Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_643.2476976939380.0
YAL023C (PMT2)75972525450.0
Kwal_26.710574072125390.0
Scas_505.275276524620.0
KLLA0F15829g74172224300.0
CAGL0J08734g74272224080.0
YOR321W (PMT3)75371124060.0
ACR290W75572523200.0
CAGL0F00759g73471919230.0
Kwal_33.1547175576917130.0
KLLA0F21978g75770615930.0
YGR199W (PMT6)75976215590.0
CAGL0K00979g73070614830.0
CAGL0L07216g8587078891e-107
Scas_408.1*3913338171e-102
YDL095W (PMT1)8177237959e-94
Kwal_23.36238767347841e-91
ADR279C8177087662e-89
KLLA0E01342g8386897635e-89
YDL093W (PMT5)7436336991e-80
CAGL0M00220g7657236739e-77
Scas_442.13093116345e-76
KLLA0B03762g7727326624e-75
ABL085W7577106282e-70
Kwal_47.167347927226283e-70
Scas_710.19197086281e-69
YJR143C (PMT4)7627375886e-65
Scas_719.807627095649e-62
CAGL0L07172g7776394696e-49
Scas_329.12732263272e-33
Scas_30.11281183105e-33
Sklu_2215.66534493132e-29
AAL050W6573322802e-25
Kwal_33.143576572432222e-18
Scas_588.77264651821e-13
KLLA0C14828g6293021713e-12
YDR307W6623121364e-08
Scas_710.0d271166940.002
Kwal_23.5281162164721.7
YOR104W (PIN2)28266675.1
Scas_686.5928108668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_643.24
         (769 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_643.24                                                          1521   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...   984   0.0  
Kwal_26.7105                                                          982   0.0  
Scas_505.2                                                            952   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...   940   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...   932   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   931   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...   898   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   745   0.0  
Kwal_33.15471                                                         664   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   618   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   605   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   575   0.0  
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   347   e-107
Scas_408.1*                                                           319   e-102
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   310   9e-94
Kwal_23.3623                                                          306   1e-91
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   299   2e-89
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   298   5e-89
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   273   1e-80
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   263   9e-77
Scas_442.1                                                            248   5e-76
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   259   4e-75
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   246   2e-70
Kwal_47.16734                                                         246   3e-70
Scas_710.1                                                            246   1e-69
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   231   6e-65
Scas_719.80                                                           221   9e-62
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   185   6e-49
Scas_329.1                                                            130   2e-33
Scas_30.1                                                             124   5e-33
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       125   2e-29
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   112   2e-25
Kwal_33.14357                                                          90   2e-18
Scas_588.7                                                             75   1e-13
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    70   3e-12
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    57   4e-08
Scas_710.0d                                                            41   0.002
Kwal_23.5281                                                           32   1.7  
YOR104W (PIN2) [4908] chr15 (517642..518490) Protein of unknown ...    30   5.1  
Scas_686.5                                                             30   8.5  

>Scas_643.24
          Length = 769

 Score = 1521 bits (3938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/769 (95%), Positives = 734/769 (95%)

Query: 1   MSSSAAAVSGFEPKKEASDLKVRQHNXXXXXXXXXXXXXXXXXXXENVKKQQPPSEESPL 60
           MSSSAAAVSGFEPKKEASDLKVRQHN                   ENVKKQQPPSEESPL
Sbjct: 1   MSSSAAAVSGFEPKKEASDLKVRQHNSSAATSKAAKDSASIDEKDENVKKQQPPSEESPL 60

Query: 61  CKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM 120
           CKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM
Sbjct: 61  CKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM 120

Query: 121 LVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPA 180
           LVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPA
Sbjct: 121 LVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPA 180

Query: 181 VWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALL 240
           VWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALL
Sbjct: 181 VWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALL 240

Query: 241 GFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVC 300
           GFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVC
Sbjct: 241 GFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVC 300

Query: 301 LIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIK 360
           LIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIK
Sbjct: 301 LIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIK 360

Query: 361 NQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEY 420
           NQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEY
Sbjct: 361 NQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEY 420

Query: 421 VRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGD 480
           VRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGD
Sbjct: 421 VRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGD 480

Query: 481 EDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVES 540
           EDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVES
Sbjct: 481 EDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVES 540

Query: 541 HENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNV 600
           HENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNV
Sbjct: 541 HENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNV 600

Query: 601 GLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTF 660
           GLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTF
Sbjct: 601 GLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTF 660

Query: 661 MMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTLAKYI 720
           MMGAFYPLLAWGLHFMPFVIMARVTYVHH                EAIIRRPKGTLAKYI
Sbjct: 661 MMGAFYPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFEAIIRRPKGTLAKYI 720

Query: 721 TYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKISDLNE 769
           TYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKISDLNE
Sbjct: 721 TYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKISDLNE 769

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/725 (65%), Positives = 555/725 (76%), Gaps = 13/725 (1%)

Query: 46  ENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYL 105
           E+  K++P ++ S L ++E+ VMP++FT L+ FTRMYKIG+NNHVVWDEAHFGKFGSYYL
Sbjct: 46  EDFSKEKPAAQSS-LLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYL 104

Query: 106 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVP 165
           RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGE YPDYLDYVKMRLF A+FS+LCVP
Sbjct: 105 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVP 164

Query: 166 MAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQR 225
           +AY TAKAIGFS+P VWL T LVLFENSY+TLGRFILLDSML FFTVASF  F++FH QR
Sbjct: 165 LAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQR 224

Query: 226 KNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQ 285
             PFS KWW  L + G +LGC ISVKMVGLFIIT+VGIYTV DLWT L         K  
Sbjct: 225 SKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFL-------ADKSM 277

Query: 286 AWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGK 345
           +WK Y  HW+ARI  LII+PF +FL CF+IHF LLSHSGTGDANMPSLFQA L GSDVG+
Sbjct: 278 SWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQ 337

Query: 346 GPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIP 405
           GPRD+ALGSS VSIKNQALGG+LLHSH+QT+P GSNQQQVT Y Y D NN WFF+R R  
Sbjct: 338 GPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRER-- 395

Query: 406 GNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGD 465
           G   WS E ETDIEY++ G  YRLVH+ST +NLH   + APVSK  WEV+G+G    VGD
Sbjct: 396 GLPSWS-ENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNV-VGD 453

Query: 466 DMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSH 525
           + DNW+IE+++Q GDED   +H LTT+F IK+  +GCYL QT   LPEWGFRQ E+ C  
Sbjct: 454 NKDNWVIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMK 513

Query: 526 KISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKY 585
              K DKRTWWN+E+HENE+LP     F YPKTNF KDF+ LN  MMATNNALVPD DK+
Sbjct: 514 NPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKF 573

Query: 586 DSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQ 645
           D LAS+AWQWPTLNVGLRLCGW DD  KYFLLG+PASTW S+V+V+  M  +V+L  RWQ
Sbjct: 574 DYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQ 633

Query: 646 RQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXX 705
           RQ  +  N    N F+MG FYPLLAWGLH+MPFVIM+RVTYVHH                
Sbjct: 634 RQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCF 693

Query: 706 EAIIRR-PKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKI 764
           +A +++  +    + + ++    + A+VIG F+YFSPISFGM+GPS N+RYL+W S W I
Sbjct: 694 DAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDI 753

Query: 765 SDLNE 769
           +D  E
Sbjct: 754 ADKQE 758

>Kwal_26.7105
          Length = 740

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/721 (65%), Positives = 556/721 (77%), Gaps = 18/721 (2%)

Query: 49  KKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHE 108
           + ++   E +PL ++E+  MP++FT + FFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHE
Sbjct: 34  RIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHE 93

Query: 109 FYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAY 168
           FYHDVHPPLGKMLVGLSG++AGYNGSWDFPSGEEYPDYLDYVKMR+F ATFS+LC+P+AY
Sbjct: 94  FYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAY 153

Query: 169 ITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNP 228
            TAKAIGFS+P VWLFT LV+FENSYATLGRFILLDSML FFTVAS   F+ FH QR  P
Sbjct: 154 FTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKP 213

Query: 229 FSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWK 288
           FS KWW  L L G +LGC ISVKMVGLFIITLVGIYTV +LWTLL  +   K       K
Sbjct: 214 FSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSK-------K 266

Query: 289 VYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPR 348
            Y  HW+ARI+CLII+PFL+FL CF++HF LLSHSGTGDANMPSLFQA L GSDVG GPR
Sbjct: 267 AYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPR 326

Query: 349 DVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQ 408
           D+A+GSS VSIKNQALGG+LLHSHVQ +P+GSNQQQVT Y + D NN W FDRIR     
Sbjct: 327 DIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIR--PLT 384

Query: 409 PWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMD 468
           PWS E ET+IE+V+ G+ YRLVH +T KNLH   I AP++K++WEV+G+G   EVGD  D
Sbjct: 385 PWSEE-ETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTA-EVGDPKD 442

Query: 469 NWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKIS 528
           +W++EV+ Q G ED+S +HPLT++F IK+A LGCYL QT   LPEWGFRQSE+ C     
Sbjct: 443 HWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPF 502

Query: 529 KNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSL 588
           K DKRTWWNVE+H NEKLP   A F YPK NF K+F+ LN  MMATNNALVPD DK D+L
Sbjct: 503 KRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNL 562

Query: 589 ASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQL 648
           AS+AWQWPTLNVG+RLCGW DDTVKYFL+GSPASTW ST++V+  M  +V+L  RWQRQ 
Sbjct: 563 ASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGLVVLLLLRWQRQY 622

Query: 649 TNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEA- 707
            + ++    N FMMG FYPLL WGLH+MPFVIM+RVTYVHH                EA 
Sbjct: 623 QDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAG 682

Query: 708 ---IIRRPKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKI 764
              + +   G LA+ + Y+T   Y A+VI GF+YFSPISFG+ GPS NY +L+W   W I
Sbjct: 683 LKGLNKTKGGQLARTLIYVT---YGAIVIYGFYYFSPISFGLSGPSSNYAHLNWFKSWTI 739

Query: 765 S 765
           +
Sbjct: 740 T 740

>Scas_505.2
          Length = 752

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/765 (60%), Positives = 564/765 (73%), Gaps = 23/765 (3%)

Query: 6   AAVSGFEPK-KEASDLKVRQHNXXXXXXXXXXXXXXXXXXXENVKKQ---QPPSEESPLC 61
           ++ +GF+ + K+  ++K RQ                     E++KK+       E + L 
Sbjct: 2   SSATGFKAREKDTEEVKARQD-------INIDTHEEIIDEKEDLKKEIVSTEKKESNTLL 54

Query: 62  KVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 121
           +VE+ +MP+VFTGL+ F RMYKIG+N+HVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML
Sbjct: 55  RVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 114

Query: 122 VGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAV 181
           VGLSGYLAGYNGS+DF SG EYPDY+DYVKMR+F A FS++CVP+AY TAKAIGFSIP V
Sbjct: 115 VGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTV 174

Query: 182 WLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLG 241
           WLFT  VLFENSY TLG+FILLDSML FFTV S+M F++FH QR  PFS KWW  + L G
Sbjct: 175 WLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTG 234

Query: 242 FNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCL 301
            ++GCAISVKMVGLFIIT+VGIYT+ DLW  L         K  +WK Y  HW+ARI+CL
Sbjct: 235 LSMGCAISVKMVGLFIITVVGIYTIIDLWNFL-------GDKTMSWKAYIGHWLARIICL 287

Query: 302 IIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKN 361
           II+PFLVFL CF+IHF LL+HSGTGDANM SLFQA L GSDVG GPRDVA+GSS +SIKN
Sbjct: 288 IIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKN 347

Query: 362 QALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYV 421
           QALGGALLHSH   +P+GSNQQQVT Y+Y D NN WFFDR   P  +P+ +E ETDIEYV
Sbjct: 348 QALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDR---PRGEPFYHENETDIEYV 404

Query: 422 RVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDE 481
              ++YRLVH  T KNLH   + AP+S   WEV+G+G   E GD  DNW+IE+++Q GDE
Sbjct: 405 LGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDA-EQGDSRDNWLIEIVDQRGDE 463

Query: 482 DKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESH 541
           DK+ +HPLTT+F I +  + CYL+QT   LPEWGF+Q E+ C     + DKRTWWN+E++
Sbjct: 464 DKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETN 523

Query: 542 ENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVG 601
           EN+ LP   A F +PKTNFFKDF+ LN  MMATNNALVPD +K+D LAS+AWQWPTL  G
Sbjct: 524 ENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWG 583

Query: 602 LRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFM 661
           LR+C W +D VKYFLLG+PASTW S+++V+ LM++IVVL  RWQRQ ++  + K LNTFM
Sbjct: 584 LRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFM 643

Query: 662 MGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTLAKYIT 721
           MGAFYPLLAWGLH+ PFVIM+RVTYVHH                +A ++    T +  I 
Sbjct: 644 MGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQIL 703

Query: 722 YITLVL-YFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKIS 765
            I + L  +  VIG F+YFSPISFGM GP +NY YL+W S W I+
Sbjct: 704 RIVIYLAAYVTVIGCFWYFSPISFGMVGPMENYSYLNWFSTWNIA 748

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/722 (62%), Positives = 547/722 (75%), Gaps = 13/722 (1%)

