181 SKSAPQKSPRPGRRKSAIGSTLSTTFSQLAVAQSQATASSQKTTPSPSPSNTKIMNGYTK 240

Query: 241 ISVTSVSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYP 300
           ISVTSVSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYP
Sbjct: 241 ISVTSVSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYP 300

Query: 301 FSYLIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRS 360
           FSYLIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRS
Sbjct: 301 FSYLIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRS 360

Query: 361 IPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVE 420
           IPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVE
Sbjct: 361 IPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVE 420

Query: 421 ETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSSPENLP 480
           ETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSSPENLP
Sbjct: 421 ETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSSPENLP 480

Query: 481 LQRLRNHGDLXXXXXXXXXXMRTPQDXXXXXXXXXXXXXDIPEXXXXXXXXXXXEFIHPS 540
           LQRLRNHGDL          MRTPQD             DIPE           EFIHPS
Sbjct: 481 LQRLRNHGDLNSNSSRNNPSMRTPQDGSASSGNGHNGSNDIPEDRDDQDDVSVDEFIHPS 540

Query: 541 DDAXXXXXXXXXXXXXXXXXXXXIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGKIEL 600
           DDA                    IAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGKIEL
Sbjct: 541 DDALRQELLQQQQRLREQQLQQEIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGKIEL 600

Query: 601 VTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAVEIVVA 660
           VTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAVEIVVA
Sbjct: 601 VTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAVEIVVA 660

Query: 661 EETLQYSNGQPIXXXXXXXXXXXXXXXXXXADQRLAELSPMFANRNAPRTRPVSNNSITP 720
           EETLQYSNGQPI                  ADQRLAELSPMFANRNAPRTRPVSNNSITP
Sbjct: 661 EETLQYSNGQPIRSKSRSDKSKNSSNSGSSADQRLAELSPMFANRNAPRTRPVSNNSITP 720

Query: 721 VNSRTTXXXXXXXXXXXXXXXXXXLPINSSKVVSVPTGAARVLRMQFRLNVTERSGLGIS 780
           VNSRTT                  LPINSSKVVSVPTGAARVLRMQFRLNVTERSGLGIS
Sbjct: 721 VNSRTTNGETSSGNNDENNSENAGLPINSSKVVSVPTGAARVLRMQFRLNVTERSGLGIS 780

Query: 781 WDEE 784
           WDEE
Sbjct: 781 WDEE 784

>YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.578p [2457 bp, 818 aa]
          Length = 818

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/672 (54%), Positives = 444/672 (66%), Gaps = 39/672 (5%)

Query: 129 PIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQKS 188
           P+ LSI+VESPPCVLYGSA +S+G++LSG+ T+ V DPY+        S+K ++S    +
Sbjct: 28  PLTLSIDVESPPCVLYGSAMESSGAVLSGLFTVTVVDPYSSAE---DKSLKNTESNVSTT 84

Query: 189 PRPGRRKSAIGSTLSTTFSQLAVXXXXXXXXXXXXXXXXXX--XNTKIMNGYTKISVTSV 246
            +  +RKS  GS LS+  S L+                      N +IM GYTKI++TSV
Sbjct: 85  SKSLKRKSTFGSALSSRLSSLSASTSNISPSTSSTSISHSPTPANLRIMAGYTKITITSV 144

Query: 247 SLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYPFSYLIP 306
           +L+ VQKIHFHKPF P+ SS+Q+C NC+TK+T+MKSW IQ   QD  VG+H+YPFSYLIP
Sbjct: 145 TLSLVQKIHFHKPFVPNISSMQTCMNCKTKITNMKSWEIQSNTQDLSVGSHSYPFSYLIP 204

Query: 307 GSVPSTSYLGSNAETQIKYELIAVATYKEPTR-----------RHDVKSKEKMLRLVMPV 355
           GSVP +S LG+ AETQ+KYELIAV TY +P R           +    SK+++L+L MP+
Sbjct: 205 GSVPCSSSLGATAETQVKYELIAVVTYIDPHRNSFSSGHSTPRKEGSSSKKRLLQLAMPI 264

