Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_640.2530630616300.0
Kwal_26.866929629410831e-149
KLLA0D07073g29730210781e-149
YOR222W (ODC2)30730810671e-147
YPL134C (ODC1)31031410191e-139
ACR109W29930510001e-137
CAGL0J04114g30330410001e-137
Scas_589.103162987861e-104
YPR021C (AGC1)9022893834e-41
YJR095W (SFC1)3223023594e-40
Sklu_2334.23193173584e-40
Sklu_2359.69022973685e-39
ADL049W9122963581e-37
CAGL0K02365g9192953526e-37
CAGL0M09020g3483143371e-36
Scas_691.43343173361e-36
AGL311C3623043362e-36
Scas_602.88852983463e-36
Kwal_47.173218812963439e-36
Kwal_47.182163333383273e-35
KLLA0F03212g3053023157e-34
KLLA0E13453g9062953262e-33
Scas_718.53243032703e-27
Sklu_2398.43093002668e-27
CAGL0K12210g3113212642e-26
Scas_582.73292822633e-26
Kwal_33.154463053142606e-26
Kwal_33.140503142902606e-26
Kwal_55.213353172932538e-25
YKR052C (MRS4)3042802501e-24
CAGL0L05742g3052812492e-24
CAGL0K08250g2972802474e-24
CAGL0D01606g3052992475e-24
YJL133W (MRS3)3142862458e-24
CAGL0L02079g2972942449e-24
KLLA0E02772g2842922431e-23
Sklu_1275.13113022432e-23
KLLA0F17864g3072992413e-23
Sklu_2075.33452972415e-23
Scas_489.42973102395e-23
KLLA0E09680g3072912396e-23
Kwal_23.43543433402407e-23
Sklu_1149.22962972378e-23
Scas_379.23012852371e-22
Scas_667.223062982371e-22
KLLA0B12826g3192902371e-22
YBR291C (CTP1)2993072342e-22
Sklu_2363.23233032335e-22
Sklu_2127.52782922315e-22
Kwal_26.79672972982316e-22
ACR260W3112792309e-22
KLLA0D15015g3173062301e-21
YBR104W (YMC2)3293142292e-21
CAGL0J01661g3273032283e-21
KLLA0E18810g3773122293e-21
YPR058W (YMC1)3073022246e-21
YEL006W3352962249e-21
YOR130C (ORT1)2922962221e-20
YPR011C3263102222e-20
CAGL0B03883g3062852212e-20
Kwal_26.76533252972222e-20
YKL120W (OAC1)3242952212e-20
YBR085W (AAC3)3073012203e-20
KLLA0B08503g3032882184e-20
AFR146W2812912166e-20
Scas_632.92922872167e-20
Scas_709.93653012188e-20
CAGL0K11616g3203012161e-19
AER184W3053022132e-19
YIL006W3732972162e-19
YNL003C (PET8)2843012122e-19
CAGL0F04213g3063122132e-19
Scas_718.243372972133e-19
Scas_667.43083082123e-19
YBL030C (PET9)3182892123e-19
KLLA0E15532g3262932124e-19
Kwal_56.230113032962105e-19
Sklu_1926.23052992097e-19
Scas_721.273743192118e-19
YGR257C (MTM1)3663692091e-18
AEL253W3653082092e-18
Kwal_27.125993042942062e-18
Scas_645.93912582092e-18
Scas_721.1293232952072e-18
Scas_714.183053142062e-18
AFR131C3443282063e-18
CAGL0K10362g3013182043e-18
KLLA0A09383g3663632063e-18
CAGL0J09790g3003002044e-18
Sklu_2442.82753032024e-18
Sklu_2431.53703222064e-18
Kwal_27.120813693132056e-18
ADL009W3793132048e-18
Kwal_33.129883032952001e-17
YMR056C (AAC1)3092942001e-17
KLLA0F13464g3002991964e-17
Kwal_0.2322743011955e-17
CAGL0J02002g3613021975e-17
Sklu_2430.103242971957e-17
CAGL0B04543g3173081958e-17
CAGL0F08305g3742571969e-17
Sklu_2117.22982931931e-16
Kwal_14.22103153001922e-16
Kwal_55.208683802981942e-16
CAGL0H03839g2822981912e-16
Kwal_27.124813042901912e-16
KLLA0E23705g3682991923e-16
Scas_562.123003041903e-16
YLR348C (DIC1)2982981894e-16
YDL198C (YHM1)3002821885e-16
ADL264C3292961887e-16
YMR166C3683171871e-15
Kwal_27.114192982431851e-15
Kwal_23.29133203081852e-15
KLLA0E12353g3052931824e-15
Kwal_23.39653073091815e-15
Scas_558.22893101797e-15
AAL014C2712971797e-15
Scas_662.123083061791e-14
Sklu_1119.13072301781e-14
AGL047C3163001781e-14
YBR192W (RIM2)3773281801e-14
CAGL0F00231g3072291771e-14
Kwal_33.155973052301772e-14
KLLA0C13431g3283131772e-14
CAGL0F07711g3682461782e-14
Kwal_27.116262992811743e-14
CAGL0G08910g2893001735e-14
KLLA0D14036g4313171756e-14
CAGL0G01166g2951591726e-14
KLLA0D09889g3642871747e-14
CAGL0J05522g5193151757e-14
YGR096W (TPC1)3142831728e-14
Scas_715.453052651719e-14
YJR077C (MIR1)3112301711e-13
Sklu_2432.52882891692e-13
CAGL0D04774g3222991692e-13
Scas_697.473283031692e-13
YOR100C (CRC1)3273031692e-13
Sklu_2115.42992811682e-13
YIL134W (FLX1)3111921683e-13
AGR383W2932831673e-13
Sklu_2037.23103071657e-13
Kwal_23.35293952931668e-13
AFL196W3612931622e-12
KLLA0D04950g2743041602e-12
AGR191W2982991603e-12
CAGL0M05225g3813261613e-12
Kwal_23.47313143111603e-12
Scas_673.173142301595e-12
ABL023W3092801585e-12
Scas_716.293163051561e-11
Scas_669.63732331571e-11
AER450C3081801551e-11
CAGL0C02013g3293321551e-11
Scas_687.15*3283301552e-11
Kwal_23.30425423101534e-11
Scas_702.103021651497e-11
Kwal_23.57573072631498e-11
YPR128C (ANT1)3282941499e-11
KLLA0E18788g3812061491e-10
CAGL0H10538g2972851471e-10
YNL083W5453101472e-10
AGL065C3353131436e-10
KLLA0B14454g3051761426e-10
CAGL0G03135g3073011401e-09
KLLA0F04697g3071871391e-09
KLLA0D04290g1881791352e-09
Sklu_2433.84203261402e-09
KLLA0C11363g5173151402e-09
Sklu_2127.43231761373e-09
AER419W4932581384e-09
Sklu_2374.75133191375e-09
AGL064W2962831346e-09
Sklu_2194.33123091347e-09
AAR036W3172991339e-09
Kwal_26.79723582081349e-09
Kwal_47.192282811511339e-09
YER053C3002781339e-09
KLLA0E08877g2942871339e-09
AFR542W3102991331e-08
AER366W2931841321e-08
CAGL0K02915g3421921322e-08
YHR002W (LEU5)3571861312e-08
KLLA0A00979g3433451303e-08
YMR241W (YHM2)3143211275e-08
YDL119C3072901267e-08
AFR253W3443271268e-08
YFR045W2852061241e-07
Scas_578.3*5243061251e-07
AFR147C3152481232e-07
Kwal_55.213383232651213e-07
Scas_717.203561261161e-06
Scas_328.1227661142e-06
KLLA0D04312g103811072e-06
Kwal_55.211063282951143e-06
CAGL0K07436g3073161133e-06
Scas_613.241771631079e-06
Scas_705.93231851091e-05
KLLA0F08547g3083171062e-05
Sklu_2260.53021541062e-05
KLLA0E02750g3041621036e-05
ADR036C3403031001e-04
Scas_696.93122921002e-04
Kwal_34.15907312311982e-04
AEL060C42980930.001
Sklu_2435.2344321870.005
KLLA0B11319g355150850.012
KLLA0E22880g43689750.22
Scas_671.1*12375680.49
Kwal_14.257444355644.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_640.25
         (306 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_640.25                                                           632   0.0  
Kwal_26.8669                                                          421   e-149
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   419   e-149
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   415   e-147
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   397   e-139
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   389   e-137
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   389   e-137
Scas_589.10                                                           307   e-104
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   152   4e-41
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   142   4e-40
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        142   4e-40
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         146   5e-39
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   142   1e-37
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   140   6e-37
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   134   1e-36
Scas_691.4                                                            134   1e-36
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   134   2e-36
Scas_602.8                                                            137   3e-36
Kwal_47.17321                                                         136   9e-36
Kwal_47.18216                                                         130   3e-35
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   125   7e-34
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   130   2e-33
Scas_718.5                                                            108   3e-27
Sklu_2398.4 , Contig c2398 9476-10405                                 107   8e-27
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   106   2e-26
Scas_582.7                                                            105   3e-26
Kwal_33.15446                                                         104   6e-26
Kwal_33.14050                                                         104   6e-26
Kwal_55.21335                                                         102   8e-25
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...   100   1e-24
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...   100   2e-24
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...   100   4e-24
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   100   5e-24
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    99   8e-24
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    99   9e-24
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    98   1e-23
Sklu_1275.1 , Contig c1275 314-1249                                    98   2e-23
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    97   3e-23
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                97   5e-23
Scas_489.4                                                             97   5e-23
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    97   6e-23
Kwal_23.4354                                                           97   7e-23
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         96   8e-23
Scas_379.2                                                             96   1e-22
Scas_667.22                                                            96   1e-22
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    96   1e-22
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    95   2e-22
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          94   5e-22
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         94   5e-22
Kwal_26.7967                                                           94   6e-22
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    93   9e-22
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    93   1e-21
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    93   2e-21
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    92   3e-21
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    93   3e-21
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    91   6e-21
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    91   9e-21
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    90   1e-20
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    90   2e-20
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    90   2e-20
Kwal_26.7653                                                           90   2e-20
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    90   2e-20
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    89   3e-20
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    89   4e-20
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    88   6e-20
Scas_632.9                                                             88   7e-20
Scas_709.9                                                             89   8e-20
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    88   1e-19
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    87   2e-19
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    88   2e-19
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    86   2e-19
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    87   2e-19
Scas_718.24                                                            87   3e-19
Scas_667.4                                                             86   3e-19
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    86   3e-19
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    86   4e-19
Kwal_56.23011                                                          86   5e-19
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          85   7e-19
Scas_721.27                                                            86   8e-19
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    85   1e-18
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    85   2e-18
Kwal_27.12599                                                          84   2e-18
Scas_645.9                                                             85   2e-18
Scas_721.129                                                           84   2e-18
Scas_714.18                                                            84   2e-18
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    84   3e-18
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    83   3e-18
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    84   3e-18
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    83   4e-18
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          82   4e-18
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            84   4e-18
Kwal_27.12081                                                          84   6e-18
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    83   8e-18
Kwal_33.12988                                                          82   1e-17
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    82   1e-17
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    80   4e-17
Kwal_0.232                                                             80   5e-17
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    80   5e-17
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         80   7e-17
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    80   8e-17
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    80   9e-17
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            79   1e-16
Kwal_14.2210                                                           79   2e-16
Kwal_55.20868                                                          79   2e-16
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    78   2e-16
Kwal_27.12481                                                          78   2e-16
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    79   3e-16
Scas_562.12                                                            78   3e-16
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    77   4e-16
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    77   5e-16
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    77   7e-16
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    77   1e-15
Kwal_27.11419                                                          76   1e-15
Kwal_23.2913                                                           76   2e-15
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    75   4e-15
Kwal_23.3965                                                           74   5e-15
Scas_558.2                                                             74   7e-15
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    74   7e-15
Scas_662.12                                                            74   1e-14
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             73   1e-14
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    73   1e-14
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    74   1e-14
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    73   1e-14
Kwal_33.15597                                                          73   2e-14
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    73   2e-14
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    73   2e-14
Kwal_27.11626                                                          72   3e-14
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    71   5e-14
KLLA0D14036g complement(1203522..1204817) some similarities with...    72   6e-14
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    71   6e-14
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    72   7e-14
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    72   7e-14
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    71   8e-14
Scas_715.45                                                            70   9e-14
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    70   1e-13
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       70   2e-13
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    70   2e-13
Scas_697.47                                                            70   2e-13
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    70   2e-13
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            69   2e-13
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    69   3e-13
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    69   3e-13
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         68   7e-13
Kwal_23.3529                                                           69   8e-13
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    67   2e-12
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    66   2e-12
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    66   3e-12
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    67   3e-12
Kwal_23.4731                                                           66   3e-12
Scas_673.17                                                            66   5e-12
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    65   5e-12
Scas_716.29                                                            65   1e-11
Scas_669.6                                                             65   1e-11
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    64   1e-11
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    64   1e-11
Scas_687.15*                                                           64   2e-11
Kwal_23.3042                                                           64   4e-11
Scas_702.10                                                            62   7e-11
Kwal_23.5757                                                           62   8e-11
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    62   9e-11
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    62   1e-10
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    61   1e-10
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    61   2e-10
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    60   6e-10
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    59   6e-10
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    59   1e-09
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    58   1e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    57   2e-09
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       59   2e-09
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    59   2e-09
Sklu_2127.4 , Contig c2127 6322-7293                                   57   3e-09
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    58   4e-09
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       57   5e-09
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    56   6e-09
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            56   7e-09
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    56   9e-09
Kwal_26.7972                                                           56   9e-09
Kwal_47.19228                                                          56   9e-09
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    56   9e-09
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    56   9e-09
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    56   1e-08
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    55   1e-08
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    55   2e-08
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    55   2e-08
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    55   3e-08
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    54   5e-08
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    53   7e-08
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    53   8e-08
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    52   1e-07
Scas_578.3*                                                            53   1e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    52   2e-07
Kwal_55.21338                                                          51   3e-07
Scas_717.20                                                            49   1e-06
Scas_328.1                                                             49   2e-06
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    46   2e-06
Kwal_55.21106                                                          49   3e-06
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    48   3e-06
Scas_613.24                                                            46   9e-06
Scas_705.9                                                             47   1e-05
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    45   2e-05
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         45   2e-05
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    44   6e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    43   1e-04
Scas_696.9                                                             43   2e-04
Kwal_34.15907                                                          42   2e-04
AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, ...    40   0.001
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         38   0.005
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    37   0.012
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    33   0.22 
Scas_671.1*                                                            31   0.49 
Kwal_14.2574                                                           29   4.9  

>Scas_640.25
          Length = 306

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV
Sbjct: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV
Sbjct: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120

Query: 121 LSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180
           LSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR
Sbjct: 121 LSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180

Query: 181 NAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD 240
           NAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD
Sbjct: 181 NAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD 240

Query: 241 GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
           GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR
Sbjct: 241 GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300

Query: 301 EFHEGR 306
           EFHEGR
Sbjct: 301 EFHEGR 306

>Kwal_26.8669
          Length = 296

 Score =  421 bits (1083), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 199/294 (67%), Positives = 238/294 (80%), Gaps = 5/294 (1%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PLPF YQF AGA+AGISE++VMYPLDVVKTRMQLQVS    G     YKGV+DC+ QIV 
Sbjct: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS----GGLGPQYKGVVDCIKQIVA 61

Query: 70  KEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGIT 129
           KEG   +YKGISSP+LMEAPKRA KFA NDEF K++K  FG ++LTQ +S+LSGASAG  
Sbjct: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121

Query: 130 EALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
           EA V+VPFELVKIRLQDV+S +KGP++V++ II Q+G+  +Y+G+EST+WR+ VWNAGYF
Sbjct: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249
           G+IFQVR LLP AKSK ++TRNDL AG +GGT G + +TPFDVVKSRIQ+    +  G R
Sbjct: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA-VVAGGAR 240

Query: 250 KYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303
           KYNW+WPS+  IY EEGFRALYKGFVPKVLRLGPGG +LLVVFT  M+ FR  H
Sbjct: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTLH 294

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  419 bits (1078), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 198/302 (65%), Positives = 245/302 (81%), Gaps = 7/302 (2%)

Query: 6   NTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLS 65
           + Q PLPF YQFMAGA+AG+SE++VMYPLD+VKT MQLQVS    G S   YKGV DCL 
Sbjct: 2   SDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVS----GGSGPQYKGVFDCLK 57

Query: 66  QIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGAS 125
           QI  KEGP  +YKGISSP+LMEAPKRA KFA NDEF K++K +FG ++LTQ +S+LSGAS
Sbjct: 58  QIAAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGAS 117

Query: 126 AGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           AGI E+ V+VPFELVKIRLQDV+SKF  P+ V+K+I++++G+  +Y+G+EST+WR+ +WN
Sbjct: 118 AGICESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177

Query: 186 AGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEII 245
           AGYFG+IFQVR LLP A +K E+TRNDL AG VGGT   + +TPFDVVKSR+Q+    +I
Sbjct: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQN--TAVI 235

Query: 246 NGV-RKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304
            GV RKYNW+WP++  IY EEGF+ALYKGFVPKVLRLGPGG +LLVVFT VM+ FR  HE
Sbjct: 236 PGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTVHE 295

Query: 305 GR 306
            +
Sbjct: 296 KK 297

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  415 bits (1067), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 198/308 (64%), Positives = 245/308 (79%), Gaps = 5/308 (1%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVST---GAAGASATHY 57
           MSS+ N + PLPF YQF++GA+AGISEL VMYPLDVVKTR QL+V+T    A G     Y
Sbjct: 1   MSSDSNAK-PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERY 59

Query: 58  KGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ 117
            GVIDCL +IVKKEG   +Y+GISSPMLMEAPKRA KFA ND++ K++K++F T + TQ+
Sbjct: 60  NGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK 119

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST 177
           IS+ +GASAG+TEA VIVPFEL+KIR+QDV S + GP++ LK  IK +G+ GLY G+EST
Sbjct: 120 ISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIEST 179

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
           +WRNA+WN GYFGVI+QVR  +PVAK+K +KTRNDL AG +GGT G M NTPFDVVKSRI
Sbjct: 180 MWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRI 239

Query: 238 QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMN 297
           QS  + + + V+KYNW  PS++ IY EEGFRALYKGFVPKV RL PGG+++LVVFT +MN
Sbjct: 240 QSV-DAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMN 298

Query: 298 VFREFHEG 305
            FR+   G
Sbjct: 299 FFRDLKYG 306

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  397 bits (1019), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/314 (61%), Positives = 244/314 (77%), Gaps = 14/314 (4%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGA------AGASA 54
           M+S  N   PLPF YQF AGAIAG+SEL+VMYPLDVVKTRMQLQV+T        A A+ 
Sbjct: 1   MTSIDNR--PLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAV 58

Query: 55  THYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK-- 112
            HY GV+DCL++IVKKEG  H+YKGI+SP+LMEAPKRA+KF+ ND F   +K +F T   
Sbjct: 59  DHYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNG 118

Query: 113 QLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYS 172
           ++TQ+I++ SGASAG  EA V+ PFELVKIRLQDVNS+FK P+EV+K+ + + G+  L++
Sbjct: 119 EMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFN 178

Query: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232
           G+E+T+WR+ +WNAGYFG+IFQ+R+LLP AK+  EKTRNDL AG +GGT G + NTPFDV
Sbjct: 179 GLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDV 238

Query: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           VKSRIQ     +    RKYNW+ PSV+ +Y EEGF+ALYKGF PKV+RL PGG +LLVVF
Sbjct: 239 VKSRIQRSSGPL----RKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVF 294

Query: 293 TNVMNVFREFHEGR 306
           TNVM+ FRE   G+
Sbjct: 295 TNVMDFFREVKYGK 308

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  389 bits (1000), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 187/305 (61%), Positives = 238/305 (78%), Gaps = 8/305 (2%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           S+ +T++ LPF YQF AGA+AG+SE++VMYPLDVVKTRMQLQV  GA      HY GV+D
Sbjct: 2   SSSDTKS-LPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAG----PHYTGVVD 56

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS 122
           CL +IV  EG   +YKGISSP+LMEAPKRA KFA NDEF KL+K  FG ++L+Q +S+L+
Sbjct: 57  CLKKIVAGEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLA 116

Query: 123 GASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNA 182
           GASAG  EA V+VPFELVKIRLQD +S +KGPV+V++ I+ ++G+  +Y+G+EST+WR+A
Sbjct: 117 GASAGCVEAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHA 176

Query: 183 VWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
           +WN GYFG+IFQ R LLP A +K +   NDL +  +G + G M +TPFDVVKSRIQ+   
Sbjct: 177 LWNGGYFGIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQN--T 234

Query: 243 EIING-VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
            +I G VRKYNW+ PS++ IY EEGFRALYKGFVPKVLRLGPGG +LLVVFT V++  R 
Sbjct: 235 AVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRA 294

Query: 302 FHEGR 306
            H G+
Sbjct: 295 IHYGK 299

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  389 bits (1000), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/304 (63%), Positives = 231/304 (75%), Gaps = 6/304 (1%)

Query: 7   TQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQ 66
           ++ PLPF YQF++GA AG+SEL+VMYPLDVVKTRMQLQV +G    S   Y GVIDCL Q
Sbjct: 2   SEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTG--SGVAYNGVIDCLGQ 59

Query: 67  IVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASA 126
           IVK+EG   +YKGISSPMLMEAPKRA KFA ND + K++K ++G  +LTQQIS+LSG+ A
Sbjct: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLA 119

Query: 127 GITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
           G+TEA VIVPFELVKIRLQDVNSKF GP+EV+   I++ G+  LY+G+EST+WRNA WN 
Sbjct: 120 GVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNG 179

Query: 187 GYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMF-NTPFDVVKSRIQSDGNEII 245
           GYFGVIFQ+R LLP AK+  EKT NDL AG +GG       +T   VVKSRIQS     +
Sbjct: 180 GYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTL 239

Query: 246 NG---VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREF 302
                V KYNWTWPS+ KIY EEGF ALYKGF+PK+LRLGPGG ++LVVF  +M  F+E 
Sbjct: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299

Query: 303 HEGR 306
             G+
Sbjct: 300 KYGK 303

>Scas_589.10
          Length = 316

 Score =  307 bits (786), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 146/298 (48%), Positives = 205/298 (68%), Gaps = 10/298 (3%)

Query: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASAT------HYKGVIDCL 64
           LPF YQF++GA+AG+SE ++MYPLDVVKTR QLQ++  A   S+        +  ++ CL
Sbjct: 11  LPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCL 70

Query: 65  SQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGA 124
           S+I+K+EG  ++YKG+S P+LME PKRAVKFASN++F ++    F  K++T  +++L+G 
Sbjct: 71  SKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTLLAGT 130

Query: 125 SAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVW 184
            AGITE+L++VPFELVKIRLQD  S ++ P+   + II+  GL G+Y+G EST+WRN +W
Sbjct: 131 FAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWRNTIW 190

Query: 185 NAGYFGVIFQVRELLPVAKS--KQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
           NA YFG+IFQV++ +P AKS  K +  RND   G + G      + PFDVVK+R+Q  G+
Sbjct: 191 NASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ--GS 248

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
           +  +    Y W W SV  IY  EG + +YKG +P + R GPGG +LLVVF  V  +FR
Sbjct: 249 KKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELFR 306

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  152 bits (383), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 149/289 (51%), Gaps = 24/289 (8%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           Y F  G+IAG     V+YP+D +KTRMQ Q        S   YK  IDCL +I+ +EG  
Sbjct: 532 YNFSLGSIAGCIGATVVYPIDFIKTRMQAQ-------RSLAQYKNSIDCLLKIISREGIK 584