Query: 46  ENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYL 105
           E++ KQ+    ESPL K+E+ +MPI+FTGL+FF RMYKIG N+HVVWDEAHFGKFGSYYL
Sbjct: 32  EDLSKQKH-VNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYL 90

Query: 106 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVP 165
           RHEFYHDVHPPLGKMLVG SGYLAGYNGSWDFPSGE+YP+Y+D+VKMRLF A FS+LCVP
Sbjct: 91  RHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVP 150

Query: 166 MAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQR 225
           +AY TAK+IGFS+P VWLFT LVLFENSY TLGRFILLDSML FFTV S   F+ FH  R
Sbjct: 151 VAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVR 210

Query: 226 KNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQ 285
             PF+ KWW  L   GF+LGC ISVKMVGL IIT+VGIYTV DLW +L   A  K  K  
Sbjct: 211 SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNML---ADTKMSK-- 265

Query: 286 AWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGK 345
             KVY  HW +R V LI++PF VFL CF+IHF LLSHSGTGDANMPSLFQA L GSDVG+
Sbjct: 266 --KVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGE 323

Query: 346 GPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIP 405
           GPRDVALGSS ++IKNQALGG LLHSH+QT+P+GS QQQVT Y + D NN+W FDR R  
Sbjct: 324 GPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRF- 382

Query: 406 GNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGD 465
            + P+ ++ ET+ E+V  G  YRLVH +T +NLH     APV  N WEV+G+G   +VGD
Sbjct: 383 -SAPY-DKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDA-KVGD 439

Query: 466 DMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSH 525
             D+WIIE+++Q G ED++ +HPLT++F +K+A +GCYL+QT   LP+WGFRQ+E+ C  
Sbjct: 440 PKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVK 499

Query: 526 KISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKY 585
              K DKRTWWN+E++ NEKLP    +F YPKT+F KDF+ LN  MMATNNALVP+++K 
Sbjct: 500 NPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKL 559

Query: 586 DSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQ 645
           D LAS+AWQWPTLNVG+RLCGW +  +KYFL+GSPASTWPST++V+  M+ + V   RWQ
Sbjct: 560 DKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQ 619

Query: 646 RQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXX 705
           RQ ++  N + +N F+MG  YPLLAWGLHF+PF+IM+RVTYVHH                
Sbjct: 620 RQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYLF 679

Query: 706 EAIIRR-PKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKI 764
           E  +++  K    K + Y     Y A+VI GF+YF+PISFGM GPS +Y YL+WLS W I
Sbjct: 680 EISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYEYLNWLSTWTI 739

Query: 765 SD 766
           SD
Sbjct: 740 SD 741

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/722 (62%), Positives = 538/722 (74%), Gaps = 14/722 (1%)

Query: 46  ENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYL 105
           +  K +     +SPL ++EA++MP+VFTGL+ F RMY+IG+N +VVWDEAHFGKFGSYYL
Sbjct: 34  DTSKLKDAKVSQSPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYL 93

Query: 106 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVP 165
           RHEFYHDVHPPLGKMLVGLSGYLAGYNGS+DF SG EYP+Y+D+VKMRLF A+FS++CVP
Sbjct: 94  RHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVP 153

Query: 166 MAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQR 225
           +AY TAKAIGFS+PAVWLFTC+VLFENSY+TLGRFILLDSML FFTVAS   F++FH QR
Sbjct: 154 LAYFTAKAIGFSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQR 213

Query: 226 KNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQ 285
             PFS KWW  L L G NLGC ISVKMVGLF+ITLVGIYTV DL  +L        +K  
Sbjct: 214 SRPFSRKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQML-------NEKKM 266

Query: 286 AWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGK 345
           +WK Y  HW+ARIV LI +P  VF+ CF++HF LL HSGTGDANMPSLFQA L GSDVG 
Sbjct: 267 SWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGG 326

Query: 346 GPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIP 405
           GPRDVA+GSS VSIKNQAL GALLHSHVQT+P+GSNQQQVT Y+Y D NN W F R+R  
Sbjct: 327 GPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVR-- 383

Query: 406 GNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGD 465
             +   +  ETDIEYV  G  YRLVH +T+KNLH   I APV K +WEV+G+G    +GD
Sbjct: 384 -EESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYG-NHTIGD 441

Query: 466 DMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSH 525
             D W++E+++Q G E+ + +HPLTT+F +++  L CYL QT   LPEWGFRQ E++C  
Sbjct: 442 AKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVK 501

Query: 526 KISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKY 585
              + DKRTWWNVESHENEKLP P+  F YP + F KDF+ LN  MMATNNALVP+SDK+
Sbjct: 502 DPFRRDKRTWWNVESHENEKLPTPE-EFKYPGSGFLKDFIHLNLAMMATNNALVPESDKF 560

Query: 586 DSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQ 645
           D LAS+AW+WPTL+VGLRLCGW D+  KYFLLG+P +TW S+V+VI  MI  VVL  RWQ
Sbjct: 561 DYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQ 620

Query: 646 RQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXX 705
           RQ  +F+N    N F+MG FYP+L WGLHF+PFVIM+RVTYVHH                
Sbjct: 621 RQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYII 680

Query: 706 EAIIRR-PKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKI 764
           +A  +R  K      +  +   +  A V+G F+YFSPISFGM GP+ NY YL W+  W I
Sbjct: 681 DATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLKWVKTWHI 740

Query: 765 SD 766
            D
Sbjct: 741 HD 742

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/711 (62%), Positives = 545/711 (76%), Gaps = 12/711 (1%)

Query: 57  ESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPP 116
           ES +  ++  VMPI+FT L  FTRMYKIG NNHVVWDEAHFGKFGSYYLRHEFYHDVHPP
Sbjct: 49  ESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPP 108

Query: 117 LGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGF 176
           LGKMLVGLSGYLAGYNGSWDFPSGE YPDY+DYVKMRLFQA FSSLCVP+AY T +AIGF
Sbjct: 109 LGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGF 168

Query: 177 SIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTT 236
           S  +VWLFT LV+FENSYATLG+FILLDSML FFTV+S+     FHT RK+PFS +WW  
Sbjct: 169 SRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLW 228

Query: 237 LALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIA 296
           L L G NLGCAISVKMVGLFII++VGIYT+++LW LL  ++        +WKVY  HW+A
Sbjct: 229 LCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSV-------SWKVYVNHWLA 281

Query: 297 RIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSF 356
           RI  LIIIP  VFL CF+IHF LLS+SG GD+ MPSLFQA+L+G+ VGKGPRDVALGSS 
Sbjct: 282 RIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSI 341

Query: 357 VSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETET 416
           +SIKNQALGGALLHSHVQ FP+GS QQQVT Y Y+D NN WFF RIR  G +PW++    
Sbjct: 342 ISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIR--GVEPWTDAENK 399

Query: 417 DIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIE 476
            IE+V+ G  YRL+HR T KNLH  ++ AP+SK+++EV+ +G   ++GD  DNWIIE++E
Sbjct: 400 TIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYG-DVDLGDYKDNWIIEIVE 458

Query: 477 QAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWW 536
           Q G+ED +++HPL+T+F IK+++LGCYL Q+ K LPEWGFRQ E+ C    SK DKRTWW
Sbjct: 459 QVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWW 518

Query: 537 NVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWP 596
           N+E+HENE+LP  +  F YPKT+FF++F+ LN  MMATNNALVP+ +K+D +AS+AWQWP
Sbjct: 519 NIETHENERLPQGE-DFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQWP 577

Query: 597 TLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKA 656
           TLNVG+RLC W++ ++KYFLLGSPAS WPS+++V  L+I ++ L  +WQRQ    ++   
Sbjct: 578 TLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDPVE 637

Query: 657 LNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRR-PKGT 715
            + F+M AFYPLLAW LH+MPFV+M+RV Y HH                + I +R     
Sbjct: 638 RDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWATRN 697

Query: 716 LAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKISD 766
             K++     ++Y ++VI GFFYFSP SFGMDGP  +Y YL WL  W+I +
Sbjct: 698 TGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDYAYLAWLPTWQIVE 748

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/725 (60%), Positives = 530/725 (73%), Gaps = 17/725 (2%)

Query: 46  ENVKK-QQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYY 104
           E+V K ++   E +PL K+EA+VMP++FT L+ +TRM+KIG NN VVWDEAHFGKFGSYY
Sbjct: 43  EDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNRVVWDEAHFGKFGSYY 102

Query: 105 LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCV 164
           LRHEFYHDVHPPLGKMLVGLSGY+AGYNGSWDFPSGEEYP+Y+DYVKMR+F A FS++C 
Sbjct: 103 LRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDYVKMRMFNAVFSAMCA 162

Query: 165 PMAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQ 224
           P+AY T KAIGFS+P VWLF+ LV+FENSYATLGRFILLDSML FFTV SF  F+LFH +
Sbjct: 163 PVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLFFTVCSFYTFVLFHNE 222

Query: 225 RKNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKL 284
           R  PF  KWW  L  LG +LGC ISVKMVGLFII++VGIYTV DLW  L +     ++  
Sbjct: 223 RHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDLWNKLSEPNMSVSR-- 280

Query: 285 QAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVG 344
                +  H+ AR +CLI++PF+VFL CF++HF  LS SGTGDA MPSLFQA L GS VG
Sbjct: 281 -----FAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQAGLSGSSVG 335

Query: 345 KGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRI 404
            GPRD+A+GSS VSIKNQALGG LLHSHVQT+P GS+QQQVT Y +ND NN W FDRIR 
Sbjct: 336 IGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNNWVFDRIR- 394

Query: 405 PGNQPWS-NETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEV 463
            G   WS NETE   E+V+ G  YRLVH +T +NLH   I APVSK  WEV+G+G   +V
Sbjct: 395 -GLPAWSINETEH--EFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGDA-QV 450

Query: 464 GDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTC 523
           GD  DNWIIE + Q  DEDKS++H ++T+F IK+  +GCYL QT   LPEWGFRQ E+ C
Sbjct: 451 GDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGEVAC 510

Query: 524 SHKISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSD 583
                K DKRTWWN+E++ NE+LP     F YPKT+FFKDF+ LN  MMATNNALVPD D
Sbjct: 511 ISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVPDPD 570

Query: 584 KYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFR 643
           K D LAS+AWQWPTLNVG+RLC W DD  KYFL+GSPASTWPST +V V  +  V    +
Sbjct: 571 KLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYYLLK 630

Query: 644 WQRQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXX 703
           WQRQL  F      N F+MG  YPLL WGLH++PF +M RVTYVHH              
Sbjct: 631 WQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLILAY 690

Query: 704 XXEAIIRRPKGTLAKY---ITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLS 760
             EA +R  + +   Y   + Y+   +Y+  +I GF+YF PI+ GM+GPS NY++L+WL 
Sbjct: 691 VFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPSSNYKHLNWLK 750

Query: 761 GWKIS 765
            W I+
Sbjct: 751 TWSIA 755

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/719 (51%), Positives = 488/719 (67%), Gaps = 14/719 (1%)

Query: 47  NVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLR 106
           N  K+Q  S +    ++E   MPIVFT L+   R+Y++ V   V WDEAHFGKFGSYYLR
Sbjct: 28  NDNKEQKASNKQFWLRLERVAMPIVFTLLALLVRLYRLDVVKKVTWDEAHFGKFGSYYLR 87

Query: 107 HEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPM 166
           H FYHDVHPPLGKMLVG SGYLAGYNGSWDFPSG+ YPDY+ +VKMR+FQ   S+LCVPM
Sbjct: 88  HTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVPM 147

Query: 167 AYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRK 226
            Y  AKAIGFS+P VWL T LVL ENSY TLG+ ILLDS+L FFTVA+FM F  FH+  +
Sbjct: 148 TYFAAKAIGFSLPTVWLTTILVLCENSYTTLGKLILLDSLLLFFTVATFMCFQKFHSYHR 207

Query: 227 NPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQA 286
            PFS +W   L L G ++GCAISVKMVGLF+ITLVGI+T+ +LWTLL  +          
Sbjct: 208 KPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNI-------T 260

Query: 287 WKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKG 346
           WK Y  HWIARI+CLI+ PFL+F  CF+IHFALL  SG GD  MP  FQA L+G+++G+G
Sbjct: 261 WKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQG 320

Query: 347 PRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPG 406
           PRDV++GS+ ++++N    GA LHSH QT+P+GS Q+QVT Y Y D NN W   R   P 
Sbjct: 321 PRDVSIGST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYR---PH 376

Query: 407 NQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDD 466
            +P  +  +T+ E +R G+  RLVH+ T  NLH+ ++ AP++K D+EV+G+G    +GD 
Sbjct: 377 GKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYG-NLTIGDL 435

Query: 467 MDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHK 526
            D+W++E+I+  G+EDK++IHP+TT    +HAVL CYL Q+ + LPEWGF Q+E+ C  +
Sbjct: 436 KDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIRE 495

Query: 527 ISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYD 586
             KND +T W V++H +  L  P+ +F YP+ +F+ DF  LN+ MMATNNAL    DK+D
Sbjct: 496 PEKNDIKTMWIVDTHTHPNLEAPE-NFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHD 554

Query: 587 SLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQR 646
            L S +W+WPTL   LR+  WN++  +Y LLGSPASTWPSTV+V+ L+  ++    +W R
Sbjct: 555 YLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTVAVLFLVFALLYKVLKWNR 614