Query: 356 AVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKL 415
           AVTRSIPRGPDKNSLRVFPPTELTAAAVLPNV+YPKSTFPLEMKLDGVS  DRRWRMRKL
Sbjct: 265 AVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVVYPKSTFPLEMKLDGVSSGDRRWRMRKL 324

Query: 416 SWRVEETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSS 475
           SWR+EETTRV+++AC VH+HELR+LE+ VK +E E++KKP   IKRYG++GPQ+RVAV+S
Sbjct: 325 SWRIEETTRVKAHACPVHKHELRQLEEQVKIKESEKSKKPRSHIKRYGELGPQIRVAVNS 384

Query: 476 PENLPLQRLRNHGDLXXXXXXXXXXMRTPQDXXXXXXXXXXXXXDIPEXXXXXXXXXXXE 535
            EN+P QRL                 + P               + P            E
Sbjct: 385 LENMPSQRLPGE----------PGREQAPNSSGPASTGNVGLDDENP-VNEDEEDQPGSE 433

Query: 536 FIHPSDDAXXXXXXXXXXXXXXXXXXXXIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENN 595
           FIHPSDDA                    + KN+S+LFTEEVRII+KG+MKSGWKTDF+NN
Sbjct: 434 FIHPSDDALRQELLMQQQRARQQQLQQEL-KNNSSLFTEEVRIISKGEMKSGWKTDFDNN 492

Query: 596 GKIELVTEIDCMPLNSGVGNPVTMVSTSK-PHINSHKQDANISCDIQDPNLGIYVNHILA 654
           GKIELVTEIDCM LNSGV NPV   ST + P   + K   N++CDIQDPNLG+YV+HILA
Sbjct: 493 GKIELVTEIDCMGLNSGVSNPVMHASTLQTPSTGNKKPSINVACDIQDPNLGLYVSHILA 552

Query: 655 VEIVVAEETLQYSNGQPIXX--XXXXXXXXXXXXXXXXADQRLAELSPMFANRNAPRTRP 712
           VEIVVAEETLQY+NGQPI                     DQRLAELSP+FANRN P+ R 
Sbjct: 553 VEIVVAEETLQYANGQPIRKPNSKNKKETNNNTMNVHNPDQRLAELSPIFANRNTPKVRR 612

Query: 713 VSNNSITPVNSRTTXXXXXXXXXXXXXXXXXXLPINSSKVVSVPTGAARVLRMQFRLNVT 772
           +    ITPVNS  +                     ++S +VSVPTGAARVLRMQFRL VT
Sbjct: 613 MGPEDITPVNSNKSNHSTNKEKASNGA--------SNSNIVSVPTGAARVLRMQFRLTVT 664

Query: 773 ERSGLGISWDEE 784
           ERSGLGISWDEE
Sbjct: 665 ERSGLGISWDEE 676

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 11/81 (13%)

Query: 19  KLTRPTMAHYVDRXXXXXXXXXXXXXXTVVSPPLENIISIQGNVPLLNQSNSSTQILTPN 78
           KLT P  AH+                 TV SPPLE+++S+QG+VP          +LTP+
Sbjct: 749 KLTIPPTAHHYQ-----PASSSQRSLTTVQSPPLESVVSVQGSVPFRGH------VLTPH 797

Query: 79  NTREVRMHSVSQVLDTDRITQ 99
           +TR++R+ + S  LD++RITQ
Sbjct: 798 STRDIRIQNFSDFLDSNRITQ 818

>CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 795

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/697 (46%), Positives = 399/697 (57%), Gaps = 111/697 (15%)

Query: 129 PIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQKS 188
           PI+L +N+ESPPCVLYGSA DS G++L G   L VKDP ++  I + D+ +         
Sbjct: 56  PIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSVDNQE--------- 106