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND          G   L  +I  +SGASAG  + +  
Sbjct: 585 GLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEI--ISGASAGACQVIFT 642

Query: 135 VPFELVKIRLQDVNSKFKGP-----VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            P E+VKIRLQ V S + G       E    I+K+ GL+GLY+GV + + R+  ++A YF
Sbjct: 643 NPLEIVKIRLQ-VQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYF 701

Query: 190 GVIFQVRELL----PVAKSKQE--KTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
                +++ L    P  K+K+   KT   L AG + G       TPFDV+K+R+Q D  +
Sbjct: 702 PTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRK 761

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
              G  KYN  + ++  I  EE FR+ +KG   +VLR  P     L  +
Sbjct: 762 ---GETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAY 807

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           AGAIAG+    +  P DV+KTR+Q+    G      T Y G+   +  I+K+E     +K
Sbjct: 733 AGAIAGMPAAFLTTPFDVIKTRLQIDPRKGE-----TKYNGIFHAIRTILKEESFRSFFK 787

Query: 79  GISSPMLMEAPKRAVKFASNDEF 101
           G  + +L  +P+     A+ + F
Sbjct: 788 GGGARVLRSSPQFGFTLAAYELF 810

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  142 bits (359), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 153/302 (50%), Gaps = 38/302 (12%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
            MAG  AG+ E +  +PLD +K RMQ  +    AG       G I     I +KEG + +
Sbjct: 14  LMAGGTAGLFEALCCHPLDTIKVRMQ--IYRRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ---LTQQISVLSGASAGITEALV 133
           YKG+ + ++   PK A++F+S +     ++++   K+   ++   + ++G  AGITEA++
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYE----FYRTLLVNKESGIVSTGNTFVAGVGAGITEAVL 127

Query: 134 IV-PFELVKIRLQ---------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           +V P E+VKIRLQ         +   K+   +     I+K++G+  LY GV  T  R A 
Sbjct: 128 VVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQAT 187

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDL-------CAGFVGGTFGVMFNTPFDVVKSR 236
                F V  +++E L      Q   + D+       C G + G  G   N P D +K+R
Sbjct: 188 NQGANFTVYSKLKEFL------QNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTR 241

Query: 237 IQSDGN---EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFT 293
           +Q D +   E  +G++K       ++K   EEGFRALYKG  P+V+R+ PG AV   V+ 
Sbjct: 242 LQKDKSISLEKQSGMKKIITIGAQLLK---EEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

Query: 294 NV 295
            V
Sbjct: 299 YV 300

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 91/195 (46%), Gaps = 16/195 (8%)

Query: 17  FMAGAIAGISE-LMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
           F+AG  AGI+E ++V+ P++VVK R+Q Q  T +   +   Y   I     IVK+EG   
Sbjct: 114 FVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSA 173

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQL----TQQISVLSGASAGITEA 131
           +Y+G+S     +A  +   F    +  +  ++      L    T  I ++SGA    + A
Sbjct: 174 LYRGVSLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNA 233

Query: 132 LVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVW 184
               P + +K RLQ       +  S  K  + +   ++K++G + LY G+   V R A  
Sbjct: 234 ----PLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPG 289

Query: 185 NAGYFGVIFQVRELL 199
            A  F V   VRE L
Sbjct: 290 QAVTFTVYEYVREHL 304

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 84/197 (42%), Gaps = 10/197 (5%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNS-------KFKGPVEVLKHIIKQDGLKGL 170
           I++++G +AG+ EAL   P + +K+R+Q           K  G ++  + I +++G   L
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLAL 71

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTP 229
           Y G+ + V       A  F      R LL   +S    T N   AG   G T  V+   P
Sbjct: 72  YKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNP 131

Query: 230 FDVVKSRIQSD--GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            +VVK R+Q+        N   KYN    +   I  EEG  ALY+G      R       
Sbjct: 132 MEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGA 191

Query: 288 LLVVFTNVMNVFREFHE 304
              V++ +    + +H+
Sbjct: 192 NFTVYSKLKEFLQNYHQ 208

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 8/89 (8%)

Query: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK-- 260
           K K      +L AG   G F  +   P D +K R+Q      + G+   +   P  +K  
Sbjct: 4   KKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQI--YRRVAGIE--HVKPPGFIKTG 59

Query: 261 --IYHEEGFRALYKGFVPKVLRLGPGGAV 287
             IY +EGF ALYKG    V+ + P  A+
Sbjct: 60  RTIYQKEGFLALYKGLGAVVIGIIPKMAI 88

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  142 bits (358), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 154/317 (48%), Gaps = 49/317 (15%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MSS   +  P       +AG  AG+ E +  +PLD +K RMQ+   +   G       G 
Sbjct: 1   MSSKKKSSNPA---VNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKP---PGF 54

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           I     I  +EG + +YKG+ + ++   PK A++F+S +     ++S    KQ T  +S 
Sbjct: 55  IKTGRNIYTEEGLLALYKGLGAVVIGIIPKMAIRFSSYE----FYRSALADKQ-TGSVST 109

Query: 121 ----LSGASAGITEALVIV-PFELVKIRLQD--------VNSKFKGPVEVLKHIIKQDGL 167
               L+G  AG TEA+++V P E+VKIRLQ          + +++  ++    I+K++G+
Sbjct: 110 GNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGI 169

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL-------CAGFVGG 220
             LY GV  T  R A      F V  +++E L      QE  + D        C G + G
Sbjct: 170 GALYRGVSLTAARQATNQGANFTVYSKLKEFL------QEHHKTDALPSWETSCIGLISG 223

Query: 221 TFGVMFNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKI----YHEEGFRALYKGFV 275
             G   N P D +K+R+Q D +   ++G       W  ++ I      EEGFRALYKG  
Sbjct: 224 AIGPFSNAPLDTIKTRLQKDKSTANMSG-------WSRIVTIGKQLIKEEGFRALYKGIT 276

Query: 276 PKVLRLGPGGAVLLVVF 292
           P+V+R+ PG AV   V+
Sbjct: 277 PRVMRVAPGQAVTFTVY 293

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 91/193 (47%), Gaps = 15/193 (7%)

Query: 17  FMAGAIAGISE-LMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
           F+AG  AG +E ++V+ P++VVK R+Q Q       A++  Y+  +     IVK+EG   
Sbjct: 113 FLAGVGAGTTEAVLVVNPMEVVKIRLQAQ-HLHPETAASPRYRNALQACYLIVKEEGIGA 171

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQL----TQQISVLSGASAGITEA 131
           +Y+G+S     +A  +   F    +  +  +    T  L    T  I ++SGA    + A
Sbjct: 172 LYRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNA 231

Query: 132 LVIVPFELVKIRLQDVNSK-----FKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
               P + +K RLQ   S      +   V + K +IK++G + LY G+   V R A   A
Sbjct: 232 ----PLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQA 287

Query: 187 GYFGVIFQVRELL 199
             F V   VRE L
Sbjct: 288 VTFTVYEFVREHL 300

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 83/195 (42%), Gaps = 8/195 (4%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNS------KFKGPVEVLKHIIKQDGLKGLY 171
           +++++G +AG+ EAL   P + +K+R+Q          K  G ++  ++I  ++GL  LY
Sbjct: 12  VNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALY 71

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGF-VGGTFGVMFNTPF 230
            G+ + V       A  F      R  L   ++    T N   AG   G T  V+   P 
Sbjct: 72  KGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNPM 131

Query: 231 DVVKSRIQSDG-NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289
           +VVK R+Q+   +       +Y     +   I  EEG  ALY+G      R         
Sbjct: 132 EVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANF 191

Query: 290 VVFTNVMNVFREFHE 304
            V++ +    +E H+
Sbjct: 192 TVYSKLKEFLQEHHK 206

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  146 bits (368), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 100/297 (33%), Positives = 154/297 (51%), Gaps = 27/297 (9%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           Y F  G+IAG     V+YP+D+VKTRMQ Q        S + YK  IDC ++I  +EG  
Sbjct: 520 YNFTLGSIAGCIGATVVYPIDLVKTRMQAQ-------RSFSQYKNSIDCFAKIFSREGIR 572

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND +++  + +     L     +LSGA AG  + +  
Sbjct: 573 GIYSGLGPQLIGVAPEKAIKLTVND-YMR-GRLMDKHANLKWYFEILSGACAGACQVVFT 630

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKH------IIKQDGLKGLYSGVESTVWRNAVWNAGY 188
            P E+VKIRLQ V S++ G  +VLK       +IKQ G+KGLY G+ + + R+  ++A Y
Sbjct: 631 NPLEVVKIRLQ-VRSEYAG--DVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIY 687

Query: 189 FGVIFQVRELLPVAKSKQEKTRND------LCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
           F     +++ +     K +K RN       L AG + G       TPFDV+K+R+Q D  
Sbjct: 688 FPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPR 747

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           +   G  +Y   + +   I  EE F++ +KG   +VLR  P     L  +    N+F
Sbjct: 748 K---GETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQNMF 801

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 123/249 (49%), Gaps = 27/249 (10%)

Query: 6   NTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLS 65
           +  A L + ++ ++GA AG  +++   PL+VVK R  LQV +  AG      K  +  L 
Sbjct: 605 DKHANLKWYFEILSGACAGACQVVFTNPLEVVKIR--LQVRSEYAGDVL---KSQVTALG 659

Query: 66  QIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-----GTKQLTQQIS- 119
            ++K+ G   +YKGI++ ++ + P  A+ F +   +  L K VF       KQ  +  + 
Sbjct: 660 -VIKQLGIKGLYKGIAACLMRDVPFSAIYFPT---YAHLKKDVFKYDPKDKKQRNKLKTW 715

Query: 120 --VLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSG 173
             +++G  AG+  A +  PF+++K RLQ       ++++G     + I+K++  K  + G
Sbjct: 716 ELLVAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKG 775

Query: 174 VESTVWRNAVWNAGYFGVIFQV-RELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232
             + V R++    G+    +++ + + P+ + +   T++D  A  V  +F   F +  D 
Sbjct: 776 GSARVLRSSP-QFGFTLAAYEIFQNMFPLKREESTFTKDDTPA--VTSSFTAFFKSLKD- 831

Query: 233 VKSRIQSDG 241
             SR  S+ 
Sbjct: 832 -SSRTASEN 839

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  142 bits (358), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 145/296 (48%), Gaps = 25/296 (8%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           Y F  G++AG    MV+YP+D+VKTRMQ Q          + YK  IDCL +I+ KEG  
Sbjct: 526 YNFTLGSVAGCIGAMVVYPIDMVKTRMQAQ-------RDFSKYKNSIDCLLKILSKEGVR 578

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND          G  +L+    ++SGA+AG  + +  
Sbjct: 579 GLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDG--KLSLPCEIISGATAGACQVVFT 636

Query: 135 VPFELVKIRLQDVNSKF-----KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            P E+VKIRLQ V S +     +  V  +  +IK  GL GLY G  + + R+  ++A YF
Sbjct: 637 NPLEIVKIRLQ-VKSDYVADAARNSVNAIS-VIKNLGLIGLYRGAGACLLRDIPFSAIYF 694

Query: 190 GVIFQVRELLPVAKSKQEKTRND------LCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
                ++  +     K    RN       L +G + G       TPFDV+K+R+Q D  +
Sbjct: 695 PTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDPKK 754

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
              G   YN  W +   I  EEG ++ +KG   +VLR  P     L  +    N+F
Sbjct: 755 ---GESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLF 807

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  140 bits (352), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 142/295 (48%), Gaps = 22/295 (7%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           Y F  G++AG     ++YP+D VKTRMQ Q        S + YK  IDC  +I+ +EG  
Sbjct: 545 YNFSLGSVAGCIGATIVYPIDFVKTRMQAQ-------RSLSQYKNSIDCFLKILSREGIR 597

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND      K   G   L  +I  +SGASAG  + +  
Sbjct: 598 GVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNGKLGLLSEI--ISGASAGACQVIFT 655

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLK----HIIKQDGLKGLYSGVESTVWRNAVWNAGYFG 190
            P E+VKIRLQ          E  K     IIK+ GL GLY G  + + R+  ++A YF 
Sbjct: 656 NPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFP 715

Query: 191 VIFQVRELL----PVAKSKQEK--TRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEI 244
               ++  L    P  K+K+ +  T   L AG + G       TPFDV+K+R+Q D  + 
Sbjct: 716 TYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKK- 774

Query: 245 INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
             G   Y     +   I  EE F++ +KG   +VLR  P     L  +    N+F
Sbjct: 775 --GETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAYELFHNIF 827

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 216 GFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFV 275
           G V G  G     P D VK+R+Q+        + +Y  +    +KI   EG R +Y G  
Sbjct: 550 GSVAGCIGATIVYPIDFVKTRMQAQ-----RSLSQYKNSIDCFLKILSREGIRGVYSGLG 604

Query: 276 PKVLRLGPGGAVLLVVFTNVMNVFRE 301
           P+++ + P  A+ L V   + N  ++
Sbjct: 605 PQLIGVAPEKAIKLTVNDYMRNKLKD 630

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  134 bits (337), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 145/314 (46%), Gaps = 42/314 (13%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQL------------------------QVSTGAAGA 52
            +AG  AG+ E +  +PLD +K RMQ+                            G    
Sbjct: 15  LVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDAT 74

Query: 53  SATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
           +A    G I     I  +EG + +YKG+ + ++   PK A++F+S +     ++++   K
Sbjct: 75  AAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE----FYRTLLADK 130

Query: 113 Q---LTQQISVLSGASAGITEALVIV-PFELVKIRLQD---------VNSKFKGPVEVLK 159
           Q   ++   + ++G  AG+TEA+++V P E+VKIRLQ             K+   V+   
Sbjct: 131 QTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGY 190

Query: 160 HIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-KTRNDLCAGFV 218
            IIK++G+  LY GV  T  R A      F V  ++RE L      +   +    C G +
Sbjct: 191 TIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLI 250

Query: 219 GGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
            G  G   N P D +K+R+Q D +    G   +        ++  EEGFRALYKG  P+V
Sbjct: 251 SGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRV 310

Query: 279 LRLGPGGAVLLVVF 292
           +R+ PG AV   V+
Sbjct: 311 MRVAPGQAVTFTVY 324

 Score = 72.0 bits (175), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 92/195 (47%), Gaps = 16/195 (8%)

Query: 17  FMAGAIAGISE-LMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
           F+AG  AG++E ++V+ P++VVK R+Q Q        +   Y   +     I+K+EG   
Sbjct: 141 FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISA 200

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQL----TQQISVLSGASAGITEA 131
           +Y+G+S     +A  +   F    +  +  +   GT+ L    T  I ++SGA    + A
Sbjct: 201 LYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNA 260

Query: 132 LVIVPFELVKIRLQ-DVNSKFKGP------VEVLKHIIKQDGLKGLYSGVESTVWRNAVW 184
               P + +K RLQ D ++ FKG         +   ++K++G + LY G+   V R A  
Sbjct: 261 ----PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPG 316

Query: 185 NAGYFGVIFQVRELL 199
            A  F V   VR  L
Sbjct: 317 QAVTFTVYEFVRRHL 331

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 86/222 (38%), Gaps = 36/222 (16%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQ-------------------------------D 146
           +++++G +AG+ EAL   P + +K+R+Q                               D
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 147 VNSKFKGP--VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKS 204
             +  K P  +   ++I  Q+G   LY G+ + V       A  F      R LL   ++
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 205 KQEKTRNDLCAGFVGG-TFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWP--SVMKI 261
               T N   AG   G T  V+   P +VVK R+Q+      + + K  +T    +   I
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 262 YHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303
             EEG  ALY+G      R          V++ +    +E+H
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYH 234

>Scas_691.4
          Length = 334

 Score =  134 bits (336), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/317 (29%), Positives = 145/317 (45%), Gaps = 43/317 (13%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N    +PL      +AG  AG+ E +  +PLD +K RMQ+   T           G I  
Sbjct: 7   NDKKSSPL---INLVAGGTAGLFEALCCHPLDTIKVRMQIAKRT-----EGMRPHGFITT 58

Query: 64  LSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSG 123
              I   EG + +YKG+ + ++   PK A++F+S  EF +   +   T+ +T   + L+G
Sbjct: 59  GRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSSY-EFYRNALTDKETRTITTGNTFLAG 117

Query: 124 ASAGITEALVIV-PFELVKIRLQD----------------------VNSKFKGPVEVLKH 160
             AGITEA+++V P E+VKIRLQ                          K+   +     
Sbjct: 118 VGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYT 177

Query: 161 IIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-KTRNDLCAGFVG 219
           I+K++G   LY GV  T  R A      F V   +++ L    +++   +    C G + 
Sbjct: 178 IVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLIS 237

Query: 220 GTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSV----MKIYHEEGFRALYKGFV 275
           G  G   N P D +K+R+Q D +         N  W  +     ++  EEGFRALYKG  
Sbjct: 238 GAIGPFSNAPLDTIKTRLQKDKS------ISSNSAWKKIYIIGTQLIKEEGFRALYKGIT 291

Query: 276 PKVLRLGPGGAVLLVVF 292
           P+V+R+ PG AV   V+
Sbjct: 292 PRVMRVAPGQAVTFTVY 308

 Score = 68.6 bits (166), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 94/214 (43%), Gaps = 43/214 (20%)

Query: 17  FMAGAIAGISE-LMVMYPLDVVKTRMQLQ---------VSTGAAGASAT----HYKGVID 62
           F+AG  AGI+E ++V+ P++VVK R+Q Q             AAG +AT     Y   I 
Sbjct: 114 FLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIH 173

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFA------------SNDEFIKLWKSVFG 110
               IVK+EG   +Y+G+S     +A  +   F              N E +  W+    
Sbjct: 174 AAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWE---- 229

Query: 111 TKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ-----DVNSKFKGPVEVLKHIIKQD 165
               T  I ++SGA    + A    P + +K RLQ       NS +K    +   +IK++
Sbjct: 230 ----TSCIGLISGAIGPFSNA----PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEE 281

Query: 166 GLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           G + LY G+   V R A   A  F V   VR+ L
Sbjct: 282 GFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 90/212 (42%), Gaps = 20/212 (9%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNS----KFKGPVEVLKHIIKQDGL 167
           K+ +  I++++G +AG+ EAL   P + +K+R+Q        +  G +   ++I   +G 
Sbjct: 9   KKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGF 68

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMF 226
             LY G+ + V       A  F      R  L   +++   T N   AG   G T  V+ 
Sbjct: 69  LALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAGVGAGITEAVLV 128

Query: 227 NTPFDVVKSRIQSDG-NEII---NGVR-----------KYNWTWPSVMKIYHEEGFRALY 271
             P +VVK R+Q+   N++I    GV            KY     +   I  EEG  ALY
Sbjct: 129 VNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALY 188

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303
           +G      R          V++ + +  +++H
Sbjct: 189 RGVSLTAARQATNQGANFTVYSYLKDYLQKYH 220

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  134 bits (336), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 148/304 (48%), Gaps = 26/304 (8%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MSS  +T   +      +AG  AG+ E +  +PLD +K RMQ+           T   G 
Sbjct: 49  MSSKKSTNPAV----NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN----EGTKPPGF 100

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           +   + I   EG +  YKG+ + ++   PK A++F+S  EF +   +   T  ++   + 
Sbjct: 101 LRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSY-EFYRTLLADRQTGVVSTGNTF 159

Query: 121 LSGASAGITEALVIV-PFELVKIRLQDVN-------SKFKGPVEVLKHIIKQDGLKGLYS 172
           L+G  AG+TEA+++V P E+VKIRLQ  +        K++  ++    I+K++G+  LY 
Sbjct: 160 LAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYR 219

Query: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-KTRNDLCAGFVGGTFGVMFNTPFD 231
           GV  T  R A      F V  ++ E L      Q   +      G V G  G   N P D
Sbjct: 220 GVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLD 279

Query: 232 VVKSRIQSDGNEIINGVRKY-NWTWPSVM--KIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
            +K+R+Q D        R   NW   + +  ++  EEGFRALYKG  P+V+R+ PG AV 
Sbjct: 280 TIKTRLQKD-----KSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVT 334

Query: 289 LVVF 292
             V+
Sbjct: 335 FTVY 338

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 84/198 (42%), Gaps = 6/198 (3%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQ-----DVNSKFKGPVEVLKHIIKQDG 166
           K     +++++G +AG+ EAL   P + +K+R+Q     +  +K  G +    +I   +G
Sbjct: 53  KSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEG 112

Query: 167 LKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVM 225
           L   Y G+ + V       A  F      R LL   ++    T N   AG   G T  V+
Sbjct: 113 LLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVL 172

Query: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285
              P +VVK R+Q+         +KY     +   I  EEG  ALY+G      R     
Sbjct: 173 VVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQ 232

Query: 286 AVLLVVFTNVMNVFREFH 303
                V++ +M   +E+H
Sbjct: 233 GANFTVYSKLMERLQEYH 250

>Scas_602.8
          Length = 885

 Score =  137 bits (346), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/298 (34%), Positives = 150/298 (50%), Gaps = 27/298 (9%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           + F  G++AG     ++YP+D +KTRMQ Q        S T YK  IDCL +I  KEG  
Sbjct: 500 FNFSLGSVAGCIGATLVYPIDFIKTRMQAQ-------RSLTKYKNSIDCLVKIFGKEGIR 552

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND   K      G  QL  +  VLSGA+AG  + +  
Sbjct: 553 GLYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKGNLQLGAE--VLSGATAGACQVVFT 610

Query: 135 VPFELVKIRLQDVNSKFKG---PVEVLK--HIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            P E+VKIRLQ V S++     P   L    IIK+  L GLY GV + + R+  ++A YF
Sbjct: 611 NPLEIVKIRLQ-VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYF 669

Query: 190 GVIFQVR----ELLPVAKSKQE--KTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
                ++    +  P  K K++  KT   L AG + G       TPFDV+K+R+Q +   
Sbjct: 670 PTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEPGV 729

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV---VFTNVMNV 298
              G  +Y     +V  I  EE FR+ +KG   +V+R  P     L    +F N+ N+
Sbjct: 730 ---GETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFKNMFNI 784

>Kwal_47.17321
          Length = 881

 Score =  136 bits (343), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 95/296 (32%), Positives = 151/296 (51%), Gaps = 25/296 (8%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           Y F+ G++AG      +YP+D+VKTRMQ Q        + + YK  IDC  +I  +EG  
Sbjct: 502 YNFLLGSVAGCIGATAVYPIDLVKTRMQAQ-------RNFSQYKNSIDCFVKIFSREGIR 554

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND   KL        +LT  + ++SGA+AG  + +  
Sbjct: 555 GIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMD--ENNRLTLPLEIISGAAAGACQVIFT 612

Query: 135 VPFELVKIRLQDVNSKF-----KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            P E+VKIRLQ V S++     K  +  L  ++K  GL+GLY G+ + + R+  ++A YF
Sbjct: 613 NPLEIVKIRLQ-VRSEYADSLPKSQLTALG-VVKSLGLRGLYKGLVACLMRDVPFSAIYF 670

Query: 190 GVIFQVRELL----PVAKSKQEK--TRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
                ++  +    P  K+K+ +  T   L AG + G       TPFDV+K+R+Q D  +
Sbjct: 671 PTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDPRK 730

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
              G  +Y     +   I  EE F++ +KG   +VLR  P     L  +    N+F
Sbjct: 731 ---GETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMF 783

>Kwal_47.18216
          Length = 333

 Score =  130 bits (327), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 150/338 (44%), Gaps = 65/338 (19%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MS+  N+  P       +AG  AG+ E +  +PLD +K RMQ+       G  A   +G 
Sbjct: 1   MSNRKNSSHPA---INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA---RGF 54