Query: 647 QLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXE 706
           Q+  F N+     F+ G  YPLL W LHF PFVIM RV YVHH                +
Sbjct: 615 QMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFD 674

Query: 707 AIIR-RPKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKI 764
           A +R   K    + I +     Y +VVIGGF  F+P S+GM G  +NY++L+W+  W +
Sbjct: 675 AGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLNWMKNWDV 733

>Kwal_33.15471
          Length = 755

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/769 (45%), Positives = 470/769 (61%), Gaps = 30/769 (3%)

Query: 9   SGFEPKKEASDLKVRQHNXXXXXXXXXXXXXXXXXXXENVKKQQPPSEESPLCK--VEAW 66
           SGF PK    +L+ RQ N                   E   K +     S + +  +   
Sbjct: 4   SGFLPKSSELNLRERQKNFTENELSIPPNESLDSDVDEKNSKNKTKFASSSISRNVLLQV 63

Query: 67  VMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 126
              I+ T LSF+ R  KI  N+ VVWDEAHFGKFGSYY+++EFYHDVHPPLGKML+ LS 
Sbjct: 64  TGVILLTILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPLGKMLIALSQ 123

Query: 127 YLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTC 186
           YLAG+NG + F SG  YP  ++Y  MR F ATF +LC P+  +TAK +GFS    +    
Sbjct: 124 YLAGFNGDFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFSNLGSYFLGM 183

Query: 187 LVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGC 246
           +V  E S+  L +FILLDSML FFT  +F      H  R  PF+ +W   + LLG ++GC
Sbjct: 184 MVALELSFVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWMLLLGLSVGC 243

Query: 247 AISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPF 306
             SVK VGLFI  + GIYTV DL++        +  +L  +K    HW+ RI+ LI+IPF
Sbjct: 244 VCSVKWVGLFITVIAGIYTVVDLFSY---HYDKELSRLSYYK----HWLVRIIDLIVIPF 296

Query: 307 LVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGG 366
           LV+L CF+IHFA+L  SGTGDA   +LFQ  LDG+ +  GPR+VA GS  V+I++  L  
Sbjct: 297 LVYLFCFKIHFAILHKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFGSE-VTIRSHGLSP 355

Query: 367 ALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSN---ETETDIEYVRV 423
            LLHSHVQ +P GS Q QVTGY ++DDNN W     R  G +   N   + ++D+  +  
Sbjct: 356 NLLHSHVQLYPFGSGQHQVTGYGHSDDNNNWVIKYPREGGLKAAENGLQDVQSDL--LTE 413

Query: 424 GNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGD--- 480
           G+E RLVH++T  NLH+ +I A VSK  +EV+G+G   E+GD  D+W++E+++Q      
Sbjct: 414 GSEIRLVHKNTGANLHSHEIPAHVSKGSFEVSGYG-DEEIGDIKDDWVVEIVQQLDSDNS 472

Query: 481 ----EDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWW 536
               ED S++HP++T+F ++H  LGCYL  T    P WGF+Q+E+ C H   K DK TWW
Sbjct: 473 SFPKEDPSLLHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWW 532

Query: 537 NVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWP 596
           N+E H N  L   +  +  PK+ F+ DF+ +N  M ++NNALVPD DKYDSLAS AWQWP
Sbjct: 533 NIEDHWNPNLEKSEG-YVPPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWP 591

Query: 597 TLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKA 656
           TL+VGLR+C W++DTVKYFLLGSP  TW ST+S+ + ++ ++ LAF+WQRQ  N   ++ 
Sbjct: 592 TLHVGLRMCSWSNDTVKYFLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLTGNEL 651

Query: 657 LNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTL 716
               M G   P LAW LH++PFV+M RVTYVHH                E  +  PK   
Sbjct: 652 SEISMQGVL-PFLAWLLHYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCL--PKRYF 708

Query: 717 AKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKIS 765
             YI Y  L   +A  I  +  FSPI+ G+DGP+ N++YL WL+ WKIS
Sbjct: 709 LNYIVYTAL---YAGCIYIYVLFSPIAQGIDGPAHNFKYLQWLNTWKIS 754

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/706 (45%), Positives = 437/706 (61%), Gaps = 27/706 (3%)

Query: 70  IVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 129
           ++ T +SF  R YKI  +N VVWDEAHFGKFGSYYL+HEFYHDVHPPLGKML+GL  YLA
Sbjct: 66  LLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEYLA 125

Query: 130 GYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVL 189
           G++G++DF S   YPD +++  MR F A FSSLC P+A+  A+ + FS+P V+L   +V 
Sbjct: 126 GFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVALMVC 185

Query: 190 FENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAIS 249
           FE+SY  LG+F+LLDSML FFTV +F      +  R+   ++KW   +   GF++GC  S
Sbjct: 186 FEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIGCVCS 245

Query: 250 VKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVF 309
           VK VGL I  LVGIYTV++L+ L   ++  KTK L        HWI RI  LI+ P +++
Sbjct: 246 VKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLG-------HWIVRISALIVFPLILY 298

Query: 310 LTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALL 369
           +  F+IHF LL  +GTGD++  SLFQA L+G+ +   PRD+A GS  +S+++  L   LL
Sbjct: 299 MVFFKIHFTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSC-ISLRSHGLSPGLL 357

Query: 370 HSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETD-IEYVRVGNEYR 428
           HSH QT+P GSNQ+QVTGY+Y D NN W     R  G         +D I +++ G+  R
Sbjct: 358 HSHPQTYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLR 417

Query: 429 LVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQ--AGD---EDK 483
           LVH  T+ NLH  +I + VSK  +EV+G+G    VGD  D+WIIEV+EQ   G+   E+K
Sbjct: 418 LVHEKTKNNLHTHQIPSHVSKGHYEVSGYGND-AVGDLKDDWIIEVVEQLPTGNNTMENK 476

Query: 484 SMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHEN 543
           ++IHPLTT+F +++  LGCYL  T    P WG+ Q+E+ C +  ++ DK TWWNVE H N
Sbjct: 477 ALIHPLTTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYPWNQRDKSTWWNVEDHIN 536

Query: 544 EKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLR 603
             L   D +F  P T F+ DF+ +N  M A+NNAL+PD DKYD +AS  W+WP L  GLR
Sbjct: 537 SNL-HIDQTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLR 595

Query: 604 LCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMG 663
           +C WND TVKY+LLGSP +TW ST ++ +L+I + +  FR+QRQ       KA N F   
Sbjct: 596 MCNWNDKTVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACA 655

Query: 664 AFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTLAKYITYI 723
                + W LH+ PF IM RVTY+HH                +         LA    Y+
Sbjct: 656 GL-SFIGWLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDF-------ALANSNRYL 707

Query: 724 TLVLYFAVVIGGFF---YFSPISFGMDGPSKNYRYLDWLSGWKISD 766
            +V Y ++  G  F   YF+P   GM  P+  Y  L+ L  W +++
Sbjct: 708 KVVAYSSLYAGCTFTYWYFAPFCQGMPEPNLTYVNLELLPSWDVTN 753

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/762 (41%), Positives = 459/762 (60%), Gaps = 37/762 (4%)

Query: 12  EPKKEASDLKVRQHNXXXXXXXXXXXXXXXXXXXENVKKQQPPSEESPLCKVEAWVMPIV 71
           +PK  ASD++  Q +                   E   + +   E + L  +   + P++
Sbjct: 26  QPKANASDIQDEQLDCFEQL--------------EEKHRTKKNEEYTALKILRDVIGPLL 71

Query: 72  FTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY 131
            T  SF+ R   I  NN+VVWDEAHFGKFGSYY++HE+YHDVHPPLGKML+ LS ++AG+
Sbjct: 72  LTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIALSEWMAGF 131

Query: 132 NGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLFE 191
           +G +DF S   YP+ +++  MR F ATF +LC P+A+ TAK +GF+   V+L   +V  E
Sbjct: 132 DGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIATMVTLE 191

Query: 192 NSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAISVK 251
           +SY  L +FILLDSML FF++ +F   I  +T RK   + KW   + L G ++GC  SVK
Sbjct: 192 HSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIGCVCSVK 251

Query: 252 MVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLT 311
            VGLFI  +VG+YT  +L+ L   +   + K       Y  HW+ RI+ LI+IPFL++L 
Sbjct: 252 WVGLFITVVVGLYTCIELFLLYCDKELPRIK-------YYKHWLIRIINLIVIPFLIYLY 304

Query: 312 CFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALLHS 371
           CF+IHF LL  SGTGD+   +LFQ  L+G+ +  GPRDVA GS  ++I++  L   LLHS
Sbjct: 305 CFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSE-LTIRSHGLSPNLLHS 363

Query: 372 HVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNET-ETDIEYVRVGNEYRLV 430
           H+Q +P+GS Q+Q+TGY + D NN+W F+  R  G +   N T    I  +  G E RL 
Sbjct: 364 HIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPITDGVEVRLS 423

Query: 431 HRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQA-------GDEDK 483
           H++T  NLH+  + + VS+ ++EV+G+G    VGD+ D+WI+E+++Q         +E+ 
Sbjct: 424 HKNTGSNLHSHDVPSHVSRGNYEVSGYG-SQSVGDEKDDWIVEIVKQMDSPNPVYSNENS 482

Query: 484 SMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHEN 543
           +++HP++T F ++H VLGCYL  T    P WGF+Q+E+ C    S+ DK TWWNVE H N
Sbjct: 483 TILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWN 542

Query: 544 EKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLR 603
             L   +  +  PK+NF+ DF+  N  M ++NNALVPD DKYDSL+S AW+WPTL+ GLR
Sbjct: 543 HNLETAE-DYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGLR 601

Query: 604 LCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMG 663
           +C W     +Y+L+GSP +TW STVS+I+    I+ + +RW+RQ    ++D+     + G
Sbjct: 602 MCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQIWQITIQG 661

Query: 664 AFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTLAKYITYI 723
            F P ++W  H++PF +M RVTYVHH                +  + R    + KY  Y+
Sbjct: 662 IF-PFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTLTRVHW-MVKYPIYL 719

Query: 724 TLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKIS 765
           +L   F   I  +  F+PI  GM G    Y  L WLS W I+
Sbjct: 720 SL---FGGCIYIYNLFAPICQGMHGDKAEYLPLQWLSTWDIA 758

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/706 (45%), Positives = 435/706 (61%), Gaps = 31/706 (4%)

Query: 72  FTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGY 131
           FT LSF  R   I  NN VVWDEAHFGKFGSYY+RHEFYHDVHPPLGKML+ LS +LAG+
Sbjct: 43  FTVLSFVLRFQGIDKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGF 102

Query: 132 NGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLFE 191
           +G +DF SG +YPD +++  MR F ATF +LC P+ + TAK +  S P V+L T +V  E
Sbjct: 103 DGEFDFESGHQYPDGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLE 162

Query: 192 NSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAISVK 251
           +S+  L +FILLDSML FFT  +F   +     R    + +W   L L G ++GC  SVK
Sbjct: 163 HSFIALSKFILLDSMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVK 222

Query: 252 MVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLT 311
            VGLFI  +VG++T+ DL             K ++ K+Y  HWI RI+ LIIIPFLV+L 
Sbjct: 223 WVGLFITLVVGLFTIIDL-------LEHYWNKKESRKIYYKHWILRIINLIIIPFLVYLF 275

Query: 312 CFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALLHS 371
           CF+IHF LL  SGTGDA+  SLFQ  L+G+ +   PR V  GS  V+I++  L   LLHS
Sbjct: 276 CFKIHFLLLYKSGTGDASTNSLFQVNLEGTQIQNSPRTVMYGSE-VTIRSHGLSPNLLHS 334

Query: 372 HVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEY--VRVGNEYRL 429
           HVQ +P GS Q+QVTGY ++D NN W     R  G     +    + E   VR G+  RL
Sbjct: 335 HVQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDTIRL 394

Query: 430 VHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQA-------GDED 482
            H     NLH+  I + VSK ++EV+G+G   EVGD+ D+WIIE++EQ        G ED
Sbjct: 395 FHVRMGCNLHSHTISSHVSKGNYEVSGYG-SEEVGDEKDDWIIEIMEQLDSANTNFGKED 453

Query: 483 KSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHE 542
             ++HP++T F ++H  LGCYL  T    P WGF Q+E+ C +   K DK TWWNVE H 
Sbjct: 454 NEVLHPISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWNVEDHW 513

Query: 543 NEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGL 602
           N++L   D  +  PK+ F+ DF+ +N  M ++NNALVPD DKYD LAS AW+WP L+ GL
Sbjct: 514 NDQLV-VDEEYVPPKSKFWTDFILINFAMASSNNALVPDEDKYDYLASKAWEWPILHKGL 572

Query: 603 RLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMM 662
           RLCGW+   V+Y+LLGSP +TW S+++++V ++  +V+A +W+RQ +   N+++      
Sbjct: 573 RLCGWSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWRRQ-SIVINEESCWKLFT 631

Query: 663 GAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTLAKYITY 722
              +P LAW  +FMP+V+M RVTYVHH                E +       LA Y T 
Sbjct: 632 LLLFPFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITEYL-------LADYCT- 683

Query: 723 ITLVLYFAVVIGG---FFYFSPISFGMDGPSKNYRYLDWLSGWKIS 765
           +   L F  ++G    ++YF+PI  G+ G   +Y YL WL GW I+
Sbjct: 684 VKAFLAFLSMVGCTYIYWYFAPICQGLHGIGSHYFYLQWLPGWDIA 729