Query: 189 PRPGRRKSAIGSTLSTTFSQLAVXXXXXXXXXXXXXXXXXXXNTKIMNGYTKISVTSVSL 248
              GR                                      T+   GY  I++TSV L
Sbjct: 107 -HGGRNA------------------------------------TQHETGYNNITITSVHL 129

Query: 249 TFVQKIHFHKPFTPDTS----------------SIQSCTNCRTKLTDMKSWPIQKAPQDK 292
            FVQK+ ++KPF PD+S                +I +C NC+ K T +KSW IQ   +  
Sbjct: 130 KFVQKVTYNKPFIPDSSISASSTALQLPANATGNIINCKNCKVKYTSLKSWNIQSTKKLI 189

Query: 293 PVGAHTYPFSYLIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLV 352
            +G H YPFSYL+PGSVPSTS LG +A T+I+YEL+   +Y +P      K KE ML + 
Sbjct: 190 TIGKHAYPFSYLVPGSVPSTSALGLSANTKIQYELVGNVSYYDPVH----KDKEYMLNIK 245

Query: 353 MPVAVTRSIPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSL------Q 406
           MP+ VTRSI RGPDKNSLRVFPPT+LTAAAVLPNV+YPKSTFPLEMKL+G+S        
Sbjct: 246 MPIPVTRSIHRGPDKNSLRVFPPTQLTAAAVLPNVVYPKSTFPLEMKLNGISSPSTGKGS 305

Query: 407 DRRWRMRKLSWRVEETTRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIG 466
           D+RWRMRKL+WRVEETTRV++  C  H+ +L+KLE  VK +E ER+KKP   IKRYGDIG
Sbjct: 306 DKRWRMRKLAWRVEETTRVKTNVCTQHKPDLKKLEDQVKLKEEERSKKPPVPIKRYGDIG 365

Query: 467 PQVRVAVSSPENLPLQRLRNHGDLXXXXXXXXXXMRTPQDXXXXXXXXXXXXXDIPEXXX 526
           PQ+R+A+SSP N+PL      G               P               D  E   
Sbjct: 366 PQIRIALSSPSNMPLS-----GGRSGPQPTLTSSEEAPNSATLSSREGEAGNIDTDE--- 417

Query: 527 XXXXXXXXEFIHPSDDAXXXXXXXXXXXXXXXXXXXXIAKNDSTLFTEEVRIIAKGDMKS 586
                   +F+HPSDDA                    + KN S LF+EEVRII+KG+MKS
Sbjct: 418 ---NETTDQFVHPSDDAMRQELLQQQQRQREQQLKQEL-KNSSALFSEEVRIISKGEMKS 473

Query: 587 GWKTDFE-NNGKIELVTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQD---ANISCDIQD 642
           GWKTDF+ +NGK+ELVT+ID +  NSGV NP+   ST+ P+    K D     I+CDIQD
Sbjct: 474 GWKTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHTSTTHPY--KKKPDLPPVTIACDIQD 531

Query: 643 PNLGIYVNHILAVEIVVAEETLQYSNGQPIXX---------------XXXXXXXXXXXXX 687
           PNLGIYVNH LA+EIVVAEE LQY+NGQPI                              
Sbjct: 532 PNLGIYVNHTLAIEIVVAEEALQYANGQPIRNGGSRRSSVIPEGSKPEGTTENMNDDDDD 591

Query: 688 XXXADQRLAELSPMFANRNAPRTRPVSNNSITPVNSRTTXXXXXXXXXXXXXXXXXXLPI 747
               DQRL ELSPMFANRNA R +PV  N ++PVNSR++                     
Sbjct: 592 SREMDQRLLELSPMFANRNAQRAKPVEYNDLSPVNSRSSTRSGNNTGRITPHMS------ 645

Query: 748 NSSKVVSVPTGAARVLRMQFRLNVTERSGLGISWDEE 784
           ++ ++VSVPTGAARVLRMQFR+NVTERSGLGISWDEE
Sbjct: 646 STPRIVSVPTGAARVLRMQFRINVTERSGLGISWDEE 682

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 5/54 (9%)