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           I     I  +EG + +YKG+ + ++   PK A++F S  EF +   +   T  ++   + 
Sbjct: 55  IGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRFTSY-EFFRTLLADRQTGVVSTGNTF 113

Query: 121 LSGASAGITEALVIV-PFELVKIRLQD--------------------------------- 146
           ++G  AGITEA+++V P E+VKIRLQ                                  
Sbjct: 114 VAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENV 173

Query: 147 -VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSK 205
               K++  ++    I+K++G + LY GV  T  R A      F V   ++  L      
Sbjct: 174 AATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRL------ 227

Query: 206 QEKTRNDLCA-------GFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSV 258
           QE  + D+         G + G  G   N P D +K+R+Q D +         +  W  +
Sbjct: 228 QEYHQTDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKST------SKDSGWSRI 281

Query: 259 MKI----YHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           + I      EEGFRALYKG  P+V+R+ PG AV   V+
Sbjct: 282 LAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVY 319

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 93/218 (42%), Gaps = 39/218 (17%)

Query: 17  FMAGAIAGISE-LMVMYPLDVVKTRMQLQ------VSTGAAG------------------ 51
           F+AG  AGI+E +MV+ P++VVK R+Q Q      +    AG                  
Sbjct: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATEN 172

Query: 52  -ASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG 110
            A+   Y+  I     IVK+EGP  +Y+G+S     +A  +   F          +    
Sbjct: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

Query: 111 TKQL----TQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-----VEVLKHI 161
           T  L    T  I ++SGA    + A    P + +K RLQ   S  K       + + + +
Sbjct: 233 TDMLPSWETSLIGLISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQL 288

Query: 162 IKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           I+++G + LY G+   V R A   A  F V   +R+ L
Sbjct: 289 IREEGFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 87/221 (39%), Gaps = 34/221 (15%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGLY 171
           I++++G +AG+ EAL   P + +K+R+Q      +   + +G +   + I  Q+G   LY
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTPF 230
            G+ + V       A  F      R LL   ++    T N   AG   G T  VM   P 
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPM 131

Query: 231 DVVKSRIQSD---------------------------GNEIINGVRKYNWTWPSVMKIYH 263
           +VVK R+Q+                              E +    KY     +   I  
Sbjct: 132 EVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVK 191

Query: 264 EEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304
           EEG RALY+G      R          V++ + +  +E+H+
Sbjct: 192 EEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  125 bits (315), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 93/302 (30%), Positives = 152/302 (50%), Gaps = 20/302 (6%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           M+S   +  P       +AG  AG+ E +  +PLD +K RMQ+  +   +G  A    G 
Sbjct: 1   MASKQKSSNPA---VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKA---PGF 54

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           I    +I + EG +  YKG+ + ++   PK A++F+S  EF +   +   T +++   + 
Sbjct: 55  IKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRFSSY-EFYRTLLADKETGKVSTGNTF 113

Query: 121 LSGASAGITEALVIVPFELV-KIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYS 172
           ++G  AGITEA+V+V    V KIRLQ       +   K+K  V+    I+K++G   LY 
Sbjct: 114 IAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYR 173

Query: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-KTRNDLCAGFVGGTFGVMFNTPFD 231
           GV  T  R A      F V  +++E L    +++   +      G + G  G   N P D
Sbjct: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLD 233

Query: 232 VVKSRIQSD-GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290
            +K+R+Q D   + ++G+++       ++    EEGFRALYKG  P+V+R+ PG AV   
Sbjct: 234 TIKTRLQKDKSTKNMSGLKRITIIGKQLI---QEEGFRALYKGITPRVMRVAPGQAVTFT 290

Query: 291 VF 292
            +
Sbjct: 291 AY 292

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 82/193 (42%), Gaps = 7/193 (3%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGP--VEVLKHIIKQDGLKGLY 171
           +++++G  AG+ E L   P + +K+R+Q     V S  K P  ++    I + +G    Y
Sbjct: 12  VNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFY 71

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTPF 230
            G+ + V       A  F      R LL   ++ +  T N   AG   G T  V+   P 
Sbjct: 72  KGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPM 131

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290
           +VVK R+Q+     + G  KY     +   I  EEGF ALY+G      R          
Sbjct: 132 EVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFT 191

Query: 291 VFTNVMNVFREFH 303
           V++ +    + +H
Sbjct: 192 VYSKLKEFLQGYH 204

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 6/99 (6%)

Query: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL 64
           HN Q  LP     + G I+G        PLD +KTR+Q   ST     + +  K +    
Sbjct: 204 HN-QEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKST----KNMSGLKRITIIG 258

Query: 65  SQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK 103
            Q++++EG   +YKGI+  ++  AP +AV F +  EFI+
Sbjct: 259 KQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY-EFIR 296

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  130 bits (326), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 148/295 (50%), Gaps = 23/295 (7%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           + F  G+IAG     V+YP+D+VKTRMQ Q        ++  YK  IDC+ +I + +G  
Sbjct: 506 HNFTLGSIAGCIGATVVYPIDLVKTRMQAQ-------RNSVQYKNSIDCVVKIFQTKGIR 558

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            +Y G+   ++  AP++A+K   ND   + + +   T +  Q+I  LSGA+AG  + +  
Sbjct: 559 GLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQEI--LSGATAGACQVVFT 616

Query: 135 VPFELVKIRLQDVNSKFKG----PVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG 190
            P E+VKIRLQ + S + G    P      II+Q GL+GLY G  + + R+  ++A YF 
Sbjct: 617 NPLEIVKIRLQ-MRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFP 675

Query: 191 VIFQVRE----LLPVAKSKQE--KTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEI 244
               +++      P  K+K+   KT   L AG + G       TPFDV+K+R+Q D  + 
Sbjct: 676 TYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRK- 734

Query: 245 INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
             G   Y     +   I  EE  ++ +KG   +VLR  P     L  F     +F
Sbjct: 735 --GETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLF 787

>Scas_718.5
          Length = 324

 Score =  108 bits (270), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 138/303 (45%), Gaps = 40/303 (13%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG   GIS+++V  P D  K RMQ          ++    G +D + ++VK EG   
Sbjct: 42  DILAGTCGGISQVIVGQPFDTTKVRMQ----------TSAKSVGALDIIRKLVKNEGVWA 91

Query: 76  MYKGISSPMLMEAPKRAVKFASND---EFIKLWKSVFGTKQLTQQISV----LSGASAGI 128
            YKG   P++      +V+F  N+    F + W +  GT+     + +    + G + G+
Sbjct: 92  FYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGV 151

Query: 129 TEALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
             + +  P E V+IRLQ         +FKGP++ ++ ++K+   K L  G+   + R   
Sbjct: 152 VNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLR--- 205

Query: 184 WNAGY-FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSR 236
             AG+  G  F   E L   + K+ K R++     LC+ G + G    +   P DVVKS 
Sbjct: 206 --AGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263

Query: 237 IQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
           IQ+D    +   R  N     +  +Y E+G  A +KGF P +LR  P      V F  VM
Sbjct: 264 IQTD---TLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVM 320

Query: 297 NVF 299
            + 
Sbjct: 321 RLL 323

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 206 QEKTR--NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYH 263
           ++ TR   D+ AG  GG   V+   PFD  K R+Q+    +             + K+  
Sbjct: 34  KDSTRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV--------GALDIIRKLVK 85

Query: 264 EEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHEGR 306
            EG  A YKG +  ++ +G   +V   V   +   FRE++  R
Sbjct: 86  NEGVWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSR 128

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  107 bits (266), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 138/300 (46%), Gaps = 35/300 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             ++G   GI++++V  P D+ K RMQ    T A  A+A      +D ++ ++K EG + 
Sbjct: 26  DILSGTAGGIAQVLVGQPFDITKVRMQ----TSAGSATA------VDVVTSLIKNEGILG 75

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG--TKQLTQQISVLSGASAGITEALV 133
            YKG  +P++      + +F  N+   + ++ + G  +K L+ +   + G ++G   A +
Sbjct: 76  FYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFL 135

Query: 134 IVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
             P E V+IRLQ       N++++G ++ ++ ++KQ  L     G  +T+ R        
Sbjct: 136 ATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQGAL---MRGFTATLMRTCHG---- 188

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDLC-------AGFVGGTFGVMFNTPFDVVKSRIQSDG 241
           FG+ F   E L   + K+   R D+          F G  +  M   P DVVKS +QSD 
Sbjct: 189 FGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAM-AYPIDVVKSIMQSD- 246

Query: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
             +++ V   N  W     IY   G RA  KGF+P +LR  P        F   M +   
Sbjct: 247 -RLVSPVHGTN-VWQVAKSIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTMRLLER 304

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 83/203 (40%), Gaps = 16/203 (7%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N +   PL  +  ++ G  +G +   +  P++ V+ R+QLQ  + A       Y+G +DC
Sbjct: 109 NGDPSKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANA----EYQGSLDC 164

Query: 64  LSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFI-KLWKSVFGTKQLTQQISVLS 122
           + +++K+   M   +G ++ ++       + F++ +  I    K     K +      + 
Sbjct: 165 MRKLLKQGALM---RGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIF 221

Query: 123 GASAGITEALVIVPFELVKIRLQDVNSKFKGPV------EVLKHIIKQDGLKGLYSGVES 176
           GA +G     +  P ++VK  +Q  + +   PV      +V K I    G +    G   
Sbjct: 222 GAFSGACYWAMAYPIDVVKSIMQ--SDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMP 279

Query: 177 TVWRNAVWNAGYFGVIFQVRELL 199
            + R+   N   F        LL
Sbjct: 280 AMLRSLPVNGATFATFEMTMRLL 302

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 34/89 (38%), Gaps = 5/89 (5%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKG 79
           GA +G     + YP+DVVK+ MQ          S  H   V      I    G     KG
Sbjct: 222 GAFSGACYWAMAYPIDVVKSIMQSDRLV-----SPVHGTNVWQVAKSIYTTRGKRAFIKG 276

Query: 80  ISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
               ML   P     FA+ +  ++L + V
Sbjct: 277 FMPAMLRSLPVNGATFATFEMTMRLLERV 305

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  106 bits (264), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 91/321 (28%), Positives = 144/321 (44%), Gaps = 47/321 (14%)

Query: 4   NHNTQAPLPFRY-----QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYK 58
           N     P P  Y        AG + G+++++V  P D  K R+Q          ++    
Sbjct: 12  NELEDVPPPTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQ----------TSKTKI 61

Query: 59  GVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI 118
           GVI+ +  +++ EG +  YKG+ +P+L      +V+F  N E +K + + +   ++  Q 
Sbjct: 62  GVIEVVQNLLRNEGALAFYKGMLTPLLGVGICVSVQFGVN-ESMKRFFAAYNADRVDPQK 120

Query: 119 SV--------LSGASAGITEALVIVPFELVKIRLQDVNSK-----FKGPVEVLKHIIKQD 165
            V        L G + G+  + +  P E V+IRLQ   S+     FKGP + +K + K  
Sbjct: 121 HVPLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKA- 179

Query: 166 GLKGLYSGVESTVWRNAVWNAGY-FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFV 218
             K L  G+  T+ R     AG+  G  F   E L V + ++   RN      LC+ G +
Sbjct: 180 --KALMRGLLPTMIR-----AGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGAL 232

Query: 219 GGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
            GT   +   P DVVKS +Q+D    I   +  N    +   +Y + G  A +KGFVP +
Sbjct: 233 SGTILWLTVYPVDVVKSVLQTDS---IENPKYKNSIIKATRALYKQHGIPAFFKGFVPTM 289

Query: 279 LRLGPGGAVLLVVFTNVMNVF 299
           +R  P  A   V F   M V 
Sbjct: 290 IRAAPANAATFVSFEMTMRVL 310

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 88/199 (44%), Gaps = 24/199 (12%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            + +G   G+ + LV  PF+  K+RLQ   +K  G +EV++++++ +G    Y G+ + +
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI-GVIEVVQNLLRNEGALAFYKGMLTPL 87

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND---------LCAGFVGGTFGVMFNTP 229
               +  +  FGV   ++       + +   +           LC G  GG        P
Sbjct: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLC-GLTGGVVNSFLAAP 146

Query: 230 FDVVKSRIQ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGA 286
            + V+ R+Q   S GNE     R++   +  + K+      +AL +G +P ++R G G  
Sbjct: 147 IEHVRIRLQTQTSQGNE-----RQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLG 198

Query: 287 VLLVVFTNVMNVFREFHEG 305
                +  +  V +EF +G
Sbjct: 199 TYFAAYEAL--VVKEFEKG 215

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
           D+ AG +GG   V+   PFD  K R+Q+   +I  GV +       V  +   EG  A Y
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI--GVIEV------VQNLLRNEGALAFY 80

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHEGR 306
           KG +  +L +G   +V   V  ++   F  ++  R
Sbjct: 81  KGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADR 115

>Scas_582.7
          Length = 329

 Score =  105 bits (263), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 133/282 (47%), Gaps = 10/282 (3%)

Query: 9   APLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIV 68
           A  P  +Q +AGA AGI E   M+P+D +KTR+Q   + G    S +    +I  +S+I 
Sbjct: 32  AHAPLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTS----IIKQISKIS 87

Query: 69  KKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV-LSGASAG 127
             EG + ++KG+ S +L   P  AV FA+  EF K        ++  Q I V +SGA+A 
Sbjct: 88  TMEGSLALWKGVQSVILGAGPAHAVYFATY-EFTKAHLIPDSQRETHQPIKVAVSGATAT 146

Query: 128 ITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAG 187
           +     + PF+ +K R+Q  + K +    V K I   +GL   Y    +T+  N  + A 
Sbjct: 147 VASDFFMNPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAF 206

Query: 188 YFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIIN- 246
            F +I++                + LC G + G       TP D +K+ IQ  G+ +++ 
Sbjct: 207 NF-MIYESASKFFNPLHHYNPLIHCLCGG-ISGAIAAAVTTPLDCIKTVIQIRGSSVVSL 264

Query: 247 -GVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
             ++K N    +   I    G++  ++G  P++L   P  A+
Sbjct: 265 EVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAI 306

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 82/196 (41%), Gaps = 23/196 (11%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQ-------DGLKGLYS 172
           +L+GA AGI E   + P + +K R+Q   +K  G  +    IIKQ       +G   L+ 
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTK--GTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 173 GVESTVWRNAVWNAGYFGVI-FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGV---MFNT 228
           GV+S +      +A YF    F    L+P     Q +T   +     G T  V    F  
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHLIP---DSQRETHQPIKVAVSGATATVASDFFMN 154

Query: 229 PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
           PFD +K R+Q      I+ ++K    +    KIY+ EG  A Y  +   +    P  A  
Sbjct: 155 PFDTIKQRMQ------ISDLKKEK-VYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFN 207

Query: 289 LVVFTNVMNVFREFHE 304
            +++ +    F   H 
Sbjct: 208 FMIYESASKFFNPLHH 223

 Score = 31.6 bits (70), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 8/85 (9%)

Query: 211 NDLCAGFVGGTF--GVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTW-PSVMKIYHEEGF 267
           + L AG   G      MF  P D +K+RIQS   +   G  + + +    + KI   EG 
Sbjct: 38  HQLLAGAFAGIMEHSTMF--PIDALKTRIQSTTTK---GTEQTSTSIIKQISKISTMEGS 92

Query: 268 RALYKGFVPKVLRLGPGGAVLLVVF 292
            AL+KG    +L  GP  AV    +
Sbjct: 93  LALWKGVQSVILGAGPAHAVYFATY 117

>Kwal_33.15446
          Length = 305

 Score =  104 bits (260), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 87/314 (27%), Positives = 145/314 (46%), Gaps = 33/314 (10%)

Query: 1   MSSNHNTQAPLPFRYQ-----FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASAT 55
           MSS  ++ A +P         F++G  +GI++  V +P D +K R+Q    TG       
Sbjct: 1   MSSRSDSNAVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG------- 53

Query: 56  HYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF--GTKQ 113
            +KG +DC+ Q ++++G    Y G + P++      +V       +  L K       ++
Sbjct: 54  RFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEK 113

Query: 114 LTQQISVLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKG 169
           L     +LSG  AG + + +  P EL K +LQ       ++++GP++V+K +   DG++G
Sbjct: 114 LPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRG 173

Query: 170 LYSGVEST-VWRNAVWNAGYFGVIFQVRELLPV---AKSKQEKTRNDLCAGFVGGTFGVM 225
           +Y G+ ST ++R       +F   +   ELL     A +    T  +  AG    +FG  
Sbjct: 174 MYKGLVSTLIFRT------HFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFW 227

Query: 226 FNT-PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284
               P DV+K  I    N+  +G  + +W   +   I+   G R  +KGFVP  LR  P 
Sbjct: 228 TTAYPSDVIKQVILC--NDKYDGSLR-SWR-NAASDIWRTRGIRGFFKGFVPSFLRSFPA 283

Query: 285 GAVLLVVFTNVMNV 298
            A  L  F  V+ V
Sbjct: 284 NAAALASFEFVLRV 297

>Kwal_33.14050
          Length = 314

 Score =  104 bits (260), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 132/290 (45%), Gaps = 27/290 (9%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQ-LQVSTGAAGASATHYKGVIDCLSQIVKK 70
           P  +Q  AGA AGI E  +M+P+D +KTRMQ L  + G+A A+A     ++  +++I   
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTT 74

Query: 71  EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITE 130
           EG M ++KG+ S +L   P  AV FA+     ++ KS     Q  Q    L  A++GI  
Sbjct: 75  EGSMALWKGVQSVILGAGPAHAVYFAT----YEMCKSYLIDPQDFQTHQPLKTAASGIAA 130

Query: 131 A----LVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
                L++ PF+ +K R+Q           V   I + +GL   +    +T+  N  + A
Sbjct: 131 TVAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAA 190

Query: 187 GYFGVIFQVRELLPVAKSKQEKTRND----LCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
             F +     +         E T N     LC G  G T   +  TP D +K+ +Q  G+
Sbjct: 191 FNFAIYESATKFF-----NPENTYNPLIHCLCGGISGATCAAI-TTPLDCIKTVLQVRGS 244

Query: 243 E-----IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
           E     +      ++    ++ K+Y   GF   ++G  P+++   P  A+
Sbjct: 245 ESVVDPLFRQADTFSRAASAISKVYGWSGF---WRGLKPRIISNMPATAI 291

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 86/214 (40%), Gaps = 25/214 (11%)

Query: 99  DEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ-------DVNSKF 151
           DE I  ++S+     LT Q++  +GA AGI E  ++ P + +K R+Q         N+  
Sbjct: 2   DEEID-YESLPTNAPLTHQLA--AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAA 58

Query: 152 KGPVEVLKHIIK---QDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEK 208
           K P  +++ I +    +G   L+ GV+S +      +A YF      +  L   +  Q  
Sbjct: 59  KLPSNIVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTH 118

Query: 209 TRNDLCAGFVGGTFGV-MFNTPFDVVKSRIQSDGNEIINGVRKY--NWTWPSVMKIYHEE 265
                 A  +  T    +   PFD +K R+Q         +R +  +  W    +IY  E
Sbjct: 119 QPLKTAASGIAATVAADLLMNPFDTIKQRMQ---------LRTFSKDRMWSVASRIYRNE 169

Query: 266 GFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           G  A +  +   +    P  A    ++ +    F
Sbjct: 170 GLAAFFYSYPTTIAMNIPFAAFNFAIYESATKFF 203

>Kwal_55.21335
          Length = 317

 Score =  102 bits (253), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 135/293 (46%), Gaps = 37/293 (12%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-M 76
           + G+IAG +  ++ YPLD +K R+Q Q         A  +     C+    +KEG +   
Sbjct: 50  LYGSIAGAAGKVIEYPLDTIKVRLQTQ--------PAHVFPTSWSCIKYTYQKEGFVKGF 101

Query: 77  YKGISSPMLMEAPKRAVKFASNDE---FIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
           Y+G++SP++  A + AV F + +    F++ ++SV    Q     +VLSGA AG   + V
Sbjct: 102 YQGVASPLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQ-----TVLSGAFAGACTSYV 156

Query: 134 IVPFELVKIRLQDVN-----SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
           + P EL+K  LQ  N     ++       +KHI++  G+ GL+ G  ST  R     A +
Sbjct: 157 LTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVW 216

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT---PFDVVKSRIQSDGNEII 245
           F     ++  L   ++  E    +L A   G + GV FN    P D +KS  Q+    I+
Sbjct: 217 FTTYESLKSYLARRRNDTENHTWELLAS--GASAGVAFNASIFPADTIKSTAQTQHLGIV 274

Query: 246 NGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           +  +          +I    G   LY+G    ++R  P  A++   +  + N+
Sbjct: 275 DATK----------RILARSGPAGLYRGLGITLIRAAPANAIVFYTYETLSNL 317

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 81/178 (45%), Gaps = 5/178 (2%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSK-FKGPVEVLKHIIKQDG-LKGLYSGVEST 177
           +L G+ AG    ++  P + +K+RLQ   +  F      +K+  +++G +KG Y GV S 
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASP 108

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
           +   A+ NA  F    + +  L   +S    ++  L   F G     +  TP +++K  +
Sbjct: 109 LVGAALENAVLFVTFNRAQNFLQQYESVSPLSQTVLSGAFAGACTSYVL-TPVELIKCTL 167

Query: 238 QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
           Q    E      +++  WP+V  I   +G   L++G     +R   GGAV    + ++
Sbjct: 168 QVSNLE--GATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESL 223

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 7/94 (7%)

Query: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGF-RAL 270
           D+  G + G  G +   P D +K R+Q+    +      +  +W  +   Y +EGF +  
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHV------FPTSWSCIKYTYQKEGFVKGF 101

Query: 271 YKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304
           Y+G    ++      AVL V F    N  +++  
Sbjct: 102 YQGVASPLVGAALENAVLFVTFNRAQNFLQQYES 135

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 131/280 (46%), Gaps = 16/280 (5%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P   Q +AGA AGI E  +M+P+D +KTR+Q      AAG +     G+I  +S+I   E
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQ------AAGLNKAASTGMISQISKISTME 75

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-SVLSGASAGITE 130
           G M ++KG+ S +L   P  AV F +  EF K         Q  Q + + LSG  A I  
Sbjct: 76  GSMALWKGVQSVILGAGPAHAVYFGTY-EFCKARLISPEDMQTHQPMKTALSGTIATIAA 134

Query: 131 ALVIVPFELVKIRLQ-DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
             ++ PF+ VK RLQ D N +      V K I + +G    Y    +T+  N  + A  F
Sbjct: 135 DALMNPFDTVKQRLQLDTNLRV---WNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNF 191

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEI--ING 247
            +I++        ++      + LC G  G T   +  TP D +K+ +Q  G+E   I  
Sbjct: 192 -MIYESASKFFNPQNSYNPLIHCLCGGISGATCAAL-TTPLDCIKTVLQVRGSETVSIEI 249

Query: 248 VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
           ++  N    +   I    G++  ++G  P+++   P  A+
Sbjct: 250 MKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAI 289

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 81/187 (43%), Gaps = 17/187 (9%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDV---NSKFKGPVEVLKHIIKQDGLKGLYSGVES 176
           +L+GA AGI E  ++ P + +K R+Q      +   G +  +  I   +G   L+ GV+S
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 177 TVWRNAVWNAGYFGV--IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVK 234
            +      +A YFG     + R + P      +  +  L +G +          PFD VK
Sbjct: 87  VILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTAL-SGTIATIAADALMNPFDTVK 145

Query: 235 SRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLG-PGGAVLLVVFT 293
            R+Q D N     +R +N T     +IY  EGF A Y  + P  L +  P  A   +++ 
Sbjct: 146 QRLQLDTN-----LRVWNVT----KQIYQNEGFAAFYYSY-PTTLAMNIPFAAFNFMIYE 195