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  347 bits (889), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 233/707 (32%), Positives = 353/707 (49%), Gaps = 42/707 (5%)

Query: 67  VMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 126
           +M  +   ++ F R+YK+   + VV+DE HFG F S Y++ +F+ DVHPPL KML    G
Sbjct: 62  LMVAILLIITAFVRLYKLSWPSSVVFDEVHFGGFASKYIKGDFFMDVHPPLAKMLFAGVG 121

Query: 127 YLAGYNGSWDF-PSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFT 185
            LAGY G + F P GEEYPD + +  MRLF A+     V M Y+T +A G  +   +LF 
Sbjct: 122 ALAGYTGDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTVLMLYLTLRASGVRLGVAYLFA 181

Query: 186 CLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLG 245
            +  FENS+ T+ R+ILLD+ L  F  A+   +        N F  +   +L   G  LG
Sbjct: 182 LVFAFENSFVTISRYILLDAPLICFIAAAVYSYKKSELYPTNSF--RALKSLLATGIALG 239

Query: 246 CAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIP 305
            A S K VGLF +  VG+  V  LW ++          ++A        I ++V L+ +P
Sbjct: 240 LASSSKWVGLFTVAWVGLLCVWKLWFMIGDLNKSPCTIVKA-------AIGKLVLLLGVP 292

Query: 306 FLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALG---SSFVSIKNQ 362
            L+++  F +HF  L H G+G +  PS F+ATL+G+ +   P DV       S V++K+ 
Sbjct: 293 ILLYVAFFYVHFQALIHDGSGSSFFPSEFRATLEGNQI---PSDVVYDVGVGSIVTLKHL 349

Query: 363 ALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
           +  G  LHSH   +P GS QQQ+T Y + DDNN W  +R  +PG       +  D   ++
Sbjct: 350 STEGGYLHSHSHAYPTGSEQQQITLYPFLDDNNKWVIERSHLPG------ASLKDFIGLK 403

Query: 423 VGNEYRLVHRSTRKNLHADKIVAPVSKN-DW--EVAGFGYGFEVGDDMDNWIIEVIEQAG 479
            G    L+H +T   LH+     PVS++ DW  EV+G+GY    GD  D+W IE+ + + 
Sbjct: 404 NGESISLLHLATGVRLHSHDHKPPVSESADWQKEVSGYGYLGFTGDINDHWTIEIDQSSS 463

Query: 480 DED--KSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWN 537
                +  +  + T F ++HA  GCYL     +LP+WGF Q E+TC+ +     +   W 
Sbjct: 464 KPGIAQHEVRAIDTKFKLRHAT-GCYLFSHEVKLPKWGFDQQEVTCATQ--GKPELLLWY 520

Query: 538 VESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPT 597
           +E  EN +LP+      Y   NF + F+  ++ M   N  L   +  Y+SL   A++WP 
Sbjct: 521 IEGSENPQLPENTPRISYKPMNFIEKFIENHKKMWKINKGLT-GTHYYESL---AYEWPL 576

Query: 598 LNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTN--FANDK 655
           +  G+    W +   K +LLG+  + W   VS  +L ++  +LAF     L       DK
Sbjct: 577 MRRGIGY--WGEHHRKIYLLGNAVTWW--AVSAFIL-VYAAILAFEAGSFLVGKPILQDK 631

Query: 656 ALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGT 715
            +  F +   + LL + +H++PF +M R  ++HH                + II      
Sbjct: 632 NVINFHVQVLHYLLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILALAHAFDIIITFVCKN 691

Query: 716 LAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGW 762
             K   Y  L+L+ A  I  F   SPI++G D      R   W+S W
Sbjct: 692 -RKQAAYALLILFTAASIYFFHAHSPIAYGTDWTKDVCRNSRWVSTW 737

>Scas_408.1*
          Length = 391

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 227/333 (68%), Gaps = 8/333 (2%)

Query: 63  VEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 122
           + +++ P++ T LSF  R + IG NNHVVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+
Sbjct: 61  MRSYIGPLLLTILSFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLI 120

Query: 123 GLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVW 182
            LS YLAG++G ++F S E YP+ ++Y+ MR F A F +LCVP+   T +++GF+    +
Sbjct: 121 ALSEYLAGFDGHFNFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSY 180

Query: 183 LFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGF 242
           L T +V  E+SY  L +FILLDS+L FFT+ +F   +  +T +K   + +W   + L G 
Sbjct: 181 LVTLMVTLEHSYIVLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGL 240

Query: 243 NLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLI 302
           ++GC  SVK VGLFI  +VG++T+ +L+T    +   + K       Y  HW+ RI+ LI
Sbjct: 241 SVGCVCSVKWVGLFITIIVGLFTIMELFTHHYDKTLPRVK-------YYKHWMIRIIDLI 293

Query: 303 IIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQ 362
           IIPFL+++ CF+IHF LL  SGTGD+   +LFQ  L+G+ +  GPRDV  GS  V+I++ 
Sbjct: 294 IIPFLIYMFCFKIHFTLLYKSGTGDSATNTLFQVNLEGTTIENGPRDVMYGSE-VTIRSH 352

Query: 363 ALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNN 395
            L   LLHSHVQ +P GS Q+Q+TGY ++D ++
Sbjct: 353 GLSPNLLHSHVQLYPDGSRQRQITGYGHSDSSS 385

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  310 bits (795), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 222/723 (30%), Positives = 348/723 (48%), Gaps = 42/723 (5%)

Query: 53  PPSEESPLCKVEAWVMPIVFTGLSFFT---RMYKIGVNNHVVWDEAHFGKFGSYYLRHEF 109
           P +E + L  +      ++   L+ FT   R++ +   + VV+DE HFG F S Y+R  +
Sbjct: 34  PSAELASLRTMVTLKEKLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTY 93

Query: 110 YHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEEYPDYLDYVKMRLFQATFSSLCVPMAY 168
           + DVHPPL KML      L G+ G +DF + G+ +P    YV MR F A+  +L V + Y
Sbjct: 94  FMDVHPPLAKMLYAGVASLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVILMY 153

Query: 169 ITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNP 228
           +T +  G  +    +       ENSY T+ R+ILLD+ L FF  A+   F  +     N 
Sbjct: 154 MTLRYSGVRMWVALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYPAN- 212

Query: 229 FSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWK 288
            S+  + +L   G  LG A S K VGLF +T VG+  +  LW ++     L       +K
Sbjct: 213 -SLNAYKSLLATGIALGMASSSKWVGLFTVTWVGLLCIWRLWFMI---GDLTKSSKSIFK 268

Query: 289 VYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKG-P 347
           V      A++  L+ +PF ++L  F IHF  L+  G G +     F++TL  + + +   
Sbjct: 269 VA----FAKLAFLLGVPFALYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVV 324

Query: 348 RDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGN 407
            DV +G S +S+++ +  G  LHSH   +P GS QQQ T Y + D NN W  +    PG 
Sbjct: 325 ADVGIG-SIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAPG- 382

Query: 408 QPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSK-NDW--EVAGFGYGFEVG 464
                E+ T  + +  G + RL H  TR  LH+     PVS+ +DW  EV+ +GY    G
Sbjct: 383 -----ESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDG 437

Query: 465 DDMDNWIIEVIEQ--AGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMT 522
           D  D+W++E+ ++  A    +  +  L T F ++HA+ GCYL     +LP WGF Q E+T
Sbjct: 438 DANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVT 497

Query: 523 CSHKISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDS 582
           C+   S     T W VE++ N  LP+      Y   +F   F+  ++ M   N  LV + 
Sbjct: 498 CAS--SGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLV-EP 554

Query: 583 DKYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAF 642
             Y+S  ++   WP L  G+   G N+  V  +LLG+    W  T  + +  + ++   F
Sbjct: 555 HVYESQPTS---WPFLLRGISYWGENNRNV--YLLGNAIVWWAVTAFIGIFGLIVITELF 609

Query: 643 RWQRQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXX 702
            WQ       + K +N F +   + LL + +H+ P  +M R  ++HH             
Sbjct: 610 SWQLGKPILKDSKVVN-FHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAYYFGILALG 668

Query: 703 XXXEAIIR---RPKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWL 759
              + I+    R K    + + Y  ++ + A  +  F  FSPI +G     +  +   WL
Sbjct: 669 HALDIIVSYVFRSK----RQMGYAVVITFLAASVYFFKSFSPIIYGTPWTQELCQKSQWL 724

Query: 760 SGW 762
           SGW
Sbjct: 725 SGW 727

>Kwal_23.3623
          Length = 876

 Score =  306 bits (784), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 222/734 (30%), Positives = 355/734 (48%), Gaps = 59/734 (8%)

Query: 46  ENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYL 105
           + +K+ + P+       + A     V TG+    R+Y +   N VV+DE HFG F + Y+
Sbjct: 81  QTLKESRTPTSVKEKVTIAALA---VITGV---IRLYGLSNPNSVVFDEVHFGGFAAKYI 134

Query: 106 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEEYPDYLDYVKMRLFQATFSSLCV 164
           +  F+ DVHPPL KML    G +AG+ G +DF   G+ +P+   Y  MRLF A   +L V
Sbjct: 135 KGIFFMDVHPPLAKMLFAAIGSIAGFTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTV 194

Query: 165 PMAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQ 224
            + Y+T +  G  IP  ++ +     ENS+ T+ R+ILLD+ L FF  ++   F  +   
Sbjct: 195 LLMYLTLRCSGVRIPIAFIASLCFAIENSFVTISRYILLDAPLLFFIASAVYSFKKYEIY 254

Query: 225 RKNPFSIKWWTTLALL--GFNLGCAISVKMVGLFIITLVGIYTVADLWTLL-----PKQA 277
            +      W +  ALL  G  LG A+S K VGLF I  VG+  +  LW ++     P  +
Sbjct: 255 PQG----SWGSLKALLSGGLALGMALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSS 310

Query: 278 TLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQAT 337
           TLK                +++  + +P  ++   F +HF  L+ +  G     S F+ T
Sbjct: 311 TLKEAS------------RKLMFFLALPLALYAVFFYVHFETLTINSDGAGFFSSAFRTT 358

Query: 338 LDGSDVGKGP-RDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNI 396
           L G+ + K    DV +GS+ +S+++ A  G  LHSH   + +GS QQQVT Y + D NN 
Sbjct: 359 LHGNTIPKDILADVGIGST-ISMRHVATMGGYLHSHNHMYEKGSQQQQVTLYPHLDGNND 417

Query: 397 WFFDRIRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKN-DWEVA 455
           W    I +P +QP  N+  T  E ++ G   RL H  T++ LH+    APVS++ DW+  
Sbjct: 418 WV---IELP-DQP--NKAVTSFEGLKDGTVIRLKHAITQRRLHSHDHKAPVSESADWQKE 471

Query: 456 GFGYGFE--VGDDMDNWIIEVIEQAGD--EDKSMIHPLTTTFHIKHAVLGCYLTQTLKQL 511
              YGFE   GD  D+W IE+ + A +  E +  +  L T F +KH ++ C+L     +L
Sbjct: 472 VSCYGFEDFEGDGNDDWTIEIDQDASEPGEAQKRVKALDTKFRLKHNIMNCHLFSHEVKL 531

Query: 512 PEWGFRQSEMTCSHKISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIM 571
           P+WGF Q E+TC+ +       T W +E + +  L        Y K NFF+  +  ++ M
Sbjct: 532 PKWGFEQQEVTCASQ--GKPYLTLWYIEGNSHPLLTGDQERVSYKKPNFFEKLIESHQRM 589

Query: 572 MATNNALVPDSDKYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVI 631
              N  LV +   Y+S   +   WP L  G+    W ++  + +LLG+    W  T  + 
Sbjct: 590 WHINKNLV-EPHIYESKPHS---WPFLLRGINY--WGENHKQVYLLGNAIVWWSVTAFIA 643

Query: 632 VLMIFIVVLAFRWQRQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXX 691
           +    +V   F WQ       + K +N F +   + LL +GLH++P  +M R  ++HH  
Sbjct: 644 LFATIVVFELFAWQLGKPILQDSKVVN-FHVQVIHYLLGYGLHYIPSFLMGRQLFLHHYL 702

Query: 692 XXXXXXXXXXXXXXEAIIR---RPKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDG 748
                         +  +    R +    + I Y  + ++F+ V+  F  +  + +G   
Sbjct: 703 PAYYFGILAFAHALDITVTYVFRKR----EVIGYAVIGVFFSAVVYFFVSYRALIYGTAW 758

Query: 749 PSKNYRYLDWLSGW 762
            +   +   WLSGW
Sbjct: 759 TTDLCQKSQWLSGW 772

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  299 bits (766), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 212/708 (29%), Positives = 334/708 (47%), Gaps = 58/708 (8%)

Query: 74  GLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNG 133
           G++   R+Y +   + VV+DE HFG + S Y++  F+ DVHPPL KML+  +G LAGY G
Sbjct: 57  GVAAAVRLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGG 116

Query: 134 SWDFPS-GEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLFEN 192
            + F   G +YP  + Y  MR   A    L V + ++T +A G      +  + +   EN
Sbjct: 117 EFGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVEN 176