Query: 46  TVVSPPLENIISIQGNVPLLNQSNSSTQILTPNNTREVRMHSVSQVLDTDRITQ 99
           TV SP LENIISIQG VP    S      LTPNNT E+ + ++S+VLDTDRITQ
Sbjct: 747 TVQSPQLENIISIQGAVPYGRGS-----PLTPNNTIEMGIRNLSEVLDTDRITQ 795

>KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 785

 Score =  514 bits (1325), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 285/672 (42%), Positives = 398/672 (59%), Gaps = 70/672 (10%)

Query: 127 EHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQ 186
           +HPIELSIN+ESPPCVLYGSA +S+G+LL G++T+ + D   +        I+P KS P 
Sbjct: 28  DHPIELSINIESPPCVLYGSATESSGALLGGLLTVTINDDLPE--------IQPCKSTPL 79

Query: 187 KSPRPGRRKSAIGSTLSTTFSQLAVXXXXXXXXXXXXXXXXXXXNTKIM---NGYTKISV 243
                G+RK    S  ++                           + ++      T +S+
Sbjct: 80  TPVNSGQRKQLTNSLTTSLSHLSLSHAHHAHHQKSGDNLKRLASMSNLITPPKAITSVSL 139

Query: 244 TSVSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYPFSY 303
            SV L+ +QK+H+ KPF P  + + +CTNC+TK+T+   W I   P +  VG H++PFS+
Sbjct: 140 NSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSH 199

Query: 304 LIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRSIPR 363
           LIPG++P T++LGSN+ + IKYELIAVATYK P +    +S +++L+L +P+++TRSI R
Sbjct: 200 LIPGNLPPTTHLGSNSHSTIKYELIAVATYKHPFKGKG-ESAKRVLQLNLPISITRSILR 258

Query: 364 GPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVEETT 423
           G DK SLRVFPPTELTA AVLPNV+YPKSTF +E+KLDG+   DRRWRMRKL+WR+EE  
Sbjct: 259 GSDKTSLRVFPPTELTANAVLPNVVYPKSTFSMELKLDGICSDDRRWRMRKLNWRIEEKV 318

Query: 424 RVRSYACKVHQHELRKLEKHVKE-----REIERNKKPMQQIKRYGDIGPQVRVAVSSPEN 478
           +VR++ C+ H+ +L++LE+ VK+     R+I ++ KP   IKR  D+GPQV++ V++  +
Sbjct: 319 KVRAHGCQAHKAKLKQLEEKVKQDEERDRQIRKSSKP---IKRSVDMGPQVKMTVNTFHD 375

Query: 479 LPLQRLRNHGDLXXXXXXXXXXMRTPQDXXXXXXXXXXXXXD---IPEXXXXXXXXXXXE 535
           + LQ+L                +  P+D             D   IP+           +
Sbjct: 376 VLLQQL-------SRANTEAEDVDNPEDTTTAPSDEALRDEDHDTIPD--------TPTD 420

Query: 536 FIHPSDDAXXXXXXXXXXXXXXXXXXXXIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENN 595
           FIHP+DDA                    + K +S L+TEEVR IA G++KSGWK+DF + 
Sbjct: 421 FIHPNDDAMRQEIMQQQQRVRQQQIEEEL-KQESALYTEEVRTIANGEIKSGWKSDFSDK 479

Query: 596 GKIELVTEIDCMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAV 655
           G IELVT+IDCM LNSGV NP++  ST  P +  ++ + N+SCD++D NLG+YV+H+L V
Sbjct: 480 GTIELVTDIDCMRLNSGVTNPISHASTRNPCVLPNQDNVNVSCDMEDTNLGVYVSHLLFV 539

Query: 656 EIVVAEETLQYSNG--QPIXXXXXXXXXXXXXXXXXXADQRLAELSPMFANR-NAPRTRP 712
           E++VAEE LQ  NG  +                    ADQRLAELSP+FA+R N P  +P
Sbjct: 540 EVIVAEEQLQNVNGGNRSRTGSTVSDTSKTASKPKNNADQRLAELSPIFADRENKP--QP 597