Query: 294 NVMNVFR 300
           +    F 
Sbjct: 196 SASKFFN 202

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 134/281 (47%), Gaps = 12/281 (4%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  +Q MAGA AGI+E  V++PLD +KTR+Q   +    G        ++  LS I  +E
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIP-STMLRQLSSISAQE 75

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIK--LWKSVFGTKQLTQQISVLSGASAGIT 129
           G M ++KG+ S +L   P  AV FA+  E +K  L      T +     +  SGA+A I 
Sbjct: 76  GSMVLWKGVQSVLLGAGPAHAVYFATY-EMVKSFLIDEATSTSKYHFFKTAFSGATATIA 134

Query: 130 EALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
              ++ PF+++K R+Q +N+      +  K I  ++G +  YS   +T+  N  + A  F
Sbjct: 135 ADALMNPFDVIKQRIQ-LNTNIS-VWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNF 192

Query: 190 GVI-FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIIN-G 247
           G+     R   P          + LC G + G       TP D +K+ +Q  G+E ++  
Sbjct: 193 GIYDTATRYFNP--SGVYNPFIHCLCGG-ISGAACAGLTTPLDCIKTALQVRGSEKVSME 249

Query: 248 VRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAV 287
           V K   T+    + IY   G+R  + G  P++L   P  A+
Sbjct: 250 VFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAI 290

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 99.8 bits (247), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 138/280 (49%), Gaps = 17/280 (6%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  +Q +AGA AGI E  V++P+D +KTR+Q   S+GAA       +G+I  +S+I   E
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ-SSSSGAAT------QGLIKQISKITTAE 67

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI--SVLSGASAGIT 129
           G + ++KG+ S +L   P  AV FA+  EF K  K +      T Q   + +SG +A   
Sbjct: 68  GSLALWKGVQSVILGAGPAHAVYFATY-EFSKS-KLIDPQDMHTHQPIKTAISGMAATTV 125

Query: 130 EALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
              ++ PF+++K R+Q +N++ +    V K+I  ++G    Y    +T+  N  + A  F
Sbjct: 126 ADALMNPFDVIKQRMQ-LNTR-ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNF 183

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIING-- 247
            +     + +    S +        +G + G       TP D +K+ +Q  G+E ++   
Sbjct: 184 AIYESATKFM--NPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEI 241

Query: 248 VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
           +++ N    +   IY   G++   +G  P+V+   P  A+
Sbjct: 242 MKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAI 281

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 15/190 (7%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNS--KFKGPVEVLKHIIKQDGLKGLYSGVEST 177
           +L+GA AGI E  V+ P + +K R+Q  +S    +G ++ +  I   +G   L+ GV+S 
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 178 VWRNAVWNAGYFGVI-FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSR 236
           +      +A YF    F   +L+        +      +G    T       PFDV+K R
Sbjct: 80  ILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPFDVIKQR 139

Query: 237 IQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF---T 293
           +Q +  E +         W     IYH+EGF A Y  +   ++   P  A    ++   T
Sbjct: 140 MQLNTRESV---------WHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESAT 190

Query: 294 NVMNVFREFH 303
             MN   E++
Sbjct: 191 KFMNPSNEYN 200

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 99.8 bits (247), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 133/299 (44%), Gaps = 37/299 (12%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQL-QVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
             +AG   GI+++++  P D  K R+Q  +V T AA           + +  ++K EGP 
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAA-----------EVVKNLLKNEGPK 76

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLW--KSVFGTKQLTQQISVLSGASAGITEAL 132
             YKG  +P++      +++F  N+   + +  ++V     L+     L G + G+T + 
Sbjct: 77  GFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSF 136

Query: 133 VIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAG 187
           +  P E V+IRLQ        ++FKGP++ +K +  Q   KGL  G+  T+ R       
Sbjct: 137 LASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQ---KGLMRGLIPTMLREGHGCGT 193

Query: 188 YFGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSRIQSDG 241
           YF     V E L   +  Q   R +     LC  G + GT   +   P DVVKS +Q+D 
Sbjct: 194 YF----LVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDN 249

Query: 242 -NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
            N+  NG             +Y  EG +A +KGF P +LR  P        F   M + 
Sbjct: 250 LNKPQNGKNMIQ----VARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 91/209 (43%), Gaps = 30/209 (14%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           +HN  A L     ++ G   G++   +  P++ V+ R+Q Q  +GA       +KG IDC
Sbjct: 113 DHN--ATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQ----AEFKGPIDC 166

Query: 64  LSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS---- 119
           + ++  ++G M   +G+   ML E       F   +  +        +KQ+ Q +     
Sbjct: 167 IKKLRSQKGLM---RGLIPTMLREGHGCGTYFLVYEALV--------SKQINQGLKRTEI 215

Query: 120 -----VLSGASAGITEALVIVPFELVKIRLQDVN----SKFKGPVEVLKHIIKQDGLKGL 170
                 L GA +G    L++ P ++VK  +Q  N       K  ++V +++  ++GLK  
Sbjct: 216 PPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAF 275

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           + G   T+ R A  N G F        LL
Sbjct: 276 FKGFGPTMLRAAPANGGTFATFELAMRLL 304

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 99.0 bits (245), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 140/286 (48%), Gaps = 20/286 (6%)

Query: 7   TQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQ 66
           T APL   +Q +AGA AGI E  VM+P+D +KTR+Q      +A A +   K ++  +S 
Sbjct: 29  THAPL--YHQLIAGAFAGIMEHSVMFPIDALKTRIQ------SANAKSLSAKNMLSQISH 80

Query: 67  IVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI---SVLSG 123
           I   EG + ++KG+ S +L   P  AV F +  EF K  K++  +          + +SG
Sbjct: 81  ISTSEGTLALWKGVQSVILGAGPAHAVYFGTY-EFCK--KNLIDSSDTQTHHPFKTAISG 137

Query: 124 ASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           A A      ++ PF+ +K R+Q +N+      +  K I + +GL   Y    +T+  N  
Sbjct: 138 ACATTASDALMNPFDTIKQRIQ-LNTS-ASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIP 195

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
           + A  F VI++         ++     + LC G + G+      TP D +K+ +Q  G++
Sbjct: 196 FAAFNF-VIYESSTKFLNPSNEYNPLIHCLC-GSISGSTCAAITTPLDCIKTVLQIRGSQ 253

Query: 244 IING--VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            ++   +RK +    +   IY   G++  ++G+ P+++   P  A+
Sbjct: 254 TVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAI 299

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 84/191 (43%), Gaps = 16/191 (8%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSK---FKGPVEVLKHIIKQDGLKGLYSGVES 176
           +++GA AGI E  V+ P + +K R+Q  N+K    K  +  + HI   +G   L+ GV+S
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQS 96

Query: 177 TVWRNAVWNAGYFGVI-FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKS 235
            +      +A YFG   F  + L+  + ++         +G    T       PFD +K 
Sbjct: 97  VILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQ 156

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF--- 292
           RIQ + +  +         W +  +IY  EG  A Y  +   ++   P  A   V++   
Sbjct: 157 RIQLNTSASV---------WQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESS 207

Query: 293 TNVMNVFREFH 303
           T  +N   E++
Sbjct: 208 TKFLNPSNEYN 218

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 98.6 bits (244), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 129/294 (43%), Gaps = 26/294 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F+AGA+AG  E  + YP +  KTR+QL         S+   +  +  +    K +G   
Sbjct: 13  SFVAGALAGAVEASITYPFEFAKTRLQL------IDKSSKASRNPLVLIYNTAKTQGVGA 66

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV-I 134
           +Y G  + ++    K A +F   D    L K    T +L+    VL+G  AG+ E++V +
Sbjct: 67  IYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDK-KTGELSGPRGVLAGLGAGLLESVVAV 125

Query: 135 VPFELVKIRL----QDVNSKFKGPVEVLKH----IIKQDGLKGLYSGVESTVWRNAVWNA 186
            PFE +K  L    Q V  K++     +      ++K +G +GLY GV     R A   A
Sbjct: 126 TPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAANQA 185

Query: 187 GYFGVIFQVRELLP----VAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
              G   +++ L+       K K   +      G   G   V    P D VK+R+QS   
Sbjct: 186 VRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQS--- 242

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
                  KY+ T      IY EEG +  +KG  P++ RL   G ++  ++ NV+
Sbjct: 243 ---LTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 91/200 (45%), Gaps = 11/200 (5%)

Query: 111 TKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKG---PVEVLKHIIKQDGL 167
           +K++    S ++GA AG  EA +  PFE  K RLQ ++   K    P+ ++ +  K  G+
Sbjct: 5   SKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGV 64

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTF-GVMF 226
             +Y G  + +  N    A  F     +R LL   K+ +      + AG   G    V+ 
Sbjct: 65  GAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLLESVVA 124

Query: 227 NTPFDVVKSRIQSDGNEI----INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLG 282
            TPF+ +K+ +  D   +     N  R     + S++K   +EGFR LY G +P  +R  
Sbjct: 125 VTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVK---DEGFRGLYGGVLPVSMRQA 181

Query: 283 PGGAVLLVVFTNVMNVFREF 302
              AV L  +  +  + +++
Sbjct: 182 ANQAVRLGCYNKIKVLVQDY 201

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL     F+ GA +G+  +    P+D VKTRMQ          +A+ Y   ++C + I K
Sbjct: 209 PLTSGLTFIVGAFSGVVTVYATMPIDTVKTRMQ--------SLTASKYSSTLNCFTTIYK 260

Query: 70  KEGPMHMYKGISSPML 85
           +EG    +KG ++P L
Sbjct: 261 EEGLKTFWKG-ATPRL 275

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 98.2 bits (243), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 127/292 (43%), Gaps = 33/292 (11%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-MYK 78
           G++AG    ++ YP D VK R+Q Q         A  Y     C+      EG     Y+
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ--------PAHLYPTTWSCIRSTYTDEGIWKGFYQ 65

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFE 138
           GI+SP+   A + AV F S ++           K LT+  ++ SGA AG   + ++ P E
Sbjct: 66  GIASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTK--TIYSGAFAGACASFILTPVE 123

Query: 139 LVKIRLQDVN--------SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG 190
           LVK +LQ  N        ++       +K +IK+ GL GL+ G  ST  R  +  A +F 
Sbjct: 124 LVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWF- 182

Query: 191 VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT---PFDVVKSRIQSDGNEIING 247
             +++ ++   +    EK  +       G + GV+FN    P D VKS  Q++   I+N 
Sbjct: 183 TTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHVSIVNA 242

Query: 248 VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           ++          K+    G    Y+G    ++R  P  A +   +  +  +F
Sbjct: 243 LK----------KVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 82/184 (44%), Gaps = 4/184 (2%)

Query: 123 GASAGITEALVIVPFELVKIRLQDVNSK-FKGPVEVLKHIIKQDGL-KGLYSGVESTVWR 180
           G+ AG    ++  PF+ VK+RLQ   +  +      ++     +G+ KG Y G+ S ++ 
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLFG 73

Query: 181 NAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ-S 239
            A+ NA  F    Q    L      +  T+      F G     +  TP ++VK ++Q S
Sbjct: 74  AALENAVLFVSFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASFIL-TPVELVKCKLQVS 132

Query: 240 DGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           + +  ++   ++   WP++  +  E+G   L++G +   +R   GGAV    +  +   F
Sbjct: 133 NISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTYEIMKMKF 192

Query: 300 REFH 303
              H
Sbjct: 193 ASLH 196

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 42/102 (41%), Gaps = 7/102 (6%)

Query: 204 SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYH 263
           S  E    D+  G V G  G +   PFD VK R+Q+    +      Y  TW  +   Y 
Sbjct: 2   SDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHL------YPTTWSCIRSTYT 55

Query: 264 EEG-FRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304
           +EG ++  Y+G    +       AVL V F    N   EF +
Sbjct: 56  DEGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFLDEFTQ 97

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 138/302 (45%), Gaps = 37/302 (12%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           ++G   GI++++V  P D+ K RM  Q S+G+  A        I+ +  +VK EG +  Y
Sbjct: 28  ISGTSGGIAQVLVGQPFDITKVRM--QTSSGSPTA--------IEVIKNLVKNEGLLAFY 77

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL----SGASAGITEALV 133
           KG   P++      + +F  N+   + +  V G K   Q +S+L     G  +G   A +
Sbjct: 78  KGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKD--QHLSLLQYYTCGFVSGSANAFL 135

Query: 134 IVPFELVKIRLQ-----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
             P E V+IRLQ        ++++G ++ +K ++KQ   K L  G  +T+ R     +  
Sbjct: 136 ATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ---KALMRGFTATLMR----TSHG 188

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDL-----CA-GFVGGTFGVMFNTPFDVVKSRIQSDGN 242
           FGV F   E L + ++K    R D+     C  G   G F      PFDVVKS +Q+D  
Sbjct: 189 FGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQAD-- 246

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREF 302
            +++ V   N  +     I+   G+ A  KGFVP +LR  P        F   M +    
Sbjct: 247 RLVSPVHGKN-VFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLLESL 305

Query: 303 HE 304
            +
Sbjct: 306 DK 307

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 84/183 (45%), Gaps = 10/183 (5%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            ++SG S GI + LV  PF++ K+R+Q  +S     +EV+K+++K +GL   Y G    +
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQ-TSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPL 84

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL---CAGFVGGTFGVMFNTPFDVVKS 235
                  +  FGV   ++         +++  + L     GFV G+      TP + V+ 
Sbjct: 85  IGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRI 144

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTN- 294
           R+Q     +     +Y  +   + K+  +   +AL +GF   ++R   G  V  + +   
Sbjct: 145 RLQLQTKALAKA--EYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGFGVYFLTYEAL 199

Query: 295 VMN 297
           +MN
Sbjct: 200 IMN 202

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 79/190 (41%), Gaps = 16/190 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           +  G ++G +   +  P++ V+ R+QLQ    A       Y+G +DC+ +++K++  M  
Sbjct: 122 YTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKA----EYRGSLDCMKKLLKQKALM-- 175

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFI-KLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135
            +G ++ ++  +    V F + +  I    K+    K +      + GA +G     +  
Sbjct: 176 -RGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTY 234

Query: 136 PFELVKIRLQDVNSKFKGPV------EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
           PF++VK  +Q    +   PV      +V K I    G      G   T+ R+   N   F
Sbjct: 235 PFDVVKSIMQ--ADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATF 292

Query: 190 GVIFQVRELL 199
                   LL
Sbjct: 293 ATFEVTMRLL 302

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 18/81 (22%)

Query: 207 EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN-----EIINGVRKYNWTWPSVMKI 261
            K   D+ +G  GG   V+   PFD+ K R+Q+        E+I  + K           
Sbjct: 21  RKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSSGSPTAIEVIKNLVK----------- 69

Query: 262 YHEEGFRALYKGFVPKVLRLG 282
              EG  A YKG +  ++ +G
Sbjct: 70  --NEGLLAFYKGTLVPLIGVG 88

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 137/299 (45%), Gaps = 38/299 (12%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           +G + G+++++V  P D++K R+Q          +AT ++ + D    +VK EG M  YK
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVRLQ------TMPGNATAWEAITD----LVKYEGFMGFYK 79

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL-----SGASAGITEALV 133
           G  +P++      + +F  N+   + ++ +  ++ +      L      G  +G   AL+
Sbjct: 80  GTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALL 139

Query: 134 IVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
             P E V+IRLQ       N+++K  ++  + ++KQ  L     G  +T+ R +      
Sbjct: 140 ATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLM---RGFTATLMRTSHG---- 192

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDLCA------GFVGGTFGVMFNTPFDVVKSRIQSDGN 242
           FG+ F   E L  ++      R D+ A      G + G F      PFDVVKS +Q+D  
Sbjct: 193 FGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQAD-- 250

Query: 243 EIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
           +++N    Y      V K IY E G RA  KGF+P +LR  P        F   M + +
Sbjct: 251 KLVNPA--YGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQMLK 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 76/184 (41%), Gaps = 12/184 (6%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            V SG   G+ + LV  PF+++K+RLQ +        E +  ++K +G  G Y G  + +
Sbjct: 27  DVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGN-ATAWEAITDLVKYEGFMGFYKGTMAPL 85

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL------CAGFVGGTFGVMFNTPFDV 232
                  +  FG+   ++         +    N L        GFV G+   +  TP + 
Sbjct: 86  VGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPIEH 145

Query: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           V+ R+Q     + N   +Y  T     K+  +    +L +GF   ++R   G  +  + +
Sbjct: 146 VRIRLQLQKEALANA--EYKSTLDCTEKLLKQG---SLMRGFTATLMRTSHGFGIYFLTY 200

Query: 293 TNVM 296
             ++
Sbjct: 201 ETLI 204

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 85/188 (45%), Gaps = 12/188 (6%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           +  G ++G +  ++  P++ V+ R+QLQ    A       YK  +DC  +++K+   M  
Sbjct: 126 YTCGFVSGSANALLATPIEHVRIRLQLQKEALANA----EYKSTLDCTEKLLKQGSLM-- 179

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFI-KLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135
            +G ++ ++  +    + F + +  I       F  + ++   + + GA +G     +  
Sbjct: 180 -RGFTATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTY 238

Query: 136 PFELVKIRLQD---VNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGV 191
           PF++VK  +Q    VN  +    V+V K+I ++ GL+    G   T+ R+   N   F  
Sbjct: 239 PFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAA 298

Query: 192 IFQVRELL 199
                ++L
Sbjct: 299 FEVTMQML 306

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 207 EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQS-DGNEIINGVRKYNWTWPSVMKIYHEE 265
            KT  D+ +G VGG   V+   PFD++K R+Q+  GN            W ++  +   E
Sbjct: 22  RKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNAT---------AWEAITDLVKYE 72

Query: 266 GFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHEGR 306
           GF   YKG +  ++ +G   +    +   +   FR+ +  R
Sbjct: 73  GFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYFRDLNRSR 113

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 5/89 (5%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           M GA++G     + YP DVVK+ MQ       A     +   V+     I ++ G     
Sbjct: 224 MFGALSGAFFWAMTYPFDVVKSVMQADKLVNPA-----YGTNVVQVAKNIYRERGLRAFT 278

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWK 106
           KG    ML   P     FA+ +  +++ K
Sbjct: 279 KGFMPTMLRSLPVNGATFAAFEVTMQMLK 307

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 97.4 bits (241), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 133/297 (44%), Gaps = 36/297 (12%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F++G  +GI++  V +P D +K R+Q           +T +KG +DC+ +   ++G    
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQ-------TSQDSTRFKGPLDCVYKTFTQQGIRGF 116

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSV--FGTKQLTQQISVLSGASAGITEALVI 134
           Y G + P++      +V       +  L K    +  ++L     ++SG  AG + + + 
Sbjct: 117 YLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIA 176

Query: 135 VPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST-VWRN--AVWNAG 187
            P EL K +LQ       +K+ GPV+V+K +   +G++GLY G+ ST ++R     W   
Sbjct: 177 APVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRTNFVFWWGS 236

Query: 188 YFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFN-----TPFDVVKSRIQSDGN 242
           Y        ELL     K+    +D    F  G F   F       P DV+K  +    N
Sbjct: 237 Y--------ELL-TRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLC--N 285

Query: 243 EIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           +  +G  +   +W    K I+   G+R  +KGFVP  LR  P  A  L  F  V+  
Sbjct: 286 DKYDGTFR---SWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRT 339

>Scas_489.4
          Length = 297

 Score = 96.7 bits (239), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 133/310 (42%), Gaps = 31/310 (10%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MS       PL   + F+AGA+AG  E  + YP +  KTR+QL   T      +T  +  
Sbjct: 1   MSQEKKPVDPL---HSFIAGALAGAIEASITYPFEFAKTRLQLIDKT------STASRNP 51

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           +  +    K +G   +Y G  + ++    K  ++F   D    + +    T +L+    V
Sbjct: 52  LVLIYNTAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPV-TGELSGPRGV 110

Query: 121 LSGASAGITEALV-IVPFELVKIRLQDVNSKFK--------GPVEVLKHIIKQDGLKGLY 171
           ++G  AG+ E++V + PFE +K  L D     K        G +     +++  G+ GLY
Sbjct: 111 VAGLGAGLLESVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLY 170

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLP----VAKSKQEKTRNDLCAGFVGGTFGVMFN 227
            GV     R A   A   G   +++ ++       K +   +      G   G   V   
Sbjct: 171 RGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTT 230

Query: 228 TPFDVVKSRIQS-DGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGA 286
            P D VK+R+QS D         KY  T     KI+ EEG +  +KG  P++ RL   G 
Sbjct: 231 MPIDTVKTRMQSLDAT-------KYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGG 283

Query: 287 VLLVVFTNVM 296
           ++  ++ NV+
Sbjct: 284 IVFTIYENVL 293

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 96.7 bits (239), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 137/291 (47%), Gaps = 28/291 (9%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG  +G+++  V +P D +K R+Q          + T +KG +DC+ +  + +G    
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQ-------TSQNETRFKGPLDCVYKTFRNQGIRGF 79

Query: 77  YKGISSPMLMEAPKRAVKFASNDEF-IKLWKSVF-GTKQLTQQISVLSGASAGITEALVI 134
           Y G + P++      +V       + + + K V+   ++L     ++SG  AG + + + 
Sbjct: 80  YLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIA 139

Query: 135 VPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST-VWRN--AVWNAG 187
            P EL K +LQ       +++KGP++V+K I    G++GLY G+ ST ++R     W   
Sbjct: 140 PPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGS 199

Query: 188 YFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-PFDVVKSRIQSDGNEIIN 246
           Y  +    RE      +K  +   +  AG    +FG      P DVVK  +    N+  +
Sbjct: 200 YELLTRWFRE-----NTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLC--NDKYD 252

Query: 247 GVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
           G  K   +W + +K IY  +G    +KGFVP  LR  P  A  L  F  V+
Sbjct: 253 GSFK---SWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVL 300

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 81/178 (45%), Gaps = 8/178 (4%)

Query: 107 SVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVN--SKFKGPVEVLKHIIKQ 164
           S+   +  ++ +  ++G  +G+ +  V  PF+ +K+RLQ     ++FKGP++ +    + 
Sbjct: 14  SLISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRN 73

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL-PVAKSKQEKTRNDLC--AGFVGGT 221
            G++G Y G    +    + ++   G +   R L+        EK     C  +G + G 
Sbjct: 74  QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGW 133

Query: 222 FGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVL 279
                  P ++ K+++Q   ++      +Y      + KIY  +G R LYKG +  ++
Sbjct: 134 SVSFIAPPIELAKAKLQVQYDKTTT---RYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 78/176 (44%), Gaps = 14/176 (7%)

Query: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKK 70
           LP     ++G +AG S   +  P+++ K ++Q+Q        + T YKG +D + +I   
Sbjct: 119 LPLSGCIISGVLAGWSVSFIAPPIELAKAKLQVQYD-----KTTTRYKGPLDVIKKIYSA 173

Query: 71  EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGA-SAGIT 129
           +G   +YKG+ S ++       V +  + E +  W     TK     I+  +G  SA   
Sbjct: 174 QGIRGLYKGLISTLIFRT--HFVYWWGSYELLTRWFRE-NTKMSEAAINFWAGGFSASFG 230

Query: 130 EALVIVPFELVKIRLQDVNSKFKGPVE----VLKHIIKQDGLKGLYSGVESTVWRN 181
                 P ++VK ++   N K+ G  +     +K I +  G+ G + G   +  R+
Sbjct: 231 FWTTAYPSDVVK-QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRS 285