Query: 193 SYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAISVKM 252
           S+ T+ R+ILLDS L FF  A+   F      +    S++++  LA  G  LG A+S K 
Sbjct: 177 SFVTISRYILLDSPLLFFIAAAVYSFKRLELHQTG--SLQYYKCLAATGMALGLAMSSKW 234

Query: 253 VGLFIITLVGIYTVADLWTLL-----PKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFL 307
           VG F    VG+ +V  LW  +     P  + LK   ++          A I+C  ++P  
Sbjct: 235 VGFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIK----------ASILC--VLPMC 282

Query: 308 VFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALG---SSFVSIKNQAL 364
           +++  FRIHF  L +      N  S F+ TL G  +   P ++  G    S V+I++   
Sbjct: 283 LYVLFFRIHFQSLPNVTDAAGNFSSAFRTTLHGHTI---PANIYAGVGIGSTVTIRHIGT 339

Query: 365 GGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVG 424
            G  LHSH   +  GS QQQVT Y + D NN W+ +          SN   T  E +  G
Sbjct: 340 MGGYLHSHNHMYQGGSEQQQVTLYPHLDQNNHWYIEHYNA------SNTVPTTFEGLEHG 393

Query: 425 NEYRLVHRSTRKNLHADKIVAPVS-KNDW--EVAGFGYGFEVGDDMDNWIIEVIEQAG-- 479
            + RL H  T   LH+     PVS  +DW  EV+G+G+    GD  D+WI+E+ ++    
Sbjct: 394 TKIRLKHVLTGHRLHSHDHKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTP 453

Query: 480 DEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVE 539
            E +  +  + T F ++HA+ GC L     +LP+WGF Q E+TC+ +       T W +E
Sbjct: 454 GEARERVRAIETKFRLRHAMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTLWYIE 511

Query: 540 SHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLN 599
            + N  L +      Y   NF++  + ++R M   N +L  D+  Y    S   QWP L 
Sbjct: 512 ENTNPLLSEDSEKISYKTPNFWEKLVEIHRKMWHINKSLT-DAHMYQ---SDPIQWPFLL 567

Query: 600 VGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNT 659
            G+    W+ D+ + +LLG+    +  T+ V++  +  V   F WQ      ++ K LN 
Sbjct: 568 RGISY--WSKDSRQVYLLGNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTKILN- 624

Query: 660 FMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAII-----RRPKG 714
           F +   + LL + +H++P  +M R  ++HH                + ++     +RP  
Sbjct: 625 FHIQTIHYLLGYFIHYLPSFLMGRQMFLHHYLPAYYFGILALAHGLDGLVTFLNRKRP-- 682

Query: 715 TLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGW 762
                I Y  + ++    I  F  +SP+ +G+            LS W
Sbjct: 683 -----IAYGLVAMFVLGSIAFFVTYSPLVYGLQWTRSQCAKTRLLSNW 725

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  298 bits (763), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 217/689 (31%), Positives = 326/689 (47%), Gaps = 43/689 (6%)

Query: 70  IVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 129
           I    ++   R++ +   N VV+DE HFGKF + Y++  F+ DVHPPL KML    G LA
Sbjct: 58  IALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIGSLA 117

Query: 130 GYNGSWDFPS-GEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLV 188
           G+ G ++F   G  +P    Y  MR F A      V + Y T +A G  I   ++ + + 
Sbjct: 118 GFTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVASLMF 177

Query: 189 LFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAI 248
             ENS+ T+ R+ILLD+ L FF  A+   +  +       F+   +  L   G +LG A+
Sbjct: 178 ALENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESFNS--YKALLATGLSLGLAV 235

Query: 249 SVKMVGLFIITLVGIYTVADLWTLL-----PKQATLKTKKLQAWKVYGCHWIARIVCLII 303
           S K VGLF I  VG  ++  LW  +     P Q+TL+            H + +   L+ 
Sbjct: 236 SSKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLR------------HTVVKATLLLA 283

Query: 304 IPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKG-PRDVALGSSFVSIKNQ 362
            P  ++L  F IHF  L ++  G     S F++TL G+++    P DV +GSS VSI++ 
Sbjct: 284 APAALYLFFFYIHFQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVGSS-VSIRHT 342

Query: 363 ALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
              G  LHSH   +  GS QQQVT Y++ D NN W  +    P   P + E   D     
Sbjct: 343 GTMGGYLHSHKHIYETGSKQQQVTLYSHLDANNDWVIELYDQPEVIPETFEGLKD----- 397

Query: 423 VGNEYRLVHRSTRKNLHADKIVAPVSK-NDW--EVAGFGYGFEVGDDMDNWIIEVIEQAG 479
            G + RL HR T + LH+     PVS+ +DW  EV+ +G     GD  D+W+IE+  +A 
Sbjct: 398 -GTKIRLRHRLTDRRLHSHDHKPPVSESSDWQKEVSAYGADNFTGDANDDWVIEIDHEAS 456

Query: 480 --DEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWN 537
              E +  +  L T F ++HA+ GC L     +LP+WGF Q E+TC+   S     T W 
Sbjct: 457 APGEAQEYVKALDTKFRLRHAMTGCRLFSHEVKLPKWGFEQQEVTCAS--SGVPSLTLWY 514

Query: 538 VESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPT 597
           VE + N  LP+  A   Y    F + F+  ++ M   N  L     ++    S    WP 
Sbjct: 515 VEHNSNPLLPEDAAKISYQTPTFLEKFIESHQRMWHINKNL----KEHHVYQSDPATWPL 570

Query: 598 LNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKAL 657
           L  G+    W+ D  + +LLG+    W  T  + V ++ IV     WQ   +   +   L
Sbjct: 571 LLRGISY--WSQDHKQIYLLGNAVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQDKHVL 628

Query: 658 NTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGTLA 717
           N F +  F  LL WGLH+ P  +M R  ++HH                E I+        
Sbjct: 629 N-FHIQTFQYLLGWGLHYAPSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVSYVFKN-K 686

Query: 718 KYITYITLVLYFAVVIGGFFYFSPISFGM 746
           K + Y  ++ + A     F+ + P+ +G+
Sbjct: 687 KTVGYGVVITFLAAATAFFYVYKPLIYGL 715

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  273 bits (699), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 194/633 (30%), Positives = 310/633 (48%), Gaps = 49/633 (7%)

Query: 70  IVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 129
           ++FT +    R++ I + N VV+ E   G F S Y+ + F+ DVHPPL  ML      + 
Sbjct: 53  LIFTAI---VRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVF 109

Query: 130 GYNGSWDFPS-GEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLV 188
           GY G +++ + G EY   + YV MR F AT   + V + Y+T +  G  I    +     
Sbjct: 110 GYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCF 169

Query: 189 LFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGCAI 248
             ENS+ TL RF L++    FF   +  FF    ++   P S K   +L      LG A+
Sbjct: 170 AIENSFVTLSRFTLIEGPFVFFMACAVYFFR--RSELYLPNSCKANKSLLAASIALGFAV 227

Query: 249 SVKMVGLFIITLVGIYTVADLWTLL-----PKQATLKTKKLQAWKVYGCHWIARIVCLII 303
           S K  GLF I   GI  +  +W ++     P  +++K    Q              CL+ 
Sbjct: 228 SSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQ------------FTCLLA 275

Query: 304 IPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGP-RDVALGSSFVSIKNQ 362
           IP  ++   F +H   L+ +G   +  P+ F+ TL  ++V K    +VA+GS+ VS+ + 
Sbjct: 276 IPAFIYFLIFSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSA-VSLNHV 334

Query: 363 ALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
              G  LHSH+  +P GS QQQVT Y + D NN W  +    P      NE  T  + + 
Sbjct: 335 GTAGGYLHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHP------NENVTSFQNLT 388

Query: 423 VGNEYRLVHRSTRKNLHADKIVAPVSKN-DW--EVAGFGY-GFEVGDDMDNWIIEVIEQA 478
            G   +L        LH+     PVS+N DW  EV+ +GY GFE GD  D+WIIE+ ++ 
Sbjct: 389 DGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFE-GDINDDWIIEIDKKR 447

Query: 479 GDEDKSMIH--PLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWW 536
            +   +  H   + T F +KH + GCYL    ++LPEWGF Q E+TC++  ++ D  +W+
Sbjct: 448 SEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCAY-FAREDLTSWY 506

Query: 537 NVESHENE-KLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQW 595
            +E +ENE  LP+P+    Y K +F++ F+ +++ M   NN +    D   + +S    W
Sbjct: 507 -IEENENEISLPNPE-KVSYKKMSFWQKFVAIHKFMFYLNNYM----DTSHAYSSEPKTW 560

Query: 596 PTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDK 655
           P +  G+    WN++  + + LG+    W  T  +   +I + V    W+  + N   DK
Sbjct: 561 PLMLRGIDF--WNENGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAWKLGV-NILRDK 617

Query: 656 ALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVH 688
            +  F    F  LL +  H+ P+  + +  +++
Sbjct: 618 HIINFHYQVFQYLLGFAAHYFPYFFVGQKLFLY 650

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  263 bits (673), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 214/723 (29%), Positives = 324/723 (44%), Gaps = 67/723 (9%)

Query: 73  TGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 132
           T ++F  R YKI     VV+DE HFGKF SYYL   F+ DVHPPL KM++   G+L  Y+
Sbjct: 66  TAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCNYD 125

Query: 133 GSWDFPS-GEEYPDY-LDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLF 190
           GS+ F   G  Y  +   ++  R F A   +L V + + + K + F     +L + LV  
Sbjct: 126 GSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLVAI 185

Query: 191 ENSYATLGRFILLDSMLQFFTVASFMFFILFHT-QRKNPFSIKWWTTLALLGFNLGCAIS 249
           +N++ T  R ILLD++L     A+   +I F+  Q K PFS  W+  L L GF+L C IS
Sbjct: 186 DNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCVIS 245

Query: 250 VKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVF 309
            K +G+     +GI  V +LW LL   A L  + L        H   R+  LI+IPF+++
Sbjct: 246 TKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIK------HIGRRLNGLILIPFIIY 299

Query: 310 LTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALL 369
           L  F +HFA+L+ SG GD  M S FQ TL  S+  K  ++V      V+ +NQ   GA L
Sbjct: 300 LFWFYVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQF-FDIVTFENQD-TGAFL 357

Query: 370 HSHVQTFP-------QGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
           HSH+  +P         S  QQVT Y + D NN W           P +++ + D   +R
Sbjct: 358 HSHLARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEI--------LPVADKAKGD--NIR 407

Query: 423 VGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDED 482
            G+E+RL H  T   L A  + +P+   + E+        +G   ++ I         ++
Sbjct: 408 FGDEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDE 467

Query: 483 KSMIHPLTTTFHIKHAVLGCYL-TQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESH 541
             +I        I H      L +   + LP+WGF Q E+  + K++  D    W ++S 
Sbjct: 468 GHIIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKKMT--DSGNAWTIDSI 525

Query: 542 ENEKLPDPDASFHYPKT----NFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPT 597
            N    D   S + PK      FF  +L L ++M   NN L  +       AS    WP 
Sbjct: 526 MN---LDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSEH----PFASQPESWPG 578

Query: 598 LNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKAL 657
              G+     N++  + + +G+    W   +S  V +   +++A +  RQ   FA +K  
Sbjct: 579 SMSGVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYV--GIIIADQITRQRGYFALNKVT 636

Query: 658 NTFMMGAF-YPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKGT- 715
              + G   Y    W  H+ PF +M R  ++HH                E +  R K   
Sbjct: 637 REKLYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKSDD 696

Query: 716 -------------------LAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYL 756
                               A YIT+   VL  A ++  F +FSP+ +     ++     
Sbjct: 697 PYKDEEKPGVSFEKYPAIYTAAYITFNITVL--AALVWCFVFFSPLIYATPLSAREVIKR 754

Query: 757 DWL 759
            WL
Sbjct: 755 KWL 757

>Scas_442.1
          Length = 309

 Score =  248 bits (634), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 181/311 (58%), Gaps = 19/311 (6%)

Query: 464 GDDMDNWIIEVIEQAGD-------EDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGF 516
           GD  D+WI+E+++Q          ED++++HP++T F ++H VLGCYL  T    P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 517 RQSEMTCSHKISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNN 576
           +Q+E+ C    S  DK TWWNVE H N++LP  +  +  PK+ F+ DF+ +N  M ++N+
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPI-EEDYVPPKSKFWTDFILINFAMASSNS 124

Query: 577 ALVPDSDKYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIF 636
           ALVPD+DK+D LAS  W+WPTL+ GLRLC W+ D  KY+LLGSP +TW ST+S+ + +  
Sbjct: 125 ALVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFI 184

Query: 637 IVVLAFRWQRQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXX 696
           I  +A++W+RQ  N   D+     + G F P LAW  HF PFV+M RVTYVHH       
Sbjct: 185 ISKIAYQWRRQHLNLQEDQLWRLGIQGIF-PFLAWITHFFPFVMMGRVTYVHHYLPALYF 243

Query: 697 XXXXXXXXXEAIIRRPKGTLAKYITYITLVLYFAVVIGG---FFYFSPISFGMDGPSKNY 753
                    +  I R          +I   +Y A+ +G    +  F+PI  G+ G    Y
Sbjct: 244 AILTFGFVLDYSIGRAN-------PFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKY 296

Query: 754 RYLDWLSGWKI 764
             L+WL  W I
Sbjct: 297 LRLEWLPTWNI 307

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  259 bits (662), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 219/732 (29%), Positives = 319/732 (43%), Gaps = 69/732 (9%)