Query: 713 VSNNSITPVNSRTTXXXXXXXXXXXXXXXXXXLPINSSKVVSVPTGAARVLRMQFRLNVT 772
           V +N   P N+                           K+V VPTGAARVLRMQFR+ +T
Sbjct: 598 VIDNQ--PGNNV------------------------GPKIVGVPTGAARVLRMQFRVIMT 631

Query: 773 ERSGLGISWDEE 784
           ERSGLGISWD+E
Sbjct: 632 ERSGLGISWDDE 643

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 6/48 (12%)

Query: 52  LENIISIQGNVPLLNQSNSSTQILTPNNTREVRMHSVSQVLDTDRITQ 99
           L++++S QG  P  N +      LTP  TR + + ++S++LDTDRITQ
Sbjct: 744 LDHVMSTQGAEPGFNSA------LTPQTTRMINVPTISELLDTDRITQ 785

>ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981)
           [2055 bp, 684 aa]
          Length = 684

 Score =  415 bits (1067), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/556 (41%), Positives = 301/556 (54%), Gaps = 73/556 (13%)

Query: 243 VTSVSLTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSWPIQKAPQDKPVGAHTYPFS 302
           V  ++L   Q++ + +PF      + SC  CR +  ++  W +     +   G H YPFS
Sbjct: 67  VARLTLVLEQQVTYGRPFV--AGPLGSCAACRERRRELARWEVVAQAAELAGGRHAYPFS 124

Query: 303 YLIPGSVPSTSYLGSNAETQIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRSIP 362
           +L+ G +P+TS LGS   TQI+YEL+A A Y+          +E+   L +PV VTRSI 
Sbjct: 125 HLLAGELPATSTLGSAGATQIRYELVADAVYRAG------GGEERRRELRLPVLVTRSIL 178

Query: 363 RGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDGVSLQDRRWRMRKLSWRVEET 422
           RGPD+NSLRVFPPT++TA AVLP+VIYP+ST PLE++L GV   DRRWRMR+L+WR++E 
Sbjct: 179 RGPDRNSLRVFPPTDVTATAVLPSVIYPRSTIPLELQLGGVCCADRRWRMRRLTWRIDEK 238

Query: 423 TRVRSYACKVHQHELRKLEKHVKEREIERNKKPMQQIKRYGDIGPQVRVAVSSPEN-LPL 481
            RVRS+AC  H+  LR LE+ V+ +     KKP + IKR  D+GPQV V+V++ E+ LP 
Sbjct: 239 VRVRSHACAAHRARLRALEEEVRAKTARNLKKPAKPIKRTPDMGPQVTVSVATVEDPLPF 298

Query: 482 QRLRNHGDLXXXXXXXXXXMRTPQDXXXXXXXXXXXXXDIPEXXXXXXXXXXXEFIHPSD 541
               + G            M    D                             FIHPSD
Sbjct: 299 ----DAGSAAARQEADVGNMDDDADTQSA-------------------------FIHPSD 329

Query: 542 DAXXXXXXXXXXXXXXXXXXXXIAKNDSTLFTEEVRIIAKGDMKSGWKTDFENNGKIELV 601
            A                      K +++ + EEVR IA  D++SGWK+DF  +GKIELV
Sbjct: 330 HAMQQELQELQARIRQQQLEEE-RKQETSHYIEEVRTIAGTDIRSGWKSDFSGSGKIELV 388

Query: 602 TEIDCMPLNSGVGNPVTMVSTSKPHINSHKQDANISCDIQDPNLGIYVNHILAVEIVVAE 661
            EIDCM LNSGV NPV MVST+ P++   +   N++CD++DP LGI VNH+L VEI+VAE
Sbjct: 389 MEIDCMKLNSGVTNPVNMVSTTSPYLARGQAPVNVTCDVEDPTLGISVNHLLLVEIIVAE 448