>Kwal_23.4354
          Length = 343

 Score = 97.1 bits (240), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 84/340 (24%), Positives = 145/340 (42%), Gaps = 52/340 (15%)

Query: 8   QAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQ-------VSTGAAGASATHYKGV 60
           Q  +  + + ++  +  +   +++ P+DVV+ R+Q Q         T A   S    KGV
Sbjct: 6   QKGIGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGV 65

Query: 61  I----------------------DCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASN 98
                                  D   +I K EG   +++G+S  +LM AP   V F   
Sbjct: 66  FWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGY 125

Query: 99  DEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDV--NSKFKGPVE 156
           +      KS    K  T    ++ GA A +  A  + P EL + RLQ +  +S       
Sbjct: 126 ESLRD--KSRLQDKYPTLN-PLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAM 182

Query: 157 VLKHIIKQD-------GLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSK---- 205
           ++K +IK+        G K L+ G+E T+WR+  +++ Y+G     +  + +   K    
Sbjct: 183 MIKDLIKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVN 242

Query: 206 -QEKTRNDLCAGFVGGTFG----VMFNTPFDVVKSRIQ-SDGNEIINGVRKYNWTWPSVM 259
                 N     FVGG+FG     +   PFDV K+R+Q +  N  +      N  +  + 
Sbjct: 243 SSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKN-MFKYLN 301

Query: 260 KIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           ++   EG  ALY G VP+V+++ P  A+++  +     +F
Sbjct: 302 QMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 5/106 (4%)

Query: 2   SSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVI 61
           SSN N      F   F+ G+  G    ++ +P DV KTRMQ+           +  K + 
Sbjct: 243 SSNSNWNH---FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPS--KNMF 297

Query: 62  DCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKS 107
             L+Q+ K EG   +Y G+   ++  AP  A+  ++ +   +L+ +
Sbjct: 298 KYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKRLFST 343

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 45/122 (36%), Gaps = 31/122 (25%)

Query: 210 RNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD------GNEIINGVR-------------- 249
           +  L +  VG     +  TP DVV+ R+Q        G E   G+               
Sbjct: 12  KERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDIC 71

Query: 250 -----------KYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
                      +YN TW +  KI   EG ++L++G    +L   P   V  + + ++ + 
Sbjct: 72  FEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDK 131

Query: 299 FR 300
            R
Sbjct: 132 SR 133

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 95.9 bits (237), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 129/297 (43%), Gaps = 26/297 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F+AG +AG  E  V YP +  KTR+QL      A       +  +  +    K +G   
Sbjct: 12  SFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKAS------RNPLVLIYNTAKTQGIGS 65

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV-I 134
           +Y G  + ++    K  V+F   D    L +    T +L+    V++G  AG+ E++V +
Sbjct: 66  VYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDP-KTGELSGPRGVIAGLGAGLLESVVAV 124

Query: 135 VPFELVKIRL----QDVNSKF----KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
            PFE +K  L    Q    K+    KG +     ++++ GL GLY GV     R A   A
Sbjct: 125 TPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAANQA 184

Query: 187 GYFG----VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
              G    +   V++     K K   +      G   G   V    P D VK+R+QS  +
Sbjct: 185 VRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDS 244

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
                 ++Y+ T      I+ EEG +A +KG  P++ RL   G ++  V+  V+ V 
Sbjct: 245 ------KRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVL 295

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 88/200 (44%), Gaps = 11/200 (5%)

Query: 111 TKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKG---PVEVLKHIIKQDGL 167
           +KQ+    S ++G  AG  EA V  PFE  K RLQ ++   K    P+ ++ +  K  G+
Sbjct: 4   SKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGI 63

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTF-GVMF 226
             +Y G  + +  N       F     ++ LL   K+ +      + AG   G    V+ 
Sbjct: 64  GSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLLESVVA 123

Query: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY----HEEGFRALYKGFVPKVLRLG 282
            TPF+ +K+ +  D     +   KY+     +++ Y     ++G   LY+G +P  +R  
Sbjct: 124 VTPFEAIKTALIDDKQ---SATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQA 180

Query: 283 PGGAVLLVVFTNVMNVFREF 302
              AV L  +  +  + +++
Sbjct: 181 ANQAVRLGCYNKIKVMVQDY 200

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           +N     PL     F+ GA +GI  +    P+D VKTRMQ           +  Y   I+
Sbjct: 201 TNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ--------SLDSKRYSSTIN 252

Query: 63  CLSQIVKKEGPMHMYKGISSPML 85
           C + I K+EG    +KG ++P L
Sbjct: 253 CFTTIFKEEGLKAFWKG-ATPRL 274

>Scas_379.2
          Length = 301

 Score = 95.9 bits (237), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 133/285 (46%), Gaps = 18/285 (6%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  +Q +AGA AGI E  VM+P+D +KTR+Q   ST A   S      ++  +++I   E
Sbjct: 22  PLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ---STSAKSTS-----NMLSQMAKISTAE 73

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-SVLSGASAGITE 130
           G + ++KG+ S +L   P  AV FA+  E+ K +       Q  Q + + LSG  A I  
Sbjct: 74  GSLALWKGVQSVILGAGPAHAVYFATY-EYTKKYLIDEKDMQTHQPLKTALSGTVATIAA 132

Query: 131 ALVIVPFELVKIRLQ-DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
             ++ PF+ +K R+Q + N+       V K I K +G    Y    +T+  N  + A  F
Sbjct: 133 DALMNPFDTLKQRMQLNTNTTV---WNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNF 189

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIIN--G 247
            +I++         +      + L  G  G T   +  TP D +K+ +Q  G+E ++   
Sbjct: 190 -MIYESATKFFNPTNDYNPLVHCLSGGLSGATCAAI-TTPLDCIKTVLQVRGSESVSLQV 247

Query: 248 VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           +++ N    +   IY   G +  ++G  P+V    P  A+    +
Sbjct: 248 MKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAY 292

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 77/184 (41%), Gaps = 13/184 (7%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-VEVLKHIIKQDGLKGLYSGVESTV 178
           +L+GA AGI E  V+ P + +K R+Q  ++K     +  +  I   +G   L+ GV+S +
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVI 86

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQ-EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
                 +A YF      ++ L   K  Q  +      +G V          PFD +K R+
Sbjct: 87  LGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTLKQRM 146

Query: 238 QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLG-PGGAVLLVVFTNVM 296
           Q + N  +         W    +IY  EGF A Y  + P  L +  P  A   +++ +  
Sbjct: 147 QLNTNTTV---------WNVTKQIYKNEGFSAFYYSY-PTTLAMNIPFAAFNFMIYESAT 196

Query: 297 NVFR 300
             F 
Sbjct: 197 KFFN 200

>Scas_667.22
          Length = 306

 Score = 95.9 bits (237), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 132/298 (44%), Gaps = 34/298 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG   GI++++V  P D  K R+Q   +   A          ++ + +++K EGP  
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----------MEVIRKLLKNEGPKG 77

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL-----SGASAGITE 130
            YKG  +P++      +++F  N+   + + S       T QI  L      G + GIT 
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR--NPDSTSQILSLPQYYICGLTGGITN 135

Query: 131 ALVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           + +  P E V+IRLQ       N +FKGP++ ++ +  Q    G   G+  T+ R     
Sbjct: 136 SFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG---GFMRGLTPTMLREGHGC 192

Query: 186 AGYFGVIFQVRELLPVAKS--KQEKTRNDLCA-GFVGGTFGVMFNTPFDVVKSRIQSDGN 242
             YF ++++      + K   + E     LC  G + GT   M   P DV+KS +Q+D  
Sbjct: 193 GTYF-LVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL 251

Query: 243 EIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           +      KY  +  SV K +Y + G  A +KGF P +LR  P        F   M + 
Sbjct: 252 K----SPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMRLL 305

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 32/80 (40%), Gaps = 8/80 (10%)

Query: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY 262
           K    +   DL AG  GG   V+   PFD  K R+Q+                  + K+ 
Sbjct: 19  KHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT--------AMEVIRKLL 70

Query: 263 HEEGFRALYKGFVPKVLRLG 282
             EG +  YKG +  ++ +G
Sbjct: 71  KNEGPKGFYKGTLTPLIGVG 90

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 95.9 bits (237), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 128/290 (44%), Gaps = 24/290 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +A    + V  P D VKTRMQLQ    A  A    Y   I     I K EG   +
Sbjct: 24  FVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKV--YTNPIQAFGVIFKNEGIAGL 81

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ-----ISVLSGASAGITEA 131
            KG++S  L +      +    +    +  +VF     + +     I+V +GA++G+  A
Sbjct: 82  QKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGA 141

Query: 132 LVIVPFELVKIRLQDVN--------SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
            +  P  LVK R+Q  +        + +      L  I + +G+KGL+ GV++ + R  +
Sbjct: 142 FIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGI 201

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTPFDVVKSRIQSDGN 242
            +A    +    +  L       + T   L +  + G   GV  N P+DVV +R+ +   
Sbjct: 202 GSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMN-PWDVVLTRVYNQKG 260

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
            +      Y+      +K    EG  ALYKGF  ++LR+GP   VL + F
Sbjct: 261 NL------YSGPIDCFIKTVRNEGLSALYKGFGAQILRIGP-HTVLCLTF 303

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 84/200 (42%), Gaps = 15/200 (7%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLY 171
           S ++G  A      V  PF+ VK R+Q       +    +  P++    I K +G+ GL 
Sbjct: 23  SFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQ 82

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELL------PVAKSKQEKTRNDLCAGFVGGTFGVM 225
            G+ S        N    G    +R +L       V   K +    ++ AG   G  G  
Sbjct: 83  KGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAF 142

Query: 226 FNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284
             +P  +VK+R+QS  N I I     Y   +  +  I+  EG + L++G    +LR G G
Sbjct: 143 IGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAMLRTGIG 202

Query: 285 GAVLLVVFTNVMNVFREFHE 304
            AV L ++ N+   F   H+
Sbjct: 203 SAVQLPIY-NICKNFLLKHD 221

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             ++  IAG    + M P DVV TR+  Q            Y G IDC  + V+ EG   
Sbjct: 230 HLLSSTIAGFGVGVAMNPWDVVLTRVYNQ--------KGNLYSGPIDCFIKTVRNEGLSA 281

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
           +YKG  + +L   P   +     ++ +KL  SV
Sbjct: 282 LYKGFGAQILRIGPHTVLCLTFMEQTLKLVYSV 314

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 141/307 (45%), Gaps = 26/307 (8%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           S+  T++ +   + F+AG++AG +E  + YP +  KTR+QL      A       +  + 
Sbjct: 2   SSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKAS------RNPLV 55

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS 122
            + +  K +G   +Y G  + ++    K  ++F   D    + +    T +L+    V++
Sbjct: 56  LIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDS-ETGELSGTRGVIA 114

Query: 123 GASAGITEAL-VIVPFELVKIRL----QDVNSKF----KGPVEVLKHIIKQDGLKGLYSG 173
           G  AG+ E++  + PFE +K  L    Q    K+    +G V     +++  G  GLY G
Sbjct: 115 GLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRG 174

Query: 174 VESTVWRNAVWNAGYFGVIFQVRELL-PVAKSKQEKTRNDLCAGFVGGTFGV--MFNT-P 229
           V     R A   A   G   +++ L+     S ++K  +      VG   G+  +++T P
Sbjct: 175 VLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMP 234

Query: 230 FDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289
            D VK+R+QS  +       KY+ T      I+ EEG +  +KG  P++ RL   G ++ 
Sbjct: 235 LDTVKTRMQSLDST------KYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVF 288

Query: 290 VVFTNVM 296
            ++  V+
Sbjct: 289 TIYEKVL 295

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 87/194 (44%), Gaps = 11/194 (5%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKG---PVEVLKHIIKQDGLKGLYSGVE 175
           S L+G+ AG  EA +  PFE  K RLQ ++   K    P+ ++    K  G+  +Y G  
Sbjct: 15  SFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCP 74

Query: 176 STVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTF-GVMFNTPFDVVK 234
           + +  N       F     ++++L  +++ +      + AG   G    V   TPF+ +K
Sbjct: 75  AFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIK 134

Query: 235 SRIQSDGNEIINGVRKYNWTWPSVMKIY----HEEGFRALYKGFVPKVLRLGPGGAVLLV 290
           + +  D     +   KY+     V++ Y     ++GF  LY+G +P  +R     AV L 
Sbjct: 135 TALIDDKQ---SATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLG 191

Query: 291 VFTNVMNVFREFHE 304
            +  +  + +++ +
Sbjct: 192 CYNKIKTLIQDYTD 205

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 94.4 bits (233), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 135/303 (44%), Gaps = 30/303 (9%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +AG     V+ P + VK  +Q+Q ST A      + +G++  + Q+ ++EG   +
Sbjct: 26  FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTA------YNQGIVGAVRQVYREEGTPGL 79

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK---QLTQQISVLSGASAGITEALV 133
           ++G     +   P  AV+F   +   K +  V G+K   QL     + SGA  G    L 
Sbjct: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLA 139

Query: 134 IVPFELVKIRL--QDVN------------SKFKGPVEVLKHIIKQDG-LKGLYSGVESTV 178
             P +LV+ RL  Q  N            SK  G  ++L    K++G +KGLY GV  T 
Sbjct: 140 TYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTS 199

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
                + A  F V  Q +E +P            L  G + G        PFD+++ R Q
Sbjct: 200 LGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ 259

Query: 239 ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
                GNE+  G R Y     +++ I   EGFR  YKG    + ++ P  AV  +V+  V
Sbjct: 260 VLAMGGNEL--GFR-YKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVV 316

Query: 296 MNV 298
            ++
Sbjct: 317 CDL 319

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 88/179 (49%), Gaps = 16/179 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVS-----TGAAGASATHYKGVIDCLSQIVKK 70
           +  +GA+ G   ++  YPLD+V+TR+ +Q +     + +   + +   GV D L +  K+
Sbjct: 125 RLFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKE 184

Query: 71  EGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS-GASAGI 128
           EG +  +Y+G+    L   P  A+ FA  ++F +      GT         LS GA +G 
Sbjct: 185 EGGIKGLYRGVWPTSLGVVPYVALNFAVYEQFKEFMPE--GTDNTLANFYKLSIGALSGG 242

Query: 129 TEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180
               V  PF+L++ R Q       ++  ++K  ++ L  I K +G +G Y G+ + +++
Sbjct: 243 VAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 98/202 (48%), Gaps = 21/202 (10%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDVNSKF---KGPVEVLKHIIKQDGLKGLYSG 173
            ++ L+G  AG     V+ PFE VKI LQ  NS     +G V  ++ + +++G  GL+ G
Sbjct: 23  NVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRG 82

Query: 174 VESTVWRNAVWNAGYFGVIFQV--RELLPVAKSK-QEKTRN--DLCAGFVGGTFGVMFNT 228
                 R   ++A  F V+++   +    V  SK +E+ +N   L +G + G   V+   
Sbjct: 83  NGLNCIRIFPYSAVQF-VVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATY 141

Query: 229 PFDVVKSR--IQSDGNEIINGVRKYNWT-----WPSVMKIYHEE-GFRALYKGFVPKVLR 280
           P D+V++R  IQ+     ++  R +N +     W  + + Y EE G + LY+G  P  L 
Sbjct: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201

Query: 281 LGPGGAVLLVVFTNVMNVFREF 302
           + P  A+   V+      F+EF
Sbjct: 202 VVPYVALNFAVYEQ----FKEF 219

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           Y+   GA++G     V YP D+++ R Q+    G        YK V+D L  I K EG  
Sbjct: 232 YKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGG--NELGFRYKSVMDALITIGKTEGFR 289

Query: 75  HMYKGISSPMLMEAPKRAVKF 95
             YKG+++ +    P  AV +
Sbjct: 290 GYYKGLTANLFKVIPSTAVSW 310

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 93.6 bits (231), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 127/292 (43%), Gaps = 35/292 (11%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-M 76
           + G+IAG    ++ YP D VK R+Q Q         A  +     C+      EG     
Sbjct: 11  LYGSIAGAVGKVIEYPFDTVKVRLQTQ--------PAHMFPTTWSCIKFTYDNEGLWRGF 62

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS--VLSGASAGITEALVI 134
           Y+GI SP+   A + AV F S ++     K +   + L   +S  V +GA AG   + V+
Sbjct: 63  YQGIGSPLAGAALENAVLFVSFNQA----KRLLDVESLLSPLSKTVWAGAFAGACASFVL 118

Query: 135 VPFELVKIRLQDVN-----SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            P EL+K +LQ  N     +     +  +K ++ + G  GL+ G   T  R +   A +F
Sbjct: 119 TPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWF 178

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT---PFDVVKSRIQSDGNEIIN 246
                V+  L   +  ++ T  +L A   G + G+ FN    P D +KS +Q+D  ++ +
Sbjct: 179 TTYEVVKNYLASRRQAEQNTTWELLAS--GASAGLAFNASIFPADTIKSTMQTDHIDLSS 236

Query: 247 GVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
             R          KIY  +G    Y+G    ++R  P  A +   +  + +V
Sbjct: 237 ATR----------KIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETLSSV 278

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 5/180 (2%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSK-FKGPVEVLKHIIKQDGL-KGLYSGVEST 177
           +L G+ AG    ++  PF+ VK+RLQ   +  F      +K     +GL +G Y G+ S 
Sbjct: 10  ILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSP 69

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
           +   A+ NA  F    Q + LL V +S        + AG   G       TP +++K ++
Sbjct: 70  LAGAALENAVLFVSFNQAKRLLDV-ESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKL 128

Query: 238 QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMN 297
           Q   + +      +    P++  +  E GF  L++G     +R   GGA     +  V N
Sbjct: 129 QV--SNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKN 186

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 9/179 (5%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQL-QVSTGAAGASATHYKGVIDCLSQIVKK 70
           P      AGA AG     V+ P++++K ++Q+  +ST     + T +  ++  +  ++ +
Sbjct: 99  PLSKTVWAGAFAGACASFVLTPVELIKCKLQVSNLST-----TKTSHTKILPTIKSVLSE 153

Query: 71  EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITE 130
            G + +++G S   + E+   A  F + +       S    +Q T    + SGASAG+  
Sbjct: 154 RGFLGLWQGQSGTFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAF 213

Query: 131 ALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
              I P + +K  +Q  +          + I  + G+ G Y G+  T+ R    NA  F
Sbjct: 214 NASIFPADTIKSTMQTDHIDLSSAT---RKIYARQGIAGFYRGLGITLIRAVPANAAIF 269

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 7/87 (8%)

Query: 207 EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEG 266
           E+   D+  G + G  G +   PFD VK R+Q+    +      +  TW  +   Y  EG
Sbjct: 4   EEAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHM------FPTTWSCIKFTYDNEG 57

Query: 267 -FRALYKGFVPKVLRLGPGGAVLLVVF 292
            +R  Y+G    +       AVL V F
Sbjct: 58  LWRGFYQGIGSPLAGAALENAVLFVSF 84

>Kwal_26.7967
          Length = 297

 Score = 93.6 bits (231), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 132/298 (44%), Gaps = 26/298 (8%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           + F+AG++AG  E  + YP +  KTR+QL         S+T  +  +  + +  K +G  
Sbjct: 11  HSFLAGSLAGAVEASITYPFEFAKTRLQL------VDKSSTASRNPLTLIYRTAKVQGLG 64

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV- 133
            +Y G  + ++    K  V+F   D    + +    T +L+    +++G  AG+ E++V 
Sbjct: 65  AVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDP-TTGELSGPRGIVAGLGAGLLESVVA 123

Query: 134 IVPFELVKIRL----QDVNSKF----KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           + PFE +K  L    Q  + K+    +G +     ++   G  GLY GV     R A   
Sbjct: 124 VTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAANQ 183

Query: 186 AGYFGVIFQVRELLP----VAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDG 241
           A   G   +++ ++      AK K   +      G   G   V    P D VK+R+QS  
Sbjct: 184 AVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLD 243

Query: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           +       KY+ T      ++ EEG +  +KG  P++ RL   G ++  ++  V+ V 
Sbjct: 244 SS------KYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVL 295

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 89/199 (44%), Gaps = 11/199 (5%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPVEVLKHIIKQDGLK 168
           KQ+    S L+G+ AG  EA +  PFE  K RLQ V+   +  + P+ ++    K  GL 
Sbjct: 5   KQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTASRNPLTLIYRTAKVQGLG 64

Query: 169 GLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTF-GVMFN 227
            +Y G  + +  N       F     ++ +L    + +      + AG   G    V+  
Sbjct: 65  AVYVGCPAFIVGNTAKAGVRFLGFDAIKNILRDPTTGELSGPRGIVAGLGAGLLESVVAV 124

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY----HEEGFRALYKGFVPKVLRLGP 283
           TPF+ +K+ +  D     +   KY+     +++ Y    +++GF  LY+G +P  +R   
Sbjct: 125 TPFEAIKTALIDDKQ---SASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAA 181

Query: 284 GGAVLLVVFTNVMNVFREF 302
             AV L  +  +  + +++
Sbjct: 182 NQAVRLGCYNKIKTMIQDY 200

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           +N     PL     F+ GA +GI  +    P+D VKTRMQ           ++ Y   I+
Sbjct: 201 TNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ--------SLDSSKYSSTIN 252

Query: 63  CLSQIVKKEGPMHMYKGISSPML 85
           C + + ++EG    +KG ++P L
Sbjct: 253 CFATVFREEGLKTFWKG-ATPRL 274

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 93.2 bits (230), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 132/279 (47%), Gaps = 9/279 (3%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  YQ  AGA AGI E  +M+P+D +KTRMQ   +TG++ A+      ++  +++I   E
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLP-SNMLAQIAKISTTE 74

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-SVLSGASAGITE 130
           G + ++KG+ S +L   P  AV FA+  E  K        +Q  Q + + LSG  A +  
Sbjct: 75  GSLALWKGVQSVVLGAGPAHAVYFATY-EMCKSRLIDPEDRQTHQPLKTALSGTLATVAA 133

Query: 131 ALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG 190
             ++ PF+ +K RLQ   S       V   + +++G+   +    +T+  N  + A  F 
Sbjct: 134 DALMNPFDTIKQRLQLHPSDSMTKCAV--RMYQREGIAAFFYSYPTTIAMNIPFAALNF- 190

Query: 191 VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIING--V 248
           VI++    +    +      + LC G  G T   +  TP D VK+ +Q  G + +     
Sbjct: 191 VIYESSTKIFNPSNNYNPWIHCLCGGISGATCAAI-TTPLDCVKTVLQIRGADSVQSQLF 249

Query: 249 RKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
           ++ +    +   I+   G+   ++G  P+++   P  A+
Sbjct: 250 KEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAI 288

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 37/87 (42%), Gaps = 13/87 (14%)

Query: 213 LCAGFVGGTF--GVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVM-----KIYHEE 265
           L AG   G     +MF  P D +K+R+Q+      +   +     PS M     KI   E
Sbjct: 21  LAAGAFAGIMEHSIMF--PIDAIKTRMQAVSTTGSSAATRL----PSNMLAQIAKISTTE 74

Query: 266 GFRALYKGFVPKVLRLGPGGAVLLVVF 292
           G  AL+KG    VL  GP  AV    +
Sbjct: 75  GSLALWKGVQSVVLGAGPAHAVYFATY 101

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 93.2 bits (230), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 143/306 (46%), Gaps = 45/306 (14%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AG+++G+   M   P+D VK R QLQ            YKG+   +  I+K+EG   ++
Sbjct: 23  IAGSVSGVFARMATAPMDTVKIRYQLQ------PVQEDKYKGIASTVRTIMKEEGLRALW 76