Query: 67  VMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 126
           VM  + TGL+   R+++I     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G
Sbjct: 63  VMNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIG 122

Query: 127 YLAGYNGSWDFPS-GEEYPDYL-DYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLF 184
           +L GYNGS+ F   G  Y  Y   +V  R   A    L V + + T K + F     ++ 
Sbjct: 123 WLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIA 182

Query: 185 TCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHT-QRKNPFSIKWWTTLALLGFN 243
             L+  +N++ T  R ILLD+ML F    S   ++ F+  Q  +PFS +W+  L L GF+
Sbjct: 183 AFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFS 242

Query: 244 LGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLII 303
           L   +S K VGL     +G+  V +LW LL  ++ L  +K+        H + RI  LII
Sbjct: 243 LSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVK------HTLVRINGLII 296

Query: 304 IPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGS----SFVSI 359
            PF+V+L  F  HFA+L+ SG GDA M S FQ TL        P  V + S      ++I
Sbjct: 297 FPFVVYLFWFWCHFAILNQSGPGDAFMSSDFQDTL-----LDAPGAVEIKSINYHDIITI 351

Query: 360 KNQALGGALLHSHVQTFPQ-------GSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSN 412
           K++A   A LHSH+  +P         SN QQVT Y++ D NN W    I  P    +  
Sbjct: 352 KHKA-TDAFLHSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQW---EILPPSGSKFKK 407

Query: 413 ETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWII 472
                   V++  + RL H  T   L A  + +P    + EV         G+  D  + 
Sbjct: 408 GAP-----VKLDADIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFTLF 462

Query: 473 EVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYL-TQTLKQLPEWGFRQSEMTCSHKISKND 531
                       +     + F I H      L T   K LPEWGF Q E+  + K+   D
Sbjct: 463 RFQPILPKNSGRVAKTKNSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVNGNKKV--QD 520

Query: 532 KRTWWNVESHENEKLPDPDASFHY-PKT----NFFKDFLFLNRIMMATNNALVPDSDKYD 586
               W V+S  N  +P+ D+   Y PK      FF+ +  L  +M   NN L  +     
Sbjct: 521 PENNWFVDSIVN--MPENDSRRIYTPKVPTSMPFFQKWYELQFLMFEHNNKLSSEH---- 574

Query: 587 SLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQR 646
             AS    WP    G+      +   + F  G+    W   VSV + +  +V      QR
Sbjct: 575 PFASNPQSWPLSLSGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQR 634

Query: 647 QLTNFANDKALNTFMMGAF-YPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXX 705
            +  +A +K     + G   + +  W +H+ PF +MAR  ++HH                
Sbjct: 635 AV--YALNKMARQKLYGPMAFLIFGWCIHYFPFFLMARQKFLHHYLPAHLILAMFSAALW 692

Query: 706 EAII---------------RRPKGTLAKY--ITYITLVLYFAVVIGG-FFYFSPISFGMD 747
           E +                + P     K   I Y    L   V +GG F YF+P+ +G+ 
Sbjct: 693 EIVFTDNQSLDFDLDEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPLVYGLS 752

Query: 748 GPSKNYRYLDWL 759
                 +   W 
Sbjct: 753 MTVDQIKARQWF 764

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  246 bits (628), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 204/710 (28%), Positives = 311/710 (43%), Gaps = 67/710 (9%)

Query: 73  TGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 132
           T ++F  R +K+   + VV+DE HFGK  SYYL   ++ DVHPP  KML+   G+L GY+
Sbjct: 55  TAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYD 114

Query: 133 GSWDFPS-GEEYPDY-LDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLF 190
           G++ F   G  Y  + + Y+  R   A   +L VP+ +   + + F          LV  
Sbjct: 115 GAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAV 174

Query: 191 ENSYATLGRFILLDSMLQFFTVASFMFFILFH-TQRKNPFSIKWWTTLALLGFNLGCAIS 249
           +N++    R ILLD+ L      S   +I F+  Q + P S +W+  L   G +L   IS
Sbjct: 175 DNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVIS 234

Query: 250 VKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVF 309
            K VG+F   ++G   + +LW LL  +A L      + +++  H++ R   L+  PF V+
Sbjct: 235 TKYVGVFTFAMIGTAVIVNLWQLLDVRAGL------SLRMFFRHFVQRFNGLVCFPFAVY 288

Query: 310 LTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALL 369
           L  F +HFA+L+ SG GD  M S FQ TL  S + K  +DV      V+ +++   GALL
Sbjct: 289 LFWFYVHFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHY-YDIVTFQHRD-TGALL 346

Query: 370 HSHVQTFPQ-------GSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
           HSH   +P         S  QQVTGY++ D NN W      I   +  S+ T    + V 
Sbjct: 347 HSHNAYYPLRYEDGRVSSQGQQVTGYSHEDINNQW-----EILPTKELSSRTG---QPVL 398

Query: 423 VGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDED 482
           + +  RL H +T   L    + +P    + EV         G+     + ++      + 
Sbjct: 399 LDDVLRLRHIATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDG 458

Query: 483 KSMIHPLTTTFHIKHAVLGCYL-TQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVES- 540
              +   T+ F + H      L T     LPEWGF+Q E+  + K++  D    W V S 
Sbjct: 459 GHTVKSKTSMFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKKVT--DPANIWTVNSI 516

Query: 541 ---HENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPT 597
               E  K+  P      P   FF  +L L R M   NN L  +       AS    WP 
Sbjct: 517 LNLSEERKVYIPKKVTKMP---FFSKWLELQRSMFEHNNKLSSE----HPFASQPESWPG 569

Query: 598 LNVGLRLCGWNDDTVK--YFLLGSPASTWPSTVSVIVLMIFI-VVLAFRWQRQLTNFAND 654
              G+    W +DT +   +  G+    W   + +I L +F+ ++LA    RQ + F   
Sbjct: 570 SLSGVSF--WTNDTERRQIYFTGNIIGWW---IELISLALFVGILLADAITRQRSFFVLG 624

Query: 655 KALNTFMMGAF-YPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPK 713
           K     + G   +  + W +H+ PF +M R  ++HH                E I    +
Sbjct: 625 KLAREKIYGPLCFLYIGWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWEVIFTDNR 684

Query: 714 GTLAKY-------------ITYITLVLYF-----AVVIGGFFYFSPISFG 745
               +              I Y   +L F       V+G F YFSPI +G
Sbjct: 685 ALTTRKDESEPAAPHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYG 734

>Kwal_47.16734
          Length = 792

 Score =  246 bits (628), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 207/722 (28%), Positives = 311/722 (43%), Gaps = 60/722 (8%)

Query: 73  TGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 132
           T L+   R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+   G+L GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 133 GSWDFPS-GEEY-PDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLF 190
           G++ F   G  Y  +   +V  R   A   +L VP+ + T K + F      L   LV  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 191 ENSYATLGRFILLDSMLQFFTVASFMFFILFHT-QRKNPFSIKWWTTLALLGFNLGCAIS 249
           + ++    R ILLD+ L      S   ++ F+  Q K PFS  W+  L L G +L   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 250 VKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVF 309
            K +G+     +G     +LW LL  +A L  ++      +  H + R+  LI  PF+++
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQ------FVKHVLQRLNGLIFAPFVLY 323

Query: 310 LTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALL 369
           L  F +HFA+L  SG GD  M S FQ TL  S + +  R V      +++K++ +  A L
Sbjct: 324 LFWFWVHFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYF-DIITLKHK-VTDAYL 381

Query: 370 HSHVQTFP-------QGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
           HSH++ +P         SN QQVTGY   D NN W      +P  Q  + E +     V 
Sbjct: 382 HSHLERYPIRYEDGRVSSNGQQVTGYTLEDVNNQWEV----LPTKQLPAREGQP----VH 433

Query: 423 VGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDED 482
           + +  R  H  T   L A  + +P+   + E+         G +    +  +      + 
Sbjct: 434 LDDVVRFRHVVTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDS 493

Query: 483 KSMIHPLTTTFHIKHAVLGCYL-TQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESH 541
           + ++    + F I H      L T     LPEWGF+Q E+  + KI   D    W  E+ 
Sbjct: 494 EDVLKSKASVFRIVHIDTTVALWTHNDVLLPEWGFKQQEVNGNKKII--DPENSWFAETI 551

Query: 542 ENEKLPDPDASFHYPKTN----FFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPT 597
            N    D   S + PKT     FF  ++ L R+M   NN L          AS+   WP 
Sbjct: 552 VN---IDEARSVYVPKTRKKLPFFTKWMELQRLMFEHNNKL----SSSHPFASSPESWPG 604

Query: 598 LNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKAL 657
              G+     + + ++ + +G+    W   VS I L   +       +R+     N  A 
Sbjct: 605 SLSGVSFWTKDSERIQIYFIGNIIGWWFQVVS-IALFCGVTAADLLVRRRGIFPLNKMAK 663

Query: 658 NTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKG-TL 716
                   +  + W  HF+PF +M R  ++HH                E I    K   L
Sbjct: 664 QKLNAPLSFLFVGWLCHFVPFFLMGRQKFLHHYLPAHLIASMFSAAMWETIFTDNKSLNL 723

Query: 717 AK-------------YITYITLVLYFAVVIGG----FFYFSPISFGMDGPS-KNYRYLDW 758
            K             ++ YI L+L+  V+ G     F YFSPI +G    S  + R  +W
Sbjct: 724 EKDEEDPANAHEANPHLNYIPLILFVLVMSGALIWFFVYFSPIVYGDQSLSVADVRKREW 783

Query: 759 LS 760
           L+
Sbjct: 784 LN 785

>Scas_710.1
          Length = 919

 Score =  246 bits (628), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 207/708 (29%), Positives = 333/708 (47%), Gaps = 53/708 (7%)

Query: 70  IVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 129
           + FT L    R++ +G  N VV+DEA +G   S YL++  + DVHPPL K+L     +  
Sbjct: 59  LAFTAL---IRLHDLGWPNGVVFDEAVYGNIVSKYLKNILFVDVHPPLIKLLYAGIAHFL 115

Query: 130 GYNGSWDFPS-GEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLV 188
           G+ G ++F   G  +P    Y  MRLF AT  SL V + Y+T +A G  I      +  +
Sbjct: 116 GFEGQFEFNDIGVPFPTTTPYYAMRLFSATLGSLTVLLMYLTLRASGVRIWVALAGSICL 175

Query: 189 LFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPF---SIKWWTTLALLGFNLG 245
           + ENS+ T+ R I+L+  L FF  A+  F     T++ + F   S   +  + +    LG
Sbjct: 176 VIENSFVTVSRHIMLEGPLMFFIAAAVYF-----TKKSDLFKADSCNSYINIGIAAVALG 230

Query: 246 CAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIP 305
            AIS K VG+  +   G+  V  LW ++     L      ++KV     + +   LI +P
Sbjct: 231 LAISSKWVGVATLIWAGLICVWRLWFMV---GNLSMPVCGSFKVA----LIKAFTLIFLP 283

Query: 306 FLVFLTCFRIHFALLSHSGTGDANMPSLFQATL-DGSDVGKGPRDVALGSSFVSIKNQAL 364
            ++++  F  HF     +          F+ TL + S V     ++A+G S +++++   
Sbjct: 284 IILYILTFYFHFQYTGINSDVSQLFTPEFRTTLANNSVVNNVVAEIAVG-SMITLRHPGT 342

Query: 365 GGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVG 424
            G  LHSH   + +GSNQQQ+T Y Y D N+ W  +   +P     S +  TD      G
Sbjct: 343 HGGYLHSHDAFYEKGSNQQQITCYPYVDKNDNWTVELYDVPLENITSFQNLTD------G 396

Query: 425 NEYRLVHRSTRKNLHADKIVAPVSKN-DW--EVAGFGY-GFEVGDDMDNWIIEVIEQAG- 479
            + RL+H +T   LH+     PVS+N DW  EV+ +GY GFE GD  D+WIIE+ + A  
Sbjct: 397 TKIRLLH-NTGCRLHSHDHKPPVSENSDWQKEVSCYGYPGFE-GDANDDWIIEIDKDASI 454

Query: 480 -DEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNV 538
             E +  +  + T F +KHA++GCYL      LP+ GF Q E+TC++  S  D  T W+V
Sbjct: 455 PGESQEHVRAIETKFRLKHAIMGCYLFSHNTMLPKLGFEQQEVTCAY--SGIDSLTLWSV 512

Query: 539 ESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTL 598
           E++EN  + D      Y   +F+K F+  ++ M+   + +    D      S    WP +
Sbjct: 513 ENNENPFVSDDAERVSYEPLSFWKKFVETHKRMLEIASGM----DNTHMYESKPATWPFM 568

Query: 599 NVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALN 658
             G+    W++     +LLG+ A  W S  + IV    IVV      +    F+ D  + 
Sbjct: 569 LRGIDF--WSEQHQDIYLLGN-AVLWWSVTAFIVGFAGIVVWELVSLQLGYEFSKDPHVI 625

Query: 659 TFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAII----RRPKG 714
            F +     LL + L+F+P +++    +++H                + ++    RR + 
Sbjct: 626 NFHIQVIQYLLGFLLNFIPSLLLENQIFLYHYLPAYYFGILALTHGLDILVSYIFRRRRS 685