Query: 662 ETLQYSNGQPIXXXXXXXXXXXXXXXXXX----------ADQRLAELSPMFANRNAPRTR 711
           E L Y+NGQ +                            ADQRLAELSPMFANRN    R
Sbjct: 449 EMLHYTNGQLLSKGEAQGEGEGQGEALAEAKPAGLAGSHADQRLAELSPMFANRNNSMFR 508

Query: 712 PVSNN---SITPVNSRTTXXXXXXXXXXXXXXXXXXLPINSSKVVSVPTGAARVLRMQFR 768
             +      + P  S                           ++V  PTGAARVLRMQF+
Sbjct: 509 ASAEEHSPGLEPDGSTAGA---------------------DKRIVGTPTGAARVLRMQFK 547

Query: 769 LNVTERSGLGISWDEE 784
           L +TERSGLGISWD+E
Sbjct: 548 LTMTERSGLGISWDDE 563

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 34/47 (72%)

Query: 125 ATEHPIELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVS 171
            ++H +EL + +ESPPCVLYG   +S G+LLSG+VT++V+   A+  
Sbjct: 17  GSDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVHVQGAGAEAG 63

>Kwal_26.7100
          Length = 178

 Score = 91.3 bits (225), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 85/155 (54%), Gaps = 15/155 (9%)

Query: 130 IELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQKSP 189
           +EL I++ESPPCVLYG+A +STG+LLSG++ + VK P   +S  + + + P  S  +K  
Sbjct: 33  VELLIDIESPPCVLYGTATESTGALLSGLLKVRVKQPGDKIS--SSEPLSPVNSHGRK-- 88

Query: 190 RPGRRKSAIG-STLSTTFSQLAVXXXXXXXXXXXXXXXXXXXNTKIMNGYTKISVTSVSL 248
               +KS+ G + +S T S L++                          +TK  V SVSL
Sbjct: 89  ----KKSSTGLNAISQTLSNLSLANANVSPVASPGISRTPSVI------FTKALVKSVSL 138

Query: 249 TFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSW 283
           + VQK+ + KPF    +SIQSC NCR+K T+   W
Sbjct: 139 SLVQKVRYAKPFDAQCNSIQSCLNCRSKDTERARW 173

>Scas_30.1d
          Length = 72

 Score = 53.9 bits (128), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 6/54 (11%)

Query: 46 TVVSPPLENIISIQGNVPLLNQSNSSTQILTPNNTREVRMHSVSQVLDTDRITQ 99
          +V SP LEN++SIQGN P          ILTP+ TR++ + ++S++LDTDRITQ
Sbjct: 25 SVQSPQLENVVSIQGNAP------GHGYILTPHTTRDIGISNISELLDTDRITQ 72

>YNL287W (SEC21) [4324] chr14 (91992..94799) Coatomer (COPI) complex
           gamma chain (gamma-COP) of secretory pathway vesicles,
           required for retrograde Golgi to endoplasmic reticulum
           transport [2808 bp, 935 aa]
          Length = 935

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 2/102 (1%)

Query: 303 YLIPGSVPSTSYLGSNAET--QIKYELIAVATYKEPTRRHDVKSKEKMLRLVMPVAVTRS 360
           +L  G    +S+ G+ + T  ++  E +AV   +E     +V  K  +    +PV  T+ 
Sbjct: 817 FLNAGDYVKSSFTGNFSATFDELPCEEVAVFNIQEDLSIQEVVDKIILNSSCLPVESTQF 876

Query: 361 IPRGPDKNSLRVFPPTELTAAAVLPNVIYPKSTFPLEMKLDG 402
            P   + ++L++F  + LT + V   +   KS+  L +K+ G
Sbjct: 877 APSDSNSHTLKLFGKSALTGSKVALQIKMIKSSKGLALKVHG 918

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,377,265
Number of extensions: 808276
Number of successful extensions: 2527
Number of sequences better than 10.0: 19
Number of HSP's gapped: 2570
Number of HSP's successfully gapped: 31
Length of query: 784
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 674
Effective length of database: 12,788,129
Effective search space: 8619198946
Effective search space used: 8619198946
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 66 (30.0 bits)