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS-GASAGITEALVIVP 136
           KG      M     AV+F S   F  +W + F   + +QQ   L+ GA AG+T ++V  P
Sbjct: 77  KGNIPATAMYVVYGAVQFGSYSWFNNVWSAKF--PRFSQQGQTLTVGALAGMTSSVVSYP 134

Query: 137 FELVKIRLQDVNSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV 195
            +L++ RL    +  +  V E  + +   +G++G ++G+ + +    +  A    ++F  
Sbjct: 135 LDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTA----IMFLT 190

Query: 196 RELLPVAKSKQEK--------TRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIING 247
            E + +     EK          + + AGFV  T  ++F  P D ++ R+Q     ++N 
Sbjct: 191 YETVNIVCENHEKEFWSRPVSASSGIIAGFVSKT--MVF--PIDTLRRRMQ-----VMNS 241

Query: 248 VRKYNWT-WPSV-------------MKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFT 293
            R  ++T +P+V              KI  +EG  ALY+G    + +  P  A+ L V+ 
Sbjct: 242 KRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYE 301

Query: 294 NVMNVF 299
             M++F
Sbjct: 302 RTMDLF 307

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 40/94 (42%), Gaps = 14/94 (14%)

Query: 211 NDLCAGFVGGTFGVMFNTPFDVVKSR-----IQSDGNEIINGVRKYNWTWPSVMKIYHEE 265
           N + AG V G F  M   P D VK R     +Q D         KY     +V  I  EE
Sbjct: 20  NSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQED---------KYKGIASTVRTIMKEE 70

Query: 266 GFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           G RAL+KG +P        GAV    ++   NV+
Sbjct: 71  GLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVW 104

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 92.8 bits (229), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 138/314 (43%), Gaps = 56/314 (17%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           AG I GI++++V  P D  K R+Q   +              ++ L  +VK EG    YK
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT----------LEVLRNLVKNEGVFAFYK 89

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ--LTQQISVLS-------------G 123
           G  +P+L      +V+F  N+   + +++   +K   ++ Q   LS             G
Sbjct: 90  GALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCG 149

Query: 124 ASAGITEALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQDGL-KGLYSGVEST 177
            + G+  + +  P E ++IRLQ   S     +FKGP + +K +  Q GL +GL+      
Sbjct: 150 LTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLMRGLFP----- 204

Query: 178 VWRNAVWNAGY-FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPF 230
                +  AG+  G  F V E L   +     TRN+     LC  G   GT   +   P 
Sbjct: 205 ----TMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPL 260

Query: 231 DVVKSRIQSDGNEIINGVRK--YNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAV 287
           DVVKS IQ+D       +RK  Y  +   V K IY +EG RA +KGF P ++R  P    
Sbjct: 261 DVVKSIIQNDD------LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGA 314

Query: 288 LLVVFTNVMNVFRE 301
             + F  VM    E
Sbjct: 315 TFLTFELVMRFLGE 328

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 87/203 (42%), Gaps = 24/203 (11%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            + +G   GI + LV  PF+  K+RLQ   ++    +EVL++++K +G+   Y G  + +
Sbjct: 37  DIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-LEVLRNLVKNEGVFAFYKGALTPL 95

Query: 179 WRNAVWNAGYFGV------IFQ----------VRELLPVAKSKQEKTRNDLCAGFVGGTF 222
               +  +  FGV       FQ            + + +++S           G  GG  
Sbjct: 96  LGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVV 155

Query: 223 GVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLG 282
                +P + ++ R+Q+  +    G R++   W  + K+  + G   L +G  P ++R G
Sbjct: 156 NSFLASPIEQIRIRLQTQTSN--GGDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAG 210

Query: 283 PGGAVLLVVFTNVMNVFREFHEG 305
            G     +V+  +  V RE   G
Sbjct: 211 HGLGTYFLVYEAL--VAREIGTG 231

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 82/195 (42%), Gaps = 21/195 (10%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           S  NT   LP    ++ G   G+    +  P++ ++ R+Q Q S G        +KG  D
Sbjct: 135 SRSNT---LPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGG----DREFKGPWD 187

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS--- 119
           C+ ++  + G M   +G+   M+         F   +  +       GT     +I    
Sbjct: 188 CIKKLKAQGGLM---RGLFPTMIRAGHGLGTYFLVYEALV---AREIGTGLTRNEIPPWK 241

Query: 120 -VLSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPVE-VLKHIIKQDGLKGLYSGV 174
             L GA +G    L + P ++VK  +Q+ +    K+K  +  V K I  ++G++  + G 
Sbjct: 242 LCLFGAFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGF 301

Query: 175 ESTVWRNAVWNAGYF 189
             T+ R+A  N   F
Sbjct: 302 GPTMVRSAPVNGATF 316

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 92.4 bits (228), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 132/303 (43%), Gaps = 39/303 (12%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG IAG     V+ P + VK  +Q+Q ST A      + KG+ D + Q+ K+E    +
Sbjct: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSSTTA------YNKGLFDAIGQVYKEENIKGL 80

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT------KQLTQQISVLSGASAGITE 130
           ++G     +   P  AV+F     F    K +F        +QL     + SGA  G   
Sbjct: 81  FRGNGLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCS 137

Query: 131 ALVIVPFELVKIRL--QDVN---------SKFKGPVEVLKHIIK----QDGLKGLYSGVE 175
            +   P +LV+ RL  Q  N         S    P  V K + K    + G+ GLY GV 
Sbjct: 138 VVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVW 197

Query: 176 STVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL---CAGFVGGTFGVMFNTPFDV 232
            T      + A  F V  Q++E +P  ++     R+ L     G + G        PFD+
Sbjct: 198 PTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDL 257

Query: 233 VKSRIQ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289
           ++ R Q     GNE+  G   YN  W +++ I   EGF+  YKG    + ++ P  AV  
Sbjct: 258 LRRRFQVLAMGGNEL--GFH-YNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSW 314

Query: 290 VVF 292
           +V+
Sbjct: 315 LVY 317

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (46%), Gaps = 15/180 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVS-----TGAAGASATHYKGVIDCLSQIVKK 70
           +  +GA+ G   ++  YPLD+V+TR+ +Q +     + +  +      GV   LS+   +
Sbjct: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAE 185

Query: 71  EGP-MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKS-VFGTKQLTQQISVLS-GASAG 127
           EG  M +Y+G+    L   P  A+ FA  ++  +   S   G   +   +  LS GA +G
Sbjct: 186 EGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISG 245

Query: 128 ITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180
                +  PF+L++ R Q       ++   +    + L  I K +G KG Y G+ + +++
Sbjct: 246 GVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFK 305

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 87/192 (45%), Gaps = 17/192 (8%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ---DVNSKFKGPVEVLKHIIKQDGLKGLYSG 173
            ++ L+G  AG     V+ PFE VKI LQ      +  KG  + +  + K++ +KGL+ G
Sbjct: 24  NVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRG 83

Query: 174 VESTVWRNAVWNAGYFGVIFQ--VRELLPV-AKSKQEKTRN--DLCAGFVGGTFGVMFNT 228
                 R   ++A  F V+F+   + +  V  K K E+  N   L +G + G   V+   
Sbjct: 84  NGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATY 142

Query: 229 PFDVVKSRIQSDGNEI-------INGVRKYNWTWPSVMKIYHEE-GFRALYKGFVPKVLR 280
           P D+V++R+      +        + + K    W  + K Y EE G   LY+G  P  L 
Sbjct: 143 PLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLG 202

Query: 281 LGPGGAVLLVVF 292
           + P  A+   V+
Sbjct: 203 IVPYVALNFAVY 214

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 6/109 (5%)

Query: 1   MSSNHNTQAPL-PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKG 59
           M S+ N  + +    Y+   GAI+G     + YP D+++ R Q+    G       HY  
Sbjct: 221 MPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGG--NELGFHYNS 278

Query: 60  VIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASND---EFIKLW 105
           V D L  I K EG    YKG+++ +    P  AV +   +   +++K W
Sbjct: 279 VWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWDYMKRW 327

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 92.8 bits (229), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 132/312 (42%), Gaps = 29/312 (9%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MSSN     P    + F+AG+IAG  E  + YP +  KTR+QL      A       +  
Sbjct: 81  MSSNKPAVDPF---HSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKAS------RNP 131

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           +  +    K  G   +Y G  + ++    K  ++F   D    L +    T +L+    V
Sbjct: 132 LVLIYNTGKNYGISSIYVGCPAFIVGNTAKAGIRFLGFDTIKNLLRDK-KTGELSGFRGV 190

Query: 121 LSGASAGITEALV-IVPFELVKIRLQD--------VNSKFKGPVEVLKHIIKQDGLKGLY 171
           ++G  AG+ E++V + PFE +K  L D          +  KG V     ++   G  GLY
Sbjct: 191 VAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLY 250

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLP----VAKSKQEKTRNDLCAGFVGGTFGVMFN 227
            GV     R A   A   G   +++ L+     V K K   +      G   G   V   
Sbjct: 251 RGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTT 310

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            P D VK+R+QS     +N   +Y+ T      I+ EEG +  +KG  P++ RL   G +
Sbjct: 311 MPIDTVKTRMQS-----LNA-GQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGI 364

Query: 288 LLVVFTNVMNVF 299
           +  ++  V+ V 
Sbjct: 365 VFTIYEKVLTVL 376

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 11/192 (5%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKG---PVEVLKHIIKQDGLKGLYSGVE 175
           S L+G+ AG  EA +  PFE  K RLQ V+   K    P+ ++ +  K  G+  +Y G  
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVLIYNTGKNYGISSIYVGCP 152

Query: 176 STVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTF-GVMFNTPFDVVK 234
           + +  N       F     ++ LL   K+ +      + AG   G    V+  TPF+ +K
Sbjct: 153 AFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFRGVVAGLGAGLLESVVAVTPFEAIK 212

Query: 235 SRIQSDGNEIINGVRKYNWTWPSVM----KIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290
           + +  D       V KY      ++    K+  ++GF  LY+G +P  +R     AV L 
Sbjct: 213 TALIDDKQA---AVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVRLG 269

Query: 291 VFTNVMNVFREF 302
            +  +  + +++
Sbjct: 270 CYNKIKTLVQDY 281

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 90.9 bits (224), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 130/302 (43%), Gaps = 41/302 (13%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG   GI++++V  P D  K R+Q   +   A          ++ + +++  EGP  
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA----------MEVVRKLLANEGPRG 77

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWK----SVFGTKQLTQQISVLSGASAGITEA 131
            YKG  +P++      +++F  N+   + +      +  T  L Q  +   G + GI  +
Sbjct: 78  FYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYAC--GVTGGIVNS 135

Query: 132 LVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
            +  P E V+IRLQ       N++FKGP+E +K +      K L  G+  T+ R      
Sbjct: 136 FLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN---KALLRGLTPTILREGHGCG 192

Query: 187 GYFGVIFQVRELLPVAKSKQEK--TRNDLCA------GFVGGTFGVMFNTPFDVVKSRIQ 238
            Y    F V E L   +  + +   R D+ A      G + GT   +   P DV+KS +Q
Sbjct: 193 TY----FLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQ 248

Query: 239 SDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMN 297
           +D  +      K+  +  SV K +Y   G  A +KGF P +LR  P        F   M 
Sbjct: 249 TDNLQ----KPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMR 304

Query: 298 VF 299
           + 
Sbjct: 305 LL 306

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 79/203 (38%), Gaps = 14/203 (6%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N +  + L     +  G   GI    +  P++ V+ R+Q Q  +G    +   +KG ++C
Sbjct: 111 NADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSG----TNAEFKGPLEC 166

Query: 64  LSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLW---KSVFGTKQLTQQISV 120
           + ++   +    + +G++  +L E       F   +  I      +     K +      
Sbjct: 167 IKKLRHNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLC 223

Query: 121 LSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPV-EVLKHIIKQDGLKGLYSGVES 176
           + GA +G    L++ P +++K  +Q  N    KF   +  V K +    G+   + G   
Sbjct: 224 IFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGP 283

Query: 177 TVWRNAVWNAGYFGVIFQVRELL 199
           T+ R A  N   F        LL
Sbjct: 284 TMLRAAPANGATFATFELAMRLL 306

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 90.9 bits (224), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 126/296 (42%), Gaps = 28/296 (9%)

Query: 14  RYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGP 73
           R   ++GA++G    M++ P DV KTR+Q Q        S  HYKG     + I K EG 
Sbjct: 39  RVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQ-HYKGFFGTFATIFKDEGA 97

Query: 74  MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
             +YKG+   +L   P   + F+  D   K    +F         S  S  +AG    + 
Sbjct: 98  AGLYKGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS--SAITAGAISTVA 155

Query: 134 IVPFELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAG 187
             P  +VK RL         ++ +KG ++  + II+Q+G K LY+G+       A+    
Sbjct: 156 TNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVP-----ALLGML 210

Query: 188 YFGVIFQVRELLPVAKSKQEKT-----------RNDLCAGFVGGTFGVMFNTPFDVVKSR 236
              + F + E L +     E T           +  + A  +          P +++++R
Sbjct: 211 NVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTR 270

Query: 237 IQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           +Q   +++ N V+++    P +   Y +EGF   Y GF   ++R  P   V LV F
Sbjct: 271 MQLK-SDLPNTVQRH--LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSF 323

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 83/186 (44%), Gaps = 28/186 (15%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           PF     +   AG    +   P+ VVKTR+ LQ      G  +THYKG ID   +I+++E
Sbjct: 137 PFLSNASSAITAGAISTVATNPIWVVKTRLMLQT---GIGKYSTHYKGTIDTFRKIIQQE 193

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQ----------QISVL 121
           G   +Y G+  P L+     A++F   +      K  FG  + T           Q  +L
Sbjct: 194 GAKALYAGL-VPALLGMLNVAIQFPLYENL----KIRFGYSESTDVSTDVTSSNFQKLIL 248

Query: 122 SGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHII-------KQDGLKGLYSGV 174
           +   + +  + V  P E+++ R+Q    K   P  V +H++       +Q+G  G YSG 
Sbjct: 249 ASMLSKMVASTVTYPHEILRTRMQ---LKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGF 305

Query: 175 ESTVWR 180
            + + R
Sbjct: 306 ATNLVR 311

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 18/180 (10%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQ--------DVNSKFKGPVEVLKHIIK 163
           K    +++ +SGA +G   A+++ PF++ K RLQ          +  +KG       I K
Sbjct: 34  KNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFK 93

Query: 164 QDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFG 223
            +G  GLY G++ TV         YF V    R+   V         ++  +    G   
Sbjct: 94  DEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRK-YSVDIFPHSPFLSNASSAITAGAIS 152

Query: 224 VMFNTPFDVVKSRIQSDGNEIINGVRKYNW----TWPSVMKIYHEEGFRALYKGFVPKVL 279
            +   P  VVK+R+      +  G+ KY+     T  +  KI  +EG +ALY G VP +L
Sbjct: 153 TVATNPIWVVKTRLM-----LQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 132/296 (44%), Gaps = 46/296 (15%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-MYK 78
           G+IAG    ++ +P D VK R+Q Q S          +     C+    + EG     ++
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQAS--------NVFPTTWSCIKFTYQNEGIARGFFQ 71

Query: 79  GISSPMLMEAPKRAVKFASNDE---FIKLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135
           GI+SP++    + A  F S ++   F++   +VF   Q+     ++SG  AG   +LV+ 
Sbjct: 72  GIASPLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQI-----LISGGVAGSCASLVLT 126

Query: 136 PFELVKIRLQDVN-------SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
           P ELVK +LQ  N       +K    +  +K II + GL GL+ G   T  R +     +
Sbjct: 127 PVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAW 186

Query: 189 FGVIFQVRELLPVAKSKQEKTRND------LCAGFVGGTFGVMFNT---PFDVVKSRIQS 239
           F     V++ L    S  +  R++      L +   GG+ G+ FN    P D VKS +Q+
Sbjct: 187 FATYEIVKKSLKDRHSLDDPKRDESKIWELLIS---GGSAGLAFNASIFPADTVKSVMQT 243

Query: 240 DGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
           +   + N V+          KI+ + G +  Y+G    + R  P  A +  +F  +
Sbjct: 244 EHISLTNAVK----------KIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETL 289

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 84/195 (43%), Gaps = 15/195 (7%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSK-FKGPVEVLKHIIKQDGL-KGLYSGVE 175
           + +++G+ AG    ++  PF+ VK+RLQ   S  F      +K   + +G+ +G + G+ 
Sbjct: 15  LDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIA 74

Query: 176 STVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRN------DLCAGFVGGTFGVMFNTP 229
           S +    + NA  F    Q  + L       EK  N       L +G V G+   +  TP
Sbjct: 75  SPLVGACLENATLFVSYNQCSKFL-------EKHTNVFPLGQILISGGVAGSCASLVLTP 127

Query: 230 FDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289
            ++VK ++Q    ++ +   K+    P++  I  E G   L++G     +R   GG    
Sbjct: 128 VELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWF 187

Query: 290 VVFTNVMNVFREFHE 304
             +  V    ++ H 
Sbjct: 188 ATYEIVKKSLKDRHS 202

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 135/310 (43%), Gaps = 33/310 (10%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +AG     V+ P + VK  +Q+Q ST       ++ +G+   + Q+  +EG   +
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSST------TSYNRGIFSSIRQVYHEEGTKGL 79

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT---KQLTQQISVLSGASAGITEALV 133
           ++G     +   P  AV+F   +   K    V G    +QLT    + SGA  G    + 
Sbjct: 80  FRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVA 139

Query: 134 IVPFELVKIRL--QDVN------------SKFKGPVEVLKHIIK-QDGLKGLYSGVESTV 178
             P +L+K RL  Q  N            SK  G  ++L    + + GL+GLY GV  T 
Sbjct: 140 TYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTS 199

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL---CAGFVGGTFGVMFNTPFDVVKS 235
                + A  F V  Q+RE    +   Q   +++L     G + G        PFD+++ 
Sbjct: 200 LGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRR 259

Query: 236 RIQ---SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           R Q     GNE+  G R Y   W +++ I   EG    YKG    + ++ P  AV  +V+
Sbjct: 260 RFQVLAMGGNEL--GFR-YTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVY 316

Query: 293 TNVMNVFREF 302
             V +  R +
Sbjct: 317 EVVCDSVRNW 326

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 89/196 (45%), Gaps = 25/196 (12%)

Query: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAA-----GASATHYKG 59
           +N Q  L    +  +GA+ G   ++  YPLD++KTR+ +Q +  ++       S +   G
Sbjct: 114 NNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPG 173

Query: 60  VIDCLSQIVKKEGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI 118
           +   LS+  + EG +  +Y+G+    L   P  A+ FA  ++  +     FG      Q 
Sbjct: 174 IWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYEQLRE-----FGVNSSDAQP 228

Query: 119 SVLS-------GASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQ 164
           S  S       GA +G     +  PF+L++ R Q       ++  ++    + L  I + 
Sbjct: 229 SWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRA 288

Query: 165 DGLKGLYSGVESTVWR 180
           +G+ G Y G+ + +++
Sbjct: 289 EGVSGYYKGLAANLFK 304

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 93/202 (46%), Gaps = 21/202 (10%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ---DVNSKFKGPVEVLKHIIKQDGLKGLYSG 173
            I+ L+G  AG     V+ PFE VKI LQ      S  +G    ++ +  ++G KGL+ G
Sbjct: 23  NIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRG 82

Query: 174 VESTVWRNAVWNAGYFGVIFQV--RELLPV-AKSKQEKTRND--LCAGFVGGTFGVMFNT 228
                 R   ++A  F V+++   ++L  V   + QE+  N   L +G + G   V+   
Sbjct: 83  NGLNCIRIFPYSAVQF-VVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATY 141

Query: 229 PFDVVKSR--IQSDGNEIIN-----GVRKYNWTWPSVMKIYH-EEGFRALYKGFVPKVLR 280
           P D++K+R  IQ+     +N      + K    W  + + Y  E G R LY+G  P  L 
Sbjct: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLG 201

Query: 281 LGPGGAVLLVVFTNVMNVFREF 302
           + P  A+   V+  +    REF
Sbjct: 202 VVPYVALNFAVYEQL----REF 219

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 138/285 (48%), Gaps = 30/285 (10%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQL-QVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
           F+AG  +G+++  V +P D VK R+Q  QV +GA       +KG +DC+ + +K +G   
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAG----IQFKGPLDCVYKTLKNQGIRG 68

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEF-IKLWKSVFGT-KQLTQQISVLSGASAGITEALV 133
           +Y G + P+       +    S   + + L K V+    +L     ++SG  AG T + +
Sbjct: 69  LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128

Query: 134 IVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQD--------GLKGLYSGVEST-VWR 180
             P EL K +LQ       +K+ GP++V++ + KQ         G++ LY G+ ST ++R
Sbjct: 129 AAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR 188

Query: 181 -NAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-PFDVVKSRIQ 238
            N V+  G + +I Q  +      +       +  AG +  +FG   +  P DVVK  + 
Sbjct: 189 SNFVFWWGSYELITQWFQ----KNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244

Query: 239 SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
              N+  +G  K +W   +V  IY + G    +KGF+P  LR  P
Sbjct: 245 C--NDKYDGSFK-SWR-TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 38/192 (19%)

Query: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKK 70
           LP     ++G +AG +   +  P+++ K ++Q+Q       A  T Y G ID + ++ K+
Sbjct: 109 LPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYD-----AKTTKYTGPIDVVQKVFKQ 163

Query: 71  --------EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS 122
                    G   +YKG+ S ++         F SN  F+  W S     Q  Q+ + LS
Sbjct: 164 GMATNGILGGVRSLYKGLISTLI---------FRSN--FVFWWGSYELITQWFQKNTNLS 212

Query: 123 ---------GASAGITEALVIVPFELVKIRLQDVNSKFKGPVE----VLKHIIKQDGLKG 169
                    G SA         P ++VK ++   N K+ G  +     +  I +Q G+ G
Sbjct: 213 APAINFWAGGLSASFGFWTSAYPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHG 271

Query: 170 LYSGVESTVWRN 181
            + G   +  R+
Sbjct: 272 FFKGFLPSFLRS 283

>Kwal_26.7653
          Length = 325

 Score = 90.1 bits (222), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 129/297 (43%), Gaps = 25/297 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-YKGVIDCLSQIVKKEGPMH 75
           F+AG +A    + V  P+++VKTRMQLQ   G   A A   YK  +  L  I K EG   
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQ---GEMSADAQRIYKNPMQALKVIFKNEGIRG 84

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-----GTKQLTQQISVLSGASAGITE 130
           + KG+S   + +      +    +    +    F       K     ++V+SGA++GI  
Sbjct: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144

Query: 131 ALVIVPFELVKIRLQDVNSKFKGPVEV--------LKHIIKQDGLKGLYSGVESTVWRNA 182
           A++  P  L+K R+Q  ++  +   +         L  I + +G KGLY GV++ + R  
Sbjct: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204

Query: 183 VWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTPFDVVKSRIQSDG 241
             ++    +    +  L      +E T   L A  V G   GV+ N P+DV+ +R+ +  
Sbjct: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTRVYNQK 263

Query: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
             +      Y       +K    EG  ALYKGF  ++ R+ P   + L      M V
Sbjct: 264 GNL------YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 89/197 (45%), Gaps = 14/197 (7%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQ 164
           +++++  S ++G  A      V  P ELVK R+Q       D    +K P++ LK I K 
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN 79

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL------PVAKSKQEKTRNDLCAGFV 218
           +G++GL  G+          N    G    +R +L       +   K +    ++ +G  
Sbjct: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139

Query: 219 GGTFGVMFNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPK 277
            G  G +  +P  ++K+R+QS  N I I     Y   W  +  IY  EGF+ LY+G    
Sbjct: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199