Query: 715 TLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGW 762
                I Y  + L+  + +  F   S + +G            WLSGW
Sbjct: 686 -----IGYTIVFLFATLCVYFFRDRSALVYGTSWTKDLCEQSKWLSGW 728

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  231 bits (588), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 206/737 (27%), Positives = 322/737 (43%), Gaps = 83/737 (11%)

Query: 52  QPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYH 111
           QP  E  P  +   WV   + T L+F  R YKI     VV+DE HFGKF SYYL   ++ 
Sbjct: 43  QPLPE--PESRYSFWVT--IVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFF 98

Query: 112 DVHPPLGKMLVGLSGYLAGYNGSWDFP----SGEEYPDYLDYVKMRLFQATFSSLCVPMA 167
           DVHPP  KM++   G+L GY+GS+ F     S E +P    Y+  R F A   +L VP+ 
Sbjct: 99  DVHPPFAKMMIAFIGWLCGYDGSFKFDEIGYSYETHP--APYIAYRSFNAILGTLTVPIM 156

Query: 168 YITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFH-TQRK 226
           + T K + F        + LV  + ++ T  R ILLD++L     A+   ++ F+  Q +
Sbjct: 157 FNTLKELNFRAITCAFASLLVAIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLR 216

Query: 227 NPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQA 286
            PF+  W+  L   G +L   IS K VG+   + +G   V +LW LL  +A L  ++   
Sbjct: 217 QPFTWSWYIWLHATGLSLSFVISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMR 276

Query: 287 WKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKG 346
                 H+  R+  L++IPF+++L  F +HF +L+ SG GDA M + FQ TL  S +   
Sbjct: 277 ------HFSKRLNGLVLIPFVIYLFWFWVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVD 330

Query: 347 PRDVALGSSFVSIKNQALGGALLHSHVQTFPQ-------GSNQQQVTGYAYNDDNNIWFF 399
            + V      ++IK+Q    A LHSH+  +PQ        S  QQVTGY + D NN W  
Sbjct: 331 SKTVNY-FDIITIKHQD-TDAFLHSHLARYPQRYEDGRISSAGQQVTGYTHPDFNNQW-- 386

Query: 400 DRIRIPGNQPWSNETETDI---EYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAG 456
             +  P          +D+   + V +    RL H +T   L A  + +P    + E+  
Sbjct: 387 -EVLPPHG--------SDVGKGQAVLLNQHIRLRHVATDTYLLAHDVASPFYPTNEEITT 437

Query: 457 FGYGFEVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYL-TQTLKQLPEWG 515
                  G+     +         ++  ++   T +F + H      L T   + LP+WG
Sbjct: 438 VTLEEGDGELYPETLFAFQPLKKSDEGHVLKSKTVSFRLFHVDTSVALWTHNDELLPDWG 497

Query: 516 FRQSEMTCSHKISKNDKRTWWNVESHENEKLPDPDASFHYPKT----NFFKDFLFLNRIM 571
           F+Q E+  + K+   D    W V+   N    D     + PK      F K ++   + M
Sbjct: 498 FQQQEINGNKKVI--DPSNNWVVDEIVNL---DEVRKVYIPKVVKPLPFLKKWIETQKSM 552

Query: 572 MATNNALVPDSDKYDSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVI 631
              NN L  +       AS  + WP    G+      D+  + + +G+    W     VI
Sbjct: 553 FEHNNKLSSEH----PFASEPYSWPGSLSGVSFWTNGDEKKQIYFIGNIIGWW---FQVI 605

Query: 632 VLMIFI-VVLAFRWQRQLTNFANDKALNTFMMGAF-YPLLAWGLHFMPFVIMARVTYVHH 689
            L +F+ +++A    R    +A +K     + G   +  ++W  H+ PF +MAR  ++HH
Sbjct: 606 SLAVFVGIIVADLITRHRGYYALNKMTREKLYGPLMFFFVSWCCHYFPFFLMARQKFLHH 665

Query: 690 XXXXXXXXXXXXXXXXEAII--------------------RRPKGTLAKYITYITLVLYF 729
                           E I                     R PK  +  Y  ++  V   
Sbjct: 666 YLPAHLIACLFSGALWEVIFSDCKSLDLEKDEDISGASYERNPKVYVKPYTVFLVCV--- 722

Query: 730 AVVIGGFF-YFSPISFG 745
           +  +  FF YFSP+ +G
Sbjct: 723 SCAVAWFFVYFSPLVYG 739

>Scas_719.80
          Length = 762

 Score =  221 bits (564), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 199/709 (28%), Positives = 303/709 (42%), Gaps = 65/709 (9%)

Query: 73  TGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 132
           T ++F  R Y I     VV+DE HFGKF SYYL   ++ DVHPP  KM +   G+L GYN
Sbjct: 60  TLIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYN 119

Query: 133 GSWDFPS-GEEY-PDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTCLVLF 190
           GS+ F   G  Y  +   Y+  R F A   +L V + + T K + F     +    LV  
Sbjct: 120 GSFKFDEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAV 179

Query: 191 ENSYATLGRFILLDSMLQFFTVASFMFFILFH-TQRKNPFSIKWWTTLALLGFNLGCAIS 249
           +N++ T  R ILLD++L     ASF  F+ F+  Q + PFS +W+  L L G +L   IS
Sbjct: 180 DNAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVIS 239

Query: 250 VKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVF 309
            K +G+     +G   + +LW LL  +A L        + +  H++ R+  L+  PF ++
Sbjct: 240 TKYIGVMTYAAIGTGVIVNLWQLLDLRANLTL------RAFFRHFVKRLNGLVFAPFCIY 293

Query: 310 LTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALL 369
           L  F +HFA+LS SG GDA M + FQ TL  S +    ++V      +++K++    A L
Sbjct: 294 LFWFWVHFAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHF-YDIITLKHKD-TEAFL 351

Query: 370 HSHVQTFPQ-------GSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVR 422
           HSH   +P         S  QQVTG+   D +N W     R         E ++      
Sbjct: 352 HSHQAFYPLRYEDGRISSEGQQVTGFTGTDISNDWEVLPTR---------ELDSHKGVPV 402

Query: 423 VGNE-YRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDE 481
           V NE  RL H ++   L A  + +P    + E+         G+     +         +
Sbjct: 403 VLNEPIRLRHVASNTYLLAHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGD 462

Query: 482 DKSMIHPLTTTFHIKHAVLGCYL-TQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVES 540
           +  ++      F I H      L T     LP+WGF Q E+  S      D    W+V+ 
Sbjct: 463 EGHVVKTKGVQFKIYHPNTDVVLWTHNDVLLPDWGFEQQEVNGSKNF--GDPTNAWSVDE 520

Query: 541 HENEKLPDPDASFHYPKT----NFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWP 596
             N    D D     PK     +FF+ +  L + M   NN L  +       AS    WP
Sbjct: 521 ITNL---DEDRKKFTPKVVKPMSFFRKWSELQKSMFEQNNKLSAE----HPFASQPQSWP 573

Query: 597 TLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFI-VVLAFRWQRQLTNFANDK 655
               G+     +++  + F   +    W     VI + +FI ++LA +  R+   F   K
Sbjct: 574 AGLCGVSFWTKSEERKQIFFTANIIGWW---FQVISMSVFIGILLADQISRKRGYFVLGK 630

Query: 656 ALNTFMMGAF-YPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAIIRRPKG 714
                + G   +  ++WG H+ PF +M R  ++HH                E +    K 
Sbjct: 631 ITREKLYGPLAFLFISWGCHYAPFFLMHRQKFLHHYLPAHLIISLFTAGLWEVVFSDCKS 690

Query: 715 TLAKY--------------ITYITLVLYFAVV----IGGFFYFSPISFG 745
             A                I   +L ++F  V    +  F YFSP+ +G
Sbjct: 691 IDASRDEEIEGTPYKADPKINSTSLTVFFVAVSIAIVWFFIYFSPLVYG 739

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  185 bits (469), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 168/639 (26%), Positives = 285/639 (44%), Gaps = 42/639 (6%)

Query: 62  KVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 121
           K +  +M IV    +  TR Y IG    +V+DE       S Y    F  DV PPLGKM+
Sbjct: 58  KSDGILMAIV-ALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKMI 116

Query: 122 VGLSGYLAGYNGSWDF-PSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPA 180
               G   G++ S+ + P G ++ +   Y+  R   A   +  V   ++T +A G S P 
Sbjct: 117 YYFVGKYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRPI 176

Query: 181 VWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALL 240
             +F+  +  ENS+ T  R++ LD+   FF  A+  F       R    S ++  T    
Sbjct: 177 AGIFSVALSLENSFITASRYVHLDAPFLFFVAAAIYFTKKSDNLRAG--SGRYIFTFTHA 234

Query: 241 GFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVC 300
              LG AIS K  GLF++  V I T+  LW L      L     +  KV+    I  ++ 
Sbjct: 235 ACLLGLAISTKWAGLFVLAWVAIVTLWRLWLL---AGDLSVPICRTVKVF----IFNLLV 287

Query: 301 LIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGP-RDVALGSSFVSI 359
           L ++P +++ + F  H    +  G     M   F++ L  + V K    DV +G + V +
Sbjct: 288 LSLVPAVIYFSIFSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGT-VRL 346

Query: 360 KNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIE 419
            N  + G  + +    +  GS Q+Q+           W  +     G+ P S E   + E
Sbjct: 347 NNIGMDGGFVEAAPAYYEAGSKQRQIDLRKNESVTTDWVVEYYNRSGSTPKSFENLKNHE 406

Query: 420 YVRVGNEYRLVHRSTRKNLHADKIVAPVSKN-DW--EVAGFGYGFEVGDDMDNWIIEVIE 476
            +      RL     +  LH+    AP+S++ DW  EV+ +GY   +GD  D+WI+E+ +
Sbjct: 407 KI------RLYSPKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVEIDQ 460

Query: 477 QAGD--EDKSMIHPLTTTFHIKHAVLGCYL-TQTLK-QLPEWGFRQSEMTCSHKISKNDK 532
              +  E +  +  + T F +KHA+ GCYL T  ++ + PE+     E+ C+H  S   +
Sbjct: 461 DLSEPGEAREFVKAIDTKFRLKHAMSGCYLFTHDVRMRTPEF-VMDYEIACAH--SGKYE 517

Query: 533 RTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYD--SLAS 590
            T WN+E  +    P P++  + PK   +K     ++I+      +     + D  SL +
Sbjct: 518 LTLWNIEQDQ----PHPNSPKN-PKRVSYKPMSLKDKILDLHAKMIEKAKVRTDKSSLIT 572

Query: 591 AAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTN 650
               WP L  G+    WN    + + LG+PA  W  +  +++ ++  V     WQ     
Sbjct: 573 FPTTWPLLEKGIPF--WNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEI 630

Query: 651 FANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHH 689
            +N + +N F +      + + L+++P+++    T  HH
Sbjct: 631 SSNPQFIN-FHIQVLQYGIGFALNYVPYIL---TTDRHH 665

>Scas_329.1
          Length = 273

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 121/226 (53%), Gaps = 6/226 (2%)

Query: 52  QPPSEESPLCKVEAWVMPIVFTGLSFFT---RMYKIGVNNHVVWDEAHFGKFGSYYLRHE 108
           +PP+E +    V      +    L+ FT   R+  +   + VV+DE HFGKF SYY++ E
Sbjct: 41  EPPAELAKARTVFPLKEKLAIAILALFTASIRLPNLQKPDSVVFDEVHFGKFASYYIKGE 100

Query: 109 FYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS-GEEYPDYLDYVKMRLFQATFSSLCVPMA 167
           F+ DVHPPL KML      LAG+ G++ F + G+ +P  + YV MR F A   +L V + 
Sbjct: 101 FFMDVHPPLAKMLYAGVAALAGFRGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLL 160

Query: 168 YITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKN 227
           Y+T ++ G      ++       ENSY T+ R+ILLD+ L FF  A+   F  +   +  
Sbjct: 161 YLTLRSSGVRPWVAFVSGACFAIENSYVTISRYILLDAPLIFFIAAAVYSFKKYENYKS- 219

Query: 228 PFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLL 273
            FSI    +L + G  LG A S K VGLF I  VG+  +  LW ++
Sbjct: 220 -FSIGSIKSLFVAGVALGMAASAKWVGLFTIAWVGLLCIWRLWFMI 264

>Scas_30.1
          Length = 128

 Score =  124 bits (310), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 80/118 (67%), Gaps = 1/118 (0%)

Query: 649 TNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEAI 708
            +FAN + LNTF+MGAFYPLL WGLH++PFVIM+RVTYVHH                +  
Sbjct: 11  VDFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFF 70

Query: 709 IRRPKGTLAKYITYITLVL-YFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGWKIS 765
           +++   +    IT + +   Y+AV+I GF+YFSPISFGMDGPS+NY YL+ LS WKI+
Sbjct: 71  MKKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNYSYLNLLSSWKIA 128

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 121/449 (26%), Positives = 198/449 (44%), Gaps = 54/449 (12%)

Query: 103 YYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSL 162
           +YL HEFY D  PPL   L  L  ++ G                L    +R    +   +
Sbjct: 70  HYLSHEFYLDSRPPLSVQLFSLLTFVYGE---------------LSVELLRAATTSCGGI 114