Query: 278 VLRLGPGGAVLLVVFTN 294
           +LR G G +V L ++  
Sbjct: 200 ILRTGAGSSVQLPIYNT 216

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 130/295 (44%), Gaps = 21/295 (7%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +A    + V  P++++K RMQLQ    A+ A    YK  I  ++ I K EG   +
Sbjct: 26  FVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKV--YKNPIQGMAVIFKNEGIKGL 83

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-----SVLSGASAGITEA 131
            KG+++  + +      +    +        +F   Q   ++     +V SGA++GI  A
Sbjct: 84  QKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGA 143

Query: 132 LVIVPFELVKIRLQDVN--------SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           ++  P  LVK RLQ  +        + + G    L  I K +G+KGL+ G+++ + R   
Sbjct: 144 VIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGA 203

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
            ++    +    + +L      ++     L A  + G    +   P+DV+ +RI +   +
Sbjct: 204 GSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 263

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           +      Y      ++K    EG  ALYKGF  +V R+ P   + L      M +
Sbjct: 264 L------YKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKL 312

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 83/195 (42%), Gaps = 14/195 (7%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLY 171
           S ++G  A      V  P EL+KIR+Q            +K P++ +  I K +G+KGL 
Sbjct: 25  SFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQ 84

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELL------PVAKSKQEKTRNDLCAGFVGGTFGVM 225
            G+ +        N    G    +R  L           K +    ++ +G   G  G +
Sbjct: 85  KGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAV 144

Query: 226 FNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284
             +P  +VK+R+QS    I I     Y   W  ++ I+  EG + L++G    +LR G G
Sbjct: 145 IGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAG 204

Query: 285 GAVLLVVFTNVMNVF 299
            +V L ++    N+ 
Sbjct: 205 SSVQLPIYNTAKNIL 219

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
              A  I+G+   +VM P DV+ TR+  Q            YKG IDCL + V+ EG   
Sbjct: 232 HLTASTISGLGVAVVMNPWDVILTRIYNQ--------KGDLYKGPIDCLVKTVRIEGVTA 283

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
           +YKG ++ +   AP   +     ++ +KL  S+
Sbjct: 284 LYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSI 316

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 131/301 (43%), Gaps = 23/301 (7%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MSS+   Q    F   F+ G ++         P++ VK  +Q Q      G     Y G+
Sbjct: 1   MSSDAKQQET-NFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGI 59

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQ---- 116
           +DC  +  K+EG +  ++G ++ ++   P +A+ FA  D+ IKL   +FG K+       
Sbjct: 60  VDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDK-IKL---MFGFKKEEGYGKW 115

Query: 117 -QISVLSGASAGITEALVIVPFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDGL 167
              ++ SG +AG    L +   +  + RL  D  S       +F G  +V K  +K DG+
Sbjct: 116 FAGNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGI 175

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFN 227
            GLY G   +V    V+   YFG+   ++ L+ +  S           G+V  T     +
Sbjct: 176 AGLYRGFMPSVVGIVVYRGLYFGMFDSLKPLV-LTGSLDGSFLASFLLGWVVTTGASTCS 234

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            P D V+ R+     + +    KYN     + KI   EG  +L+KG    +LR   G  V
Sbjct: 235 YPLDTVRRRMMMTSGQAV----KYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV 290

Query: 288 L 288
           +
Sbjct: 291 I 291

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 53/288 (18%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQL-QVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
             +AG   GI++++V  P D  K R+Q  + ST A           +  +  ++K EGPM
Sbjct: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-----------VKVIKDLIKNEGPM 74

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL----SGASAGITE 130
             YKG  +P++      +++F  N+   + + +    +  +Q +S+L     G + G T 
Sbjct: 75  GFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF--DEAASQHLSLLQYYICGVAGGFTN 132

Query: 131 ALVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           + +  P E ++IRLQ        ++FKGP++ +K + + +G   L  G+  T+ R +   
Sbjct: 133 SFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRESHG- 188

Query: 186 AGYFGVIFQVRELLPVAKSKQEKTRNDLCA------GFVGGTFGVMFNTPFDVVKSRIQS 239
               GV F   E L   + K    R D+ A      G   GT       P DV+KS +Q+
Sbjct: 189 ---CGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQT 245

Query: 240 D-------GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
           D       GN I+   R           I   +G   L+KGF P +LR
Sbjct: 246 DNLKTPKNGNNILTVGRT----------IIARQGVSGLFKGFAPTMLR 283

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 10/114 (8%)

Query: 193 FQVRELLPVAKSKQEKTR--NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRK 250
           F   +L+   +S  + TR   DL AG  GG   V+   PFD  K R+Q+      N V+ 
Sbjct: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETS-TNAVK- 62

Query: 251 YNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304
                  +  +   EG    YKG +  ++ +G   ++   V   +   F  F E
Sbjct: 63  ------VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDE 110

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 87.8 bits (216), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 131/291 (45%), Gaps = 28/291 (9%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             + G +AG    +V YP D VK R+Q Q        SA  +     C+S   K+EG   
Sbjct: 11  DLLYGGVAGSLGKLVEYPFDTVKVRLQTQ--------SAALFPTTWSCVSHTYKQEGLWR 62

Query: 76  -MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
             Y+G++SP+     + AV F S +    + ++ +    L +   V +GA AG   + V+
Sbjct: 63  GFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK--VVFAGAIAGACTSYVL 120

Query: 135 VPFELVKIRLQDVN------SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
            P ELVK +LQ  N       ++   +  L+ I+KQ+GL GL+ G   T  R +   A +
Sbjct: 121 TPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVW 180

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-PFDVVKSRIQSDGNEIING 247
           F     ++  L   +   E T  +L A   G       +  P D VKS +Q++   +   
Sbjct: 181 FTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLGPA 240

Query: 248 VRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           VR       +V+K +   GF   Y+G    +LR  P  AV+  V+ ++  +
Sbjct: 241 VR-------TVLKKHGPTGF---YRGVGITLLRALPANAVIFYVYESLCGL 281

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 93/196 (47%), Gaps = 12/196 (6%)

Query: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL 64
            N  +  P      AGAIAG     V+ P+++VK ++Q+   TG +G     Y  V+  L
Sbjct: 94  ENCYSCGPLEKVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGP---RYTAVLPTL 150

Query: 65  SQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKS-VFGTKQLTQQISVLSG 123
             IVK+ G   +++G S   + E+   AV F +  E +K W +   G+ + T    + SG
Sbjct: 151 RAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAY-EVLKGWLARRRGSTENTVWELLASG 209

Query: 124 ASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           A AG      I P + VK  +Q  +    GP   ++ ++K+ G  G Y GV  T+ R   
Sbjct: 210 AGAGAAFHASIFPADTVKSTMQTEHLGL-GP--AVRTVLKKHGPTGFYRGVGITLLRALP 266

Query: 184 WNAGYFGVIFQVRELL 199
            NA    VIF V E L
Sbjct: 267 ANA----VIFYVYESL 278

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 41/99 (41%), Gaps = 7/99 (7%)

Query: 207 EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEG 266
           +K   DL  G V G+ G +   PFD VK R+Q+    +      +  TW  V   Y +EG
Sbjct: 6   DKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAAL------FPTTWSCVSHTYKQEG 59

Query: 267 -FRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHE 304
            +R  Y+G    V       AVL V F     V    + 
Sbjct: 60  LWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYS 98

>Scas_632.9
          Length = 292

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 133/287 (46%), Gaps = 38/287 (13%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-YKGVIDCLSQIVKKEGPMH-MY 77
           G+IAG    ++ YP D VK R+Q Q          +H +     C+      EG     +
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQTQ---------GSHIFPTTWSCIKYTYHNEGVWRGFF 74

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           +GI SP+   A + A  F S ++   + +       L+  +  LSGA AG   + V+ P 
Sbjct: 75  QGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNIL--LSGAFAGSCASFVLTPV 132

Query: 138 ELVKIRLQ--DVNSKFKGPVE------VLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
           EL+K +LQ  ++ +  +G ++       L +++++ G+ GL+ G  ST  R ++    +F
Sbjct: 133 ELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWF 192

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFV-GGTFGVMFNT---PFDVVKSRIQSDGNEII 245
                +++ L   K +++ T N      V G + G+ FN    P D VKS +Q++   +I
Sbjct: 193 ATYEVMKQGL---KDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHITLI 249

Query: 246 NGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           N V+K       V+  Y   GF   Y+G    ++R  P  A +  ++
Sbjct: 250 NAVKK-------VLTTYGITGF---YRGLGITLIRAVPANATVFYMY 286

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 200 PVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVM 259
           P+ KS  +   +D+  G + G FG +   PFD VK R+Q+ G+ I      +  TW  + 
Sbjct: 8   PIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHI------FPTTWSCIK 61

Query: 260 KIYHEEG-FRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREF 302
             YH EG +R  ++G    +       A L V +    NV  +F
Sbjct: 62  YTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKF 105

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 81/176 (46%), Gaps = 4/176 (2%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSK-FKGPVEVLKHIIKQDGL-KGLYSGVEST 177
           +++G+ AG    ++  PF+ VK+RLQ   S  F      +K+    +G+ +G + G+ S 
Sbjct: 21  IVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSP 80

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
           ++  A+ NA  F    Q   +L    +      N L +G   G+      TP +++K ++
Sbjct: 81  LFGAALENATLFVSYNQCSNVLE-KFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKL 139

Query: 238 Q-SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           Q S+    + G  K+    P++M +  E+G   L++G     +R   GG      +
Sbjct: 140 QVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATY 195

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 82/178 (46%), Gaps = 4/178 (2%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P     ++GA AG     V+ P++++K ++Q+     A      H K +I  L  +++++
Sbjct: 110 PLSNILLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTK-IIPTLMYVLREK 168

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEA 131
           G + +++G SS  + E+      FA+ +   +  K      +      ++SGASAG+   
Sbjct: 169 GILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFN 228

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
             I P + VK  +Q  +      +  +K ++   G+ G Y G+  T+ R    NA  F
Sbjct: 229 ASIFPADTVKSMMQTEHITL---INAVKKVLTTYGITGFYRGLGITLIRAVPANATVF 283

>Scas_709.9
          Length = 365

 Score = 88.6 bits (218), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 135/301 (44%), Gaps = 23/301 (7%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           ++GA+AG    +++ PLDV KTR+Q Q   G       +Y+GV+  +S IV  EG   +Y
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQ---GIQSIENPYYRGVLGTMSTIVVDEGVRGLY 125

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           KG+   +L   P   + F+  +    L+  V             S  +AG    ++  P 
Sbjct: 126 KGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISH--SCSAITAGAASTVLTNPI 183

Query: 138 ELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGV 191
            +VK RL       +  + ++G ++  K II Q+G++ LY+G+  +++   +  A +F V
Sbjct: 184 WVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF-GLLHVAIHFPV 242

Query: 192 IFQVRELLPV-----AKSKQEKTRN---DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
             +++  L         + QE + +    + A         +   P +++++R+Q   ++
Sbjct: 243 YEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDK 302

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303
           ++    K       + + Y  EG    Y GF   +LR  P  A+ LV F    N   + +
Sbjct: 303 LLISKHKL---LDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEYFRNALLKIN 359

Query: 304 E 304
           +
Sbjct: 360 Q 360

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 74/171 (43%), Gaps = 8/171 (4%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDV------NSKFKGPVEVLKHIIKQDGLKGL 170
           +I+ LSGA AG    +++ P ++ K RLQ        N  ++G +  +  I+  +G++GL
Sbjct: 65  KITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGL 124

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPF 230
           Y G+   +         YF V    ++L P      +   +  C+    G    +   P 
Sbjct: 125 YKGLIPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHS-CSAITAGAASTVLTNPI 183

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRL 281
            VVK+R+      +      Y  T  +  KI  +EG R LY G VP +  L
Sbjct: 184 WVVKTRLMLQ-TPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL 233

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 87.8 bits (216), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 126/301 (41%), Gaps = 21/301 (6%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F AG +A    + V  P++VVK RMQLQ    AA      Y      +  + + EG   +
Sbjct: 22  FTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRI--YTNPFQAMGVVFRNEGIRGL 79

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ-----ISVLSGASAGITEA 131
            KG+ +  + +      +    +    +    F   Q + +     I+V +GA++GI  A
Sbjct: 80  QKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGA 139

Query: 132 LVIVPFELVKIRLQDVNSKFK--------GPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           ++  P  LVK RLQ  ++  K        G    LK I   +G+KGL+ G+++ + R   
Sbjct: 140 VMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGA 199

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
            ++    +    +  L      ++     L A  + G    +   P+DV+ +RI +   +
Sbjct: 200 GSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGD 259

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303
           +      Y      ++K    EG  ALYKGF  +V R+GP   + L      M +   F 
Sbjct: 260 L------YKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFE 313

Query: 304 E 304
            
Sbjct: 314 S 314

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 91/204 (44%), Gaps = 18/204 (8%)

Query: 112 KQLTQQISVLSGASAGITEALVIV----PFELVKIRLQ------DVNSK-FKGPVEVLKH 160
           K   Q++S     +AG   A + V    P E+VKIR+Q        N + +  P + +  
Sbjct: 10  KSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGV 69

Query: 161 IIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL-----PVAKS-KQEKTRNDLC 214
           + + +G++GL  G+ +        N    G    +R ++     P  +S K +    ++ 
Sbjct: 70  VFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVF 129

Query: 215 AGFVGGTFGVMFNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKG 273
           AG   G  G +  +P  +VK+R+QS  N I I     Y   W  +  IY  EG + L++G
Sbjct: 130 AGAASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRG 189

Query: 274 FVPKVLRLGPGGAVLLVVFTNVMN 297
               +LR G G +V L ++    N
Sbjct: 190 IDAAILRTGAGSSVQLPIYNTAKN 213

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 130/302 (43%), Gaps = 27/302 (8%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MS N  +     F   FM G ++         P++ VK  +Q Q      G+    Y G+
Sbjct: 1   MSDNKQSN----FLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGI 56

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS- 119
           +DC  +    EG +  ++G ++ ++   P +A+ FA  D+     K++FG ++     + 
Sbjct: 57  VDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFRKEVDGYAK 112

Query: 120 -----VLSGASAGITEALVIVPFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDG 166
                + SG +AG    L +   +  + RL  D  S       +F G V+V K  +  DG
Sbjct: 113 WFAGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDG 172

Query: 167 LKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMF 226
           + GLY G   +V    V+   YFG+   ++ LL     +     + L  G+   T     
Sbjct: 173 IAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLL-GWAVTTGASTA 231

Query: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGA 286
           + P D V+ R+     + +    KY+  + +  KI   EG ++L+KG    +LR   G  
Sbjct: 232 SYPLDTVRRRMMMTSGQAV----KYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAG 287

Query: 287 VL 288
           V+
Sbjct: 288 VI 289

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 134/297 (45%), Gaps = 32/297 (10%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQ-VSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           ++GA AG    + + PLDV KTR+Q Q + T        +Y+G++  LS IV+ EGP  +
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENP---YYRGIMGTLSTIVRDEGPRGL 138

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           YKG+   +L   P   + F+  +   K +  +F       Q    +  +AG     +  P
Sbjct: 139 YKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQ--SCAAITAGAASTTLTNP 196

Query: 137 FELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG 190
             +VK RL       +  + +KG  +  + +  Q+G K LY+G+  ++        G F 
Sbjct: 197 IWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL-------GLFH 249

Query: 191 VI--FQVRELLPV---AKSKQEKTRND-----LCAGFVGGTFGVMFNTPFDVVKSRIQSD 240
           V   F + E L V     S++  T +      + A  V          P +++++R+Q  
Sbjct: 250 VAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLK 309

Query: 241 GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMN 297
            ++I + +++    +P +   Y +EG +  Y GF   ++R  P  A+ LV F    N
Sbjct: 310 -SDIPDSIQR--RLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYFRN 363

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 84/189 (44%), Gaps = 39/189 (20%)

Query: 115 TQQISVLSGASAGITEALVIVPFELVKIRLQDV-------NSKFKGPVEVLKHIIKQDGL 167
           + QI+ LSGA AG    + + P ++ K RLQ         N  ++G +  L  I++ +G 
Sbjct: 76  STQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 168 KGLYSGVESTVWRNAVWNAGYFG---VIFQVRE--------LLP----VAKSKQEKTRND 212
           +GLY G+   V        GYF    + F V E        + P    VA+S        
Sbjct: 136 RGLYKGLVPIVL-------GYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS-------- 180

Query: 213 LCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYK 272
            CA    G        P  VVK+R+    N +      Y  T+ +  K++++EGF+ALY 
Sbjct: 181 -CAAITAGAASTTLTNPIWVVKTRLMLQSN-LGEHPTHYKGTFDAFRKLFYQEGFKALYA 238

Query: 273 GFVPKVLRL 281
           G VP +L L
Sbjct: 239 GLVPSLLGL 247

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 82/176 (46%), Gaps = 11/176 (6%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F  Q  A   AG +   +  P+ VVKTR+ LQ +    G   THYKG  D   ++  +EG
Sbjct: 176 FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSN---LGEHPTHYKGTFDAFRKLFYQEG 232

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEF---IKLWKSVFGTKQLTQQISVLSGASAGIT 129
              +Y G+  P L+     A+ F   ++       +     T  +  Q  +++ + + + 
Sbjct: 233 FKALYAGL-VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMI 291

Query: 130 EALVIVPFELVKIRLQ---DV-NSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRN 181
            + V  P E+++ R+Q   D+ +S  +    ++K    Q+GLKG YSG  + + R 
Sbjct: 292 ASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRT 347

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           S  N    +  +   MA +++ +    V YP ++++TRMQL+     +    +  + +  
Sbjct: 268 SRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLK-----SDIPDSIQRRLFP 322

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEF 101
            +     +EG    Y G ++ ++   P  A+   S + F
Sbjct: 323 LIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYF 361

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 136/301 (45%), Gaps = 42/301 (13%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F    ++GA AG S  +V +P+D +KTR+Q +    A G     YKG+            
Sbjct: 4   FFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGG----YKGI------------ 47

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-------GTKQLTQQISVLSGAS 125
               Y+G+ S ++  AP  ++ F S D ++K+    +       G++QL    + +  +S
Sbjct: 48  ----YRGLGSAVVASAPGASLFFISYD-YMKVKSRPYISKLYSQGSEQLIDTTTHMLSSS 102

Query: 126 AG-ITEALVIVPFELVKIRLQ--DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNA 182
            G I   LV VP E+VK R Q    NS ++    +L++  K+   K LY G  +T+ R  
Sbjct: 103 IGEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREI 162

Query: 183 VWNAGYFGVIFQVRELLPVA--KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD 240
            +    F +   +++    A  +S+ E  +  +C    GG       TP D +K+R+  +
Sbjct: 163 PFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGG-IAAATTTPLDFLKTRLMLN 221

Query: 241 GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
                 G          +++IY EEG    + G  P+ + +  GGA+ L ++  V ++  
Sbjct: 222 KTTASLG--------SVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLLS 273

Query: 301 E 301
           +
Sbjct: 274 K 274

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 136/312 (43%), Gaps = 25/312 (8%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MS     Q+   F   F+ G ++         P++ VK  +Q Q      G+    YKG+
Sbjct: 1   MSETKKPQSN--FAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGI 58

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV 120
           +DC  +  ++EG +  ++G ++ ++   P +A+ FA  D+     K++FG K+       
Sbjct: 59  VDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQI----KAMFGFKKEEGYAKW 114

Query: 121 LSG--ASAGITEALVIV---PFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDGL 167
            +G  AS GI   L ++     +  + RL  D  S       +F G V+V K  I  DG+
Sbjct: 115 FAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGV 174

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFN 227
            GLY G   +V    V+   YFG+    + LL +  S +         G+V  T     +
Sbjct: 175 AGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLL-LTGSLEGSFIASFLLGWVVTTGASTAS 233

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            P D V+ R+     + +    KY      + KI   EG  +L+KG    +LR G  GA 
Sbjct: 234 YPLDTVRRRMMMTSGQAV----KYKGAMDCLQKIVAAEGVSSLFKGCGANILR-GVAGAG 288

Query: 288 LLVVFTNVMNVF 299
           ++ ++  +  + 
Sbjct: 289 VISLYDQLQMIL 300

>Scas_718.24
          Length = 337

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 133/297 (44%), Gaps = 23/297 (7%)

Query: 6   NTQAPLP-FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL 64
           +T+ P   F   F+ G ++         P++ VK  +Q Q      G   T YKG++DC 
Sbjct: 34  STEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCF 93

Query: 65  SQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQ-----QIS 119
            +  ++EG +  ++G ++ ++   P +A+ FA  D+ IKL   +FG K+          +
Sbjct: 94  RRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDK-IKL---MFGFKKEDGYGKWFAGN 149

Query: 120 VLSGASAGITEALVIVPFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDGLKGLY 171
           + SG +AG    L +   +  + RL  D  S       +F G ++V K  +K DG+ GLY
Sbjct: 150 LASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLY 209

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G   +V    V+   YFG+   ++ +L +  S +         G+V  T     + P D
Sbjct: 210 RGFLPSVVGIIVYRGLYFGLYDSIKPVL-LTGSLEGSFLASFLLGWVVTTGASTCSYPLD 268

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
            V+ ++     + +    KY   +    KI   EG  +L+KG    +LR   G  V+
Sbjct: 269 TVRRKMMMTSGQAV----KYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVI 321

>Scas_667.4
          Length = 308

 Score = 86.3 bits (212), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 137/308 (44%), Gaps = 23/308 (7%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MSS    +    F   F+ G ++         P++ VK  +Q Q      G+  + YKG+
Sbjct: 1   MSSKEEVKKESNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGI 60

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQ---- 116
           I+C  +  K EG +  ++G ++ ++   P +A+ FA  D+     K++FG K+       
Sbjct: 61  IECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYGKW 116

Query: 117 -QISVLSGASAGITEALVIVPFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDGL 167
              ++ SG +AG    L +   +  + RL  D  S       ++KG ++V K  +  DG+
Sbjct: 117 FAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGM 176

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFN 227
            GLY G   +V    V+   YFG+   ++  + +  S +         G++  T     +
Sbjct: 177 AGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAV-LTGSLEGSFLASFLLGWIVTTGASTAS 235

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            P D V+ R+     + +    KY+  +    K+   EG  +L+KG    +LR G  GA 
Sbjct: 236 YPLDTVRRRMMMTSGQAV----KYDGAFDCFRKVVAAEGVSSLFKGCGANILR-GVAGAG 290

Query: 288 LLVVFTNV 295
           ++ ++  +
Sbjct: 291 VISMYDQL 298

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 86.3 bits (212), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 127/289 (43%), Gaps = 22/289 (7%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F   F+ G ++         P++ VK  +Q Q      G     Y G++DC  +   +EG
Sbjct: 23  FLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEG 82

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-----SVLSGASAG 127
            +  ++G ++ ++   P +A+ FA  D+     K++FG K+          ++ SG +AG
Sbjct: 83  VISFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAGNLASGGAAG 138

Query: 128 ITEALVIVPFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDGLKGLYSGVESTVW 179
               L +   +  + RL  D  S       +F G ++V K  +K DG+ GLY G   +V 
Sbjct: 139 ALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVV 198

Query: 180 RNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQS 239
              V+   YFG+   ++ LL +  S +         G+V  T     + P D V+ R+  
Sbjct: 199 GIVVYRGLYFGMYDSLKPLL-LTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMM 257

Query: 240 DGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
              + +    KY+  +  + KI   EG  +L+KG    +LR   G  V+
Sbjct: 258 TSGQAV----KYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI 302