Query: 163 CVPMAYITAKAIG----FSIPAVWLFTCLVLF--ENSYATLGRFILLDSMLQFFTVASFM 216
            + + Y+  +        S+ AV  F+ L +F  E    +   F +    +  ++  SF 
Sbjct: 115 ALVLLYLGLRKSSVNRVISVIAVVSFSYLKVFREETLRVSTDIFQVCFLAMSLYSWKSF- 173

Query: 217 FFILFHTQRKNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQ 276
                  +   PFS  W   L  L  +LG +IS K VG    + +   ++  LW ++   
Sbjct: 174 -------KAAKPFSKTWHKYLLFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADV 226

Query: 277 ATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDAN-MPSLFQ 335
                 +L   +V+  H + R + L+++P +VFL  +  H + L+   T  +  M   ++
Sbjct: 227 ------RLTGKQVF-THCVLRFMALVLVPAIVFLLSYYAHISTLTQDLTDFSTFMSPYYK 279

Query: 336 ATLDGSDVGK--GPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDD 393
            TL+ + + K   P  V  GS+ ++I+++   G  LHSH   +  GS++QQVT Y + D+
Sbjct: 280 HTLENNPLNKIVPPGRVYYGST-ITIRHKDSLGGYLHSHELNYQSGSHEQQVTLYDFPDN 338

Query: 394 NNIWFFDRIRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDW- 452
           NN W      I  ++  + +  +    V+ G   RL HR T K L A     PVS+ D+ 
Sbjct: 339 NNEW------IVEHKKENKDVSSKAVAVKNGENIRLRHRLTGKLLRASGAKPPVSEQDYD 392

Query: 453 -EVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQL 511
            EV+  G     G   + W I     +G   + ++ PL TTF + +   GC L     +L
Sbjct: 393 REVSCTGDANYTGQSDELWKIRF---SGRLLEGLV-PLDTTFQLTNQGQGCTLLSHDLRL 448

Query: 512 PEWGFRQSEMTCSHKISKNDKRTWWNVES 540
           PEW   Q E+ C    +K  +RT + VES
Sbjct: 449 PEWALFQQEVLCLDPPTK--ERTLFYVES 475

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 148/332 (44%), Gaps = 35/332 (10%)

Query: 163 CVPMAYITAKAIGFSIPAVWL---FTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFI 219
           CV + Y+        I  +W      C+ L E     + R   + + L+ +  A F+  I
Sbjct: 129 CVVLQYLYKSLRCAGIQRLWAGAAVGCIALLE-----VFRDAAVHASLEMYH-AMFLAII 182

Query: 220 LFHTQR---KNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQ 276
           L++ +    + PF   WW  L+ +    G A   K VGL     V +   A ++ L+   
Sbjct: 183 LYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHIFQLI--- 239

Query: 277 ATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQA 336
             L+      WK    H + R+  L ++P  + L  +  H    S+S    + MP+LF+A
Sbjct: 240 GDLEVSTRTVWK----HVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKA 295

Query: 337 TLDGSDVGKGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNI 396
            LDG  V + P  V  GS  V   + ++GG  LHSH  T+P GS +QQ+T Y + D NN 
Sbjct: 296 QLDGYQVLQ-PASVYYGSGVVIRHSSSIGG-YLHSHELTYPGGSEEQQITLYDFEDANNK 353

Query: 397 WFFDRIRIPGNQPWSNETETDI----EYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDW 452
           W  +        P  NE   DI    + VR G+  +L H  T K L A     PVS+ D+
Sbjct: 354 WTVE--------PVYNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDY 405

Query: 453 --EVAGFGYGFEVGDDMDNWIIEVIEQAGDED 482
             EV+  G     GD  + W +++ +    ED
Sbjct: 406 DQEVSCTGDSGYSGDSDETWRVDIQDAEYHED 437

>Kwal_33.14357
          Length = 657

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 117/243 (48%), Gaps = 18/243 (7%)

Query: 287 WKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKG 346
           WK+   H   R++ +I +PF + L+ +   F  L +S     N  SL         + +G
Sbjct: 231 WKILK-HTFWRVLMIICVPFGLMLSSY---FVFLLNSRGAGMNHSSLVSPYFKTWFLPQG 286

Query: 347 ---PRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAY-NDDNNIWFFDRI 402
              P  V  GS+ +    ++LGG  LHSH  T+  GS +QQVT   + ND +N W  +  
Sbjct: 287 LPQPDAVYYGSNLLIRHAESLGG-YLHSHNYTYESGSLEQQVTLVDFSNDADNEWIIEA- 344

Query: 403 RIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDW--EVAGFGYG 460
                Q  + + +  ++ VR G+  +L HR++ K L A    APVS+ D+  EV+  G  
Sbjct: 345 -----QNENLKLDKTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTGDH 399

Query: 461 FEVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSE 520
              GD  + W I   E+    ++ ++ P T  F +++    C L     +LP+WGF Q E
Sbjct: 400 DYTGDSDETWRIR-FERGNTPNEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFGQQE 458

Query: 521 MTC 523
           + C
Sbjct: 459 VLC 461

>Scas_588.7
          Length = 726

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 106/465 (22%), Positives = 183/465 (39%), Gaps = 80/465 (17%)

Query: 103 YYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSL 162
           YY + +F  +  PPLG  L  L             P G        Y  MRL   + SS 
Sbjct: 142 YYQKDKFILNSFPPLGIQLYSL------------LPVGS-------YSAMRLMSLSASSF 182

Query: 163 CVPMAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSM------LQFFTVASFM 216
            +   Y+  + +        + T  +L    +      I LD++      +  ++ AS  
Sbjct: 183 SLLFLYLAFRRVNVPYLIALVSTVCILSIPLFRKESTRISLDTLQWFWLSISIYSWASLK 242

Query: 217 FFILFHTQRKNPFSIKWWTTLALLGFNLGCAISVKMVGL----FIITLVGIYTVADLWTL 272
            F        + FSIKW     +   ++GC+++ K +G     + I +  IY     W +
Sbjct: 243 CF--------SHFSIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIY----FWQM 290

Query: 273 LPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDAN--- 329
           +     L T  +        H   +I CL++IP  +F T   +    ++HS         
Sbjct: 291 I-GDVRLSTSHIVK------HTTFQIFCLLVIPMTIFATTLYLQ---INHSRIDSPEYSQ 340

Query: 330 -MPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQV--T 386
            M S ++  L        P ++  GS        +LGG L     +++P+GS +Q V  T
Sbjct: 341 YMSSYYKIFLRSKSPILQPMEITNGSIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLT 400

Query: 387 GYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAP 446
               N DN  W  + +      P        I+  R+    +L HR+T K L A     P
Sbjct: 401 DMESNVDNQ-WILEYVDDYNKGPL-------IDSQRI----KLRHRTTGKLLRASSAKPP 448

Query: 447 VSKNDW--EVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYL 504
           VS+ ++  EV+  G     GD  + W I+++E +       + P      + +    C L
Sbjct: 449 VSEQEYNSEVSCTGDWDYHGDSDEFWKIDLVEGS-------LIPCWNIMELDNVGQMCTL 501

Query: 505 TQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENEKLPDP 549
                +LP+WG  + E+ C    S + +R  + +E  +N+++ +P
Sbjct: 502 ISHDTRLPDWGEFEQEVFCIQ--SPDPQRAKFQIEFVDNDEIKNP 544

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 123/302 (40%), Gaps = 18/302 (5%)

Query: 224 QRKNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKK 283
           Q    FS+ W+  + L+  +L   IS K +GL     + I ++  LW ++     L  K 
Sbjct: 175 QASKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVV---GDLDVKN 231

Query: 284 LQAWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDV 343
            Q + +  C    R++  ++IP +     +       + S    A M S FQ     S  
Sbjct: 232 RQLFAIMFC----RLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQH-YSMSQH 286

Query: 344 GKGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIR 403
              P  +  GSS       +LGG L    +  +P+ ++         +D+ N W      
Sbjct: 287 NDIPSSIIYGSSIRLRHVNSLGGYLSALEI-PYPKSNDTLVTVSDDPDDEANFWI----- 340

Query: 404 IPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWE--VAGFGYGF 461
           I  N+  + E       V+  ++ +L ++ T + L A +   P+S  +++  ++  G   
Sbjct: 341 IESNKGRNTEQTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSD 400

Query: 462 EVGDDMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEM 521
             GD  + W IE+  Q     + ++ P      +K+    C L     ++P WG R+ E+
Sbjct: 401 YQGDQDELWKIEI--QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEV 458

Query: 522 TC 523
            C
Sbjct: 459 LC 460

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 130/312 (41%), Gaps = 37/312 (11%)

Query: 230 SIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKV 289
           +  W+  +  L  +LG AIS K +G+     V +  V     L+   + +K   +Q  K 
Sbjct: 180 TTNWFANVITLSISLGLAISSKFIGIVTWAFVILSFVRQFDRLI---SDVKVTTIQIIKF 236

Query: 290 YGCHWIARIVCLI---IIPFLVFLTCFRIHFALLSHSGTGDAN----MPSLFQATLDGSD 342
                   I+CL+   IIP  +F+  +     LLS+  T        M + F++ L G  
Sbjct: 237 V-------ILCLLFVLIIPGSIFIISYS---NLLSNFKTDTPQFSKYMSTYFKSYLRGPQ 286

Query: 343 VGKGPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVT-GYAYNDDNNIWFFDR 401
           V   P  +  GS+ +++++       L SH  ++P   ++Q V   +     +N W  + 
Sbjct: 287 VQ--PSRLYYGST-ITLRHLDSMVGYLASHDISYPSDVDEQLVALSFEEFAADNEWLIEH 343

Query: 402 IRIPGNQPWSNETETD-IEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEV---AGF 457
             +  N  +S     D +  V  G   +L H+ST K L A     P+S+ D++       
Sbjct: 344 PTL--NLSFSEVYHADQLIPVEFGQSIKLRHKSTGKLLRASTAKPPISEQDYDFQISCTK 401

Query: 458 GYGFEVGDDMDNWIIEVIEQAGDEDK------SMIHPLTTTFHIKHAVLGCYLTQTLKQL 511
              +E G D + W + +I+   + DK        I PL +     +    C L     +L
Sbjct: 402 DSNYEGGMD-ERWDVLLIKDEINNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRL 460

Query: 512 PEWGFRQSEMTC 523
           PEWG  + E+ C
Sbjct: 461 PEWGRFEQEVLC 472

>Scas_710.0d
          Length = 271

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 63/166 (37%), Gaps = 10/166 (6%)

Query: 601 GLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTF 660
           G+   G +D  +  +LLG+    W  T  + + ++  +     WQ        DK +  F
Sbjct: 2   GISYWGEHDQHLGIYLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVG-KPVLQDKDVINF 60

Query: 661 MMGAFYPLLAWGLHFMPFVIMARVTYVHHXXXXXXXXXXXXXXXXEA----IIRRPKGTL 716
            +   + LL + +H  P  +M R  ++HH                +     ++RR K   
Sbjct: 61  HIQVIHYLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRKKN-- 118

Query: 717 AKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYRYLDWLSGW 762
                Y  L ++FA+    F   SPI +G +          W+S W
Sbjct: 119 ---FAYTLLAVFFALSYYFFKDHSPIIYGTEWTKDLCNKSKWVSSW 161

>Kwal_23.5281
          Length = 1621

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 550 DASFHYPKTNFFKDFLFLNRIMMATNN--ALVPDSDKYDSLASAAWQWPTLNVGLRL-CG 606
           +++ HY  ++FF      + ++  ++N  AL   S + DSL    WQ PT + G+ + C 
Sbjct: 655 ESTHHYSSSSFFT---MASSVIEQSSNCVALAESSSEVDSLKQTEWQRPTDDDGMLVNCI 711

Query: 607 WNDD 610
           +N D
Sbjct: 712 YNKD 715

>YOR104W (PIN2) [4908] chr15 (517642..518490) Protein of unknown
           function [849 bp, 282 aa]
          Length = 282

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 382 QQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHAD 441
           QQ  + Y  ND  N  F+D ++ P N+ +  E + D+E  +     +   +   K   + 
Sbjct: 119 QQPESAYYRNDAKNDTFYDEVKTPSNEVYELEEDFDLEKQKEKTRKKQ-QKERNKEGRSP 177

Query: 442 KIVAPV 447
             VAP+
Sbjct: 178 SRVAPL 183

>Scas_686.5
          Length = 928

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 19/108 (17%)

Query: 318 ALLSHSGTGDANMPSLFQATL----------DGSDVGKGPRDVALGSSFVSIKNQALGGA 367
           +LL +  T D+ +P+L   TL          D +   + P +  LG +F  + ++ +G  
Sbjct: 613 SLLPNGSTSDSQLPALSSVTLFAISFLSIQRDKTRSLRKPFNPLLGETFELVHDK-MGFR 671

Query: 368 LLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETE 415
           L+   V   PQ         +A++ D+  W FD I  P  + W    E
Sbjct: 672 LIAEKVSHKPQI--------FAFHADHEDWEFDYIVQPSQKFWGKSVE 711

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,299,741
Number of extensions: 1111232
Number of successful extensions: 3246
Number of sequences better than 10.0: 44
Number of HSP's gapped: 3077
Number of HSP's successfully gapped: 45
Length of query: 769
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 660
Effective length of database: 12,822,747
Effective search space: 8463013020
Effective search space used: 8463013020
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)