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 131/293 (44%), Gaps = 22/293 (7%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQ-----------LQVSTGAAGASATHYKGV 60
           P  YQ +AGA AGI E  +M+P+D +KTRMQ                  A +       +
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK---LWKSVFGTKQLTQQ 117
           +  +S+I   EG + +++G+ S ++   P  AV FA+  EF K   +    F T Q  + 
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATY-EFCKEQLIDAKDFNTHQPLK- 136

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQ-DVNSKFKGPVEVLKHIIKQDGLKGLYSGVES 176
            + +SG +A +    ++ PF+ +K RLQ    S       +  +I K +G    +    +
Sbjct: 137 -TAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPT 195

Query: 177 TVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSR 236
           T+  N  + A  F VI++         +      + LC G  G T   +  TP D +K+ 
Sbjct: 196 TLAMNIPFAALNF-VIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAAV-TTPLDCIKTV 253

Query: 237 IQSDGNEIIN--GVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
           +Q  G++ ++    +  N    +   I+   G++  ++G  P+V+   P  A+
Sbjct: 254 LQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAI 306

>Kwal_56.23011
          Length = 303

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/296 (27%), Positives = 126/296 (42%), Gaps = 37/296 (12%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQ-VSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
             G + G+++++V  P D+ K R+Q   V T AA             +  +VK EG +  
Sbjct: 28  FCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAA-----------QVIKSLVKNEGLLAF 76

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT--KQLTQQISVLSGASAGITEALVI 134
           YKG  +P+       + +F  N+   K ++   G   + L  +     G  +G   A + 
Sbjct: 77  YKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLA 136

Query: 135 VPFELVKIRLQ-----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            P E V+IRLQ        +++ G ++  + ++KQ  L     G  +T  R +      F
Sbjct: 137 TPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQGAL---MRGFTATTLRTSHG----F 189

Query: 190 GVIFQVRELLPVAKSKQEKTRNDLCA------GFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
           G+ F   E L   ++     R ++ A      G   G F      PFDVVKS +Q+D  +
Sbjct: 190 GIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQAD--K 247

Query: 244 IINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           + N V  Y     +V K IY E G RA  KGF P +LR  P        F   M +
Sbjct: 248 LKNPV--YGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRL 301

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 14/191 (7%)

Query: 6   NTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLS 65
           N   PL  R  +  G ++G +   +  P++ V+ R+QLQ     A +SA  Y G +DC  
Sbjct: 111 NFDQPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQT----ASSSAAEYHGSLDCAR 166

Query: 66  QIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFI--KLWKSVFGTKQLTQQISVLSG 123
           +++K+   M   +G ++  L  +    + F + +  I  +    V        ++ V  G
Sbjct: 167 KLLKQGALM---RGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKVCVY-G 222

Query: 124 ASAGITEALVIVPFELVKIRLQDVNSKF----KGPVEVLKHIIKQDGLKGLYSGVESTVW 179
           A +G     +  PF++VK  +Q    K     + P+ V K I ++ G +    G   T+ 
Sbjct: 223 AFSGAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTML 282

Query: 180 RNAVWNAGYFG 190
           R+   N   F 
Sbjct: 283 RSLPVNGATFA 293

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 75/181 (41%), Gaps = 9/181 (4%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            V  G   G+ + LV  PF++ K+RLQ  +       +V+K ++K +GL   Y G  + +
Sbjct: 26  DVFCGTVGGVAQVLVGQPFDITKVRLQ-TSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPL 84

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKT---RNDLCAGFVGGTFGVMFNTPFDVVKS 235
                  +  FGV   +++         ++    R     GFV GT      TP + V+ 
Sbjct: 85  AGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRI 144

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
           R+Q       +   +Y+ +     K+  +    AL +GF    LR   G  +  + +  +
Sbjct: 145 RLQLQTAS--SSAAEYHGSLDCARKLLKQG---ALMRGFTATTLRTSHGFGIYFLTYETL 199

Query: 296 M 296
           +
Sbjct: 200 I 200

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 85.1 bits (209), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 128/299 (42%), Gaps = 35/299 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG   G+S++++  P D  K R+Q    T +   +A      +D + ++VK EG   
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ----TSSVPTTA------LDVVKKLVKNEGFRG 75

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV----LSGASAGITEA 131
            YKG  +P++      +V+F  N+   + + S  G     + + +    L G + G   +
Sbjct: 76  FYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANS 135

Query: 132 LVIVPFELVKIRLQD-----VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
            +  P E V+IRLQ        ++F GP++ +K +   +    L  G+  T+ R +    
Sbjct: 136 FLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHG-- 190

Query: 187 GYFGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSRIQSD 240
              GV F   E L   +  +  +R++     LC  G   GT   +   P DV+KS +Q+D
Sbjct: 191 --CGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248

Query: 241 GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
              ++   +  N        IY   G  + +KGF P +LR  P        F   M V 
Sbjct: 249 --SLLQPKQGKNM-LQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMRVL 304

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 84/193 (43%), Gaps = 15/193 (7%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            +L+G + G+++ L+  PF+  K+RLQ  +S     ++V+K ++K +G +G Y G  + +
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ-TSSVPTTALDVVKKLVKNEGFRGFYKGTLTPL 84

Query: 179 WRNAVWNAGYFGV------IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232
                  +  FGV       F  R             +  LC GF GGT      +P + 
Sbjct: 85  VGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLC-GFAGGTANSFLASPIEH 143

Query: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           V+ R+Q+          +++     + K+       +L +G  P +LR   G  V  + +
Sbjct: 144 VRIRLQTQTG--TGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVYFLTY 198

Query: 293 TNVMNVFREFHEG 305
             +  +  E H+G
Sbjct: 199 EAL--IANELHKG 209

>Scas_721.27
          Length = 374

 Score = 85.9 bits (211), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 77/319 (24%), Positives = 135/319 (42%), Gaps = 61/319 (19%)

Query: 29  MVMYPLDVVKTRMQLQV-----STGAAGASA--------------THYKGVIDCLSQIVK 69
           +V  P D+VKTR+Q  +      + AA  +A              TH+K     L  + K
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 70  KEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGIT 129
           +EG   ++KG+   ++   P R++ F +     +++   F   Q T  I ++S A+AG  
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGWA 187

Query: 130 EALVIVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
            +    P  ++K R+Q        K+K   + LK ++K +G+ GLY G+          +
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGL----------S 237

Query: 186 AGYFGVI---------FQVRELLP------------VAKSKQEKTRNDLC----AGFVGG 220
           A Y G I          Q++ L+             + KS+ EK + + C    +  V  
Sbjct: 238 ASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIK-EWCQRSGSAGVAK 296

Query: 221 TFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
               +   P +VV++R++    E  NG  KY     S   I  EEG  ++Y G  P ++R
Sbjct: 297 FIASIVTYPHEVVRTRLRQMPME--NGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMR 354

Query: 281 LGPGGAVLLVVFTNVMNVF 299
             P   ++   +  V+ + 
Sbjct: 355 TVPNSIIMFGTWELVIRLL 373

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 101/215 (46%), Gaps = 28/215 (13%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N+  + PL      M+ A AG +      P+ ++KTR+QL         +   YK   DC
Sbjct: 168 NNGQETPL---IHLMSAATAGWATSTATNPIWMIKTRVQLD-----KAGTTRKYKNSWDC 219

Query: 64  LSQIVKKEGPMHMYKGISSPML--MEAPKRAVKFASNDEFIKLWKSV--FG-----TKQL 114
           L  ++K EG   +Y+G+S+  L  +E   + + +      IK  +S+  FG     TK  
Sbjct: 220 LKTVLKSEGIYGLYRGLSASYLGSIEGILQWLLYEQMKHLIKQ-RSIEKFGHEGQLTKSR 278

Query: 115 TQQIS--VLSGASAGITE---ALVIVPFELVKIRLQDV-----NSKFKGPVEVLKHIIKQ 164
           T++I        SAG+ +   ++V  P E+V+ RL+ +       K+ G V+  + IIK+
Sbjct: 279 TEKIKEWCQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKE 338

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           +GL  +YSG+   + R    +   FG    V  LL
Sbjct: 339 EGLASMYSGLTPHLMRTVPNSIIMFGTWELVIRLL 373

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 22/100 (22%)

Query: 229 PFDVVKSRIQSD---------------------GNEIINGVRKYNWTWPSVMKIYHEEGF 267
           PFD+VK+R+QSD                      N ++     +  T+  +  +Y  EGF
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 268 RALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF-REFHEGR 306
           R+L+KG  P ++ + P  ++    +     ++ + F+ G+
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQ 171

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/369 (22%), Positives = 151/369 (40%), Gaps = 71/369 (19%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQ-----------------V 45
           S+ NT   L  + + ++     +   +++ P+DVV+ R+Q Q                 V
Sbjct: 2   SDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNAV 61

Query: 46  STGA-----------------------------AGASATHYKGVIDCLSQIVKKEGPMHM 76
           S+G+                                S+  + G ++  ++I   EG   +
Sbjct: 62  SSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITSL 121

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           ++GIS  +LM  P   V F S  E+I+    +  T      +    GA A +  A  I P
Sbjct: 122 WRGISLTLLMAIPANMVYF-SGYEYIRDVSPIASTYPTLNPL--FCGAIARVFAATSIAP 178

Query: 137 FELVKIRLQDV--NSKFKGPVEVLKHIIKQDGL--------KGLYSGVESTVWRNAVWNA 186
            ELVK +LQ +  +SK      ++K ++ +           + L+ G+E T+WR+  ++A
Sbjct: 179 LELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSA 238

Query: 187 GYFGVIFQVRELLPVAKSKQEKTR-------NDLCAGFVGGTFGVMFNTPFDVVKSRIQ- 238
            Y+      +E L +  ++            N   +G + G    +   PFDV K+R Q 
Sbjct: 239 IYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQI 298

Query: 239 --SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
              + ++   G R  N  +  +  I+  EG  ALY G   +V+++ P  A+++  +    
Sbjct: 299 SMMNNSDPKGGNRSRN-MFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISK 357

Query: 297 NVF-REFHE 304
            VF  + H+
Sbjct: 358 KVFGNKLHQ 366

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 90/194 (46%), Gaps = 22/194 (11%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           ++S + T  PL        GAIA +     + PL++VKT++Q    +  +  +    K +
Sbjct: 152 IASTYPTLNPL------FCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDL 205

Query: 61  IDCLSQIVKKEGPMH-MYKGISSPMLMEAPKRAVKFASND---EFIKLWKSVFGTKQLTQ 116
           ++   Q +K  GP   ++KG+   +  + P  A+ ++S +   E + L  + F +K    
Sbjct: 206 LNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANW 265

Query: 117 Q---ISVLSGASAGITEALVIVPFELVKIRLQDV---NSKFKGP------VEVLKHIIKQ 164
                S  SG  +G+  A+   PF++ K R Q     NS  KG        + L+ I + 
Sbjct: 266 VHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRT 325

Query: 165 DGLKGLYSGVESTV 178
           +GL  LY+G+ + V
Sbjct: 326 EGLAALYTGLAARV 339

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 130/308 (42%), Gaps = 53/308 (17%)

Query: 33  PLDVVKTRMQLQVSTGAAGASAT-----------HYKGVIDCLSQIVKKEGPMHMYKGIS 81
           P DVVKTR+Q  V  GA    AT           H++  +  +  +  +EG   ++KG+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 82  SPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVK 141
             ++   P R++ F +          +    Q    I  L+GA+AG   +    P  LVK
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVK 188

Query: 142 IRLQ-----DVNS-KFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV 195
            RLQ     D  S ++K   + LK +++ +G+ GLY G+          +A Y G +  +
Sbjct: 189 TRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL----------SASYLGSVESI 238

Query: 196 RELLPVAK----------------SKQEKTR----NDLC--AGFVGGT--FGVMFNTPFD 231
            + +   +                S++ KT      + C  +G  G    F  +   P +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVV 291
           VV++R++    E  NG  KY   + S   I  EEGF ++Y G  P ++R  P   ++   
Sbjct: 299 VVRTRLRQAPKE--NGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 356

Query: 292 FTNVMNVF 299
           +  V+ + 
Sbjct: 357 WELVIKLL 364

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 92/196 (46%), Gaps = 24/196 (12%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N   +AP      F+AGA AG +      P+ +VKTR+QL     AA   +  YK   DC
Sbjct: 157 NDGQEAPW---IHFLAGATAGWATSTATNPIWLVKTRLQLD---KAADGRSRRYKNSWDC 210

Query: 64  LSQIVKKEGPMHMYKGISSP-----------MLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
           L  +++ EG + +YKG+S+            +L E  K  ++  S +EF  + +    T 
Sbjct: 211 LKGVMRNEGILGLYKGLSASYLGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTY 270

Query: 113 QLTQQISVLSGAS--AGITEALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQD 165
              ++    SG++  A +  +++  P E+V+ RL+         K+ G  +    IIK++
Sbjct: 271 MKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEE 330

Query: 166 GLKGLYSGVESTVWRN 181
           G   +YSG+   + R 
Sbjct: 331 GFASMYSGLTPHLMRT 346

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 23  AGISEL---MVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKG 79
           AG ++L   ++ YP +VV+TR++              Y G+    S I+K+EG   MY G
Sbjct: 283 AGAAKLFASILTYPHEVVRTRLR----QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSG 338

Query: 80  ISSPMLMEAPKRAVKFASNDEFIKL 104
           ++  ++   P   + F + +  IKL
Sbjct: 339 LTPHLMRTVPNSIIMFGTWELVIKL 363

>Kwal_27.12599
          Length = 304

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 131/294 (44%), Gaps = 33/294 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG   G+++++V  P D  K R+Q          ++T     ++ + ++VK EG   
Sbjct: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ----------TSTTPTTAVEVVKKLVKNEGLRG 76

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWK--SVFGTKQLTQQISVLSGASAGITEALV 133
            YKG  +P++      + +F  N+   + ++  S    K LT     + G   G+  + +
Sbjct: 77  FYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFL 136

Query: 134 IVPFELVKIRLQDVN-----SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
             P E V+IRLQ        ++FKGP++ +   ++ +G   L  G+  T+ R A   A Y
Sbjct: 137 ASPIEHVRIRLQTQTASGTVAEFKGPLDCINK-LRANG--ALMRGLSPTILREAQGCATY 193

Query: 189 FGVIFQVRELLPVAKSKQEKTRND-----LCA-GFVGGTFGVMFNTPFDVVKSRIQSDGN 242
               F   E L   +  +   R+D     LC  G V G    +   P DV+KS +Q+D  
Sbjct: 194 ----FLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTD-- 247

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
            + N VR  N    + + +  + G+++ +KGF P +LR  P        F   M
Sbjct: 248 NLKNPVRGKNIIQVARL-VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300

>Scas_645.9
          Length = 391

 Score = 85.1 bits (209), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 121/258 (46%), Gaps = 24/258 (9%)

Query: 53  SATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
           S+  + G ++  ++I K EG   +++GIS  +LM  P   V F +  E+++   S   T 
Sbjct: 125 SSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYF-TGYEYLRD-NSPLATS 182

Query: 113 QLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPV------EVLKHIIKQDG 166
             T    ++ GA A I  A  + P EL+K +LQ +    K         E+LK   ++  
Sbjct: 183 SPTFN-PLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMR 241

Query: 167 LKG----LYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTR----NDLCAGFV 218
           + G    L+ G+E T+WR+  ++A Y+G     +  L +  SK         N    G +
Sbjct: 242 ISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSI 301

Query: 219 GGTFGVMFNTPFDVVKSRIQSD--GNEIINGVRKYNWTWPSVM-----KIYHEEGFRALY 271
            GT   +   PFDV K+R Q    GN   + V+  +      M      I+  EG+ ALY
Sbjct: 302 SGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALY 361

Query: 272 KGFVPKVLRLGPGGAVLL 289
            G VP+++++ P  A+++
Sbjct: 362 TGLVPRMVKIAPSCAIMI 379

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 81/177 (45%), Gaps = 20/177 (11%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH- 75
            M GAIA I     + PL+++KT++Q       +  S    K ++    Q ++  G  + 
Sbjct: 189 LMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNA 248

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIK--LWKSVFGT-KQLTQQI-SVLSGASAGITEA 131
           ++KG+   +  + P  A+ + S  EF K  LW     +   LT  I S + G+ +G   A
Sbjct: 249 LFKGLEITLWRDVPFSAIYWGSY-EFCKTHLWMDTSKSHSNLTFFINSFIGGSISGTIAA 307

Query: 132 LVIVPFELVKIRLQ------DVNSKFKGP--------VEVLKHIIKQDGLKGLYSGV 174
           LV  PF++ K R Q      +  S  K P         + L++I K +G   LY+G+
Sbjct: 308 LVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGL 364

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 64/155 (41%), Gaps = 15/155 (9%)

Query: 141 KIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLP 200
           ++  ++ + +F G +E    I K +G+  L+ G+   +      N  YF     +R+  P
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 201 VAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK 260
           +A S    T N L  G +          P +++K+++QS     I  V K   +W  V +
Sbjct: 179 LATS--SPTFNPLMCGAIARILAASTVAPLELLKTKLQS-----IPRVSKSTTSWMMVKE 231

Query: 261 IYHEE--------GFRALYKGFVPKVLRLGPGGAV 287
           +  E            AL+KG    + R  P  A+
Sbjct: 232 LLKETRQEMRISGASNALFKGLEITLWRDVPFSAI 266

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQV-----STGAAGASATHYKGVIDCLSQI 67
           F   F+ G+I+G    +V +P DV KTR Q+        +          K +   L  I
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNI 351

Query: 68  VKKEGPMHMYKGISSPMLMEAPKRAVKFAS 97
            K EG   +Y G+   M+  AP  A+  +S
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISS 381

>Scas_721.129
          Length = 323

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 123/295 (41%), Gaps = 21/295 (7%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +A    +    P+++VK RMQLQ    A G     Y+  I  +  I + EG   +
Sbjct: 25  FIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKV--YRNPIQGMGVIFRNEGIRGL 82

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-----SVLSGASAGITEA 131
            KG+ +  + +      +    +       S F   + + +I     +V +GAS+GI  A
Sbjct: 83  QKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGA 142

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEV--------LKHIIKQDGLKGLYSGVESTVWRNAV 183
           ++  P  LVK R+Q  +   K   +         L  I + +G KGL+ G+++ + R   
Sbjct: 143 VIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGA 202

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
            ++    +    +  L      ++     L A  + G    +   P+DV+ +RI +    
Sbjct: 203 GSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIYNQKGN 262

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           +      Y       +K    EG  ALYKGF  ++LR+ P   + L      M +
Sbjct: 263 L------YKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKL 311

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 87/193 (45%), Gaps = 14/193 (7%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQ------DVNSK-FKGPVEVLKHIIKQDGLKGLY 171
           S ++G  A         P ELVKIR+Q       V  K ++ P++ +  I + +G++GL 
Sbjct: 24  SFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQ 83

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELL-----PVAKS-KQEKTRNDLCAGFVGGTFGVM 225
            G+ +        N    G    +R  L     P  +S K +K   ++ AG   G  G +
Sbjct: 84  KGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGIIGAV 143

Query: 226 FNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284
             +P  +VK+R+QS  + I I     Y   W  +  I   EGF+ L++G    +LR G G
Sbjct: 144 IGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAG 203

Query: 285 GAVLLVVFTNVMN 297
            +V L ++    N
Sbjct: 204 SSVQLPIYNTAKN 216

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 8/93 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
              A  I+G+   +VM P DV+ TR+  Q            YKG +DC  + V+ EG   
Sbjct: 231 HLTASTISGLGVAVVMNPWDVILTRIYNQ--------KGNLYKGPVDCFVKTVRTEGISA 282

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
           +YKG  + +L  AP   +     ++ +KL  SV
Sbjct: 283 LYKGFQAQILRIAPHTIICLTFMEQTMKLVYSV 315

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 194 QVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNW 253
           Q +E+   A  K  K      AG +     V F  P ++VK R+Q  G     G + Y  
Sbjct: 7   QKKEIEKTAAQKVSKF-GSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRN 65

Query: 254 TWPSVMKIYHEEGFRALYKGFVPK-VLRLGPGGAVL 288
               +  I+  EG R L KG V   + ++G  G+ L
Sbjct: 66  PIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRL 101

>Scas_714.18
          Length = 305

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 129/314 (41%), Gaps = 53/314 (16%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
           + +AG+IAG     + YP D VK R+Q Q         A  +     C+    + EG + 
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQTQ--------EAYMFPSTWSCIKYTYENEGILE 66

Query: 76  -MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
             Y+GI SP++  A + A+ F + ++      +   T+     I ++S   AG   + V+
Sbjct: 67  GFYQGIESPLIGAALENAILFLAYNQCSSFLNAF--TEFSAFLIILISAGFAGSCASFVL 124

Query: 135 VPFELVKIRLQDVNSKFK--------------------------GPVEVLKHIIKQDGLK 168
            P EL+K +LQ  N  +                             +  +K IIK+ GL 
Sbjct: 125 TPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLF 184

Query: 169 GLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT 228
           GL+ G  ST  R ++ +  +F     +++ L   KS+   T   L +   G T G+ FN 
Sbjct: 185 GLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLIS---GATAGLAFNG 241

Query: 229 ---PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285
              P D VKS +Q++   ++  VR           I   +G    Y+G    +LR  P  
Sbjct: 242 SVFPADTVKSIMQTEHLALMETVR----------SILERDGVAGFYRGLGITLLRAVPSN 291

Query: 286 AVLLVVFTNVMNVF 299
           A +   +  +  + 
Sbjct: 292 AAVFYTYEKLSKIL 305

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 80/203 (39%), Gaps = 22/203 (10%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNS-KFKGPVEVLKHIIKQDG-LKGLYSGVEST 177
           +L+G+ AG     +  PF+ VK+RLQ   +  F      +K+  + +G L+G Y G+ES 
Sbjct: 16  ILAGSIAGAIGKFIEYPFDTVKVRLQTQEAYMFPSTWSCIKYTYENEGILEGFYQGIESP 75

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
           +   A+ NA  F    Q    L             + AGF G     +  TP +++K ++
Sbjct: 76  LIGAALENAILFLAYNQCSSFLNAFTEFSAFLIILISAGFAGSCASFVL-TPVELIKCKL 134

Query: 238 QSDG-------------------NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
           Q                        ++ G  ++    P++  I  E+G   L++G     
Sbjct: 135 QISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLWQGQSSTF 194

Query: 279 LRLGPGGAVLLVVFTNVMNVFRE 301
           +R   G  V    +  +    R+
Sbjct: 195 IRESIGSVVWFATYELMKQTLRD 217

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 133/328 (40%), Gaps = 60/328 (18%)

Query: 18  MAGAIAG-ISELMVMYPLDVVKTRMQLQ------VSTG-------------------AAG 51
           M  A AG +   + + PLDVV+ R+  Q        TG                      
Sbjct: 15  MVSASAGSLVTSLFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCR 74

Query: 52  ASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT 111
             A   +G ++ L +I + EG   +++G+   ++M  P   V F+        ++++   
Sbjct: 75  EPAARLQGTLEGLRKIAQLEGLPTLWRGLGITLVMAVPANVVYFSG-------YEALRDN 127

Query: 112 KQLTQQISV----LSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEV---------L 158
             L  ++ V    + GA A I  A  I P EL++ RLQ V         +         +
Sbjct: 128 SPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREM 187

Query: 159 KHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI------FQVRELLPVAKSKQEKTRND 212
           +H +   G + L+ G+E T+WR+  ++A Y+G        F  R       S  +     
Sbjct: 188 RHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGS 247

Query: 213 LCAGFVGGTFGVMFNTPFDVVKSRIQ---SDGNEIINGVRKYNWTWPSVM-----KIYHE 264
              G +GG    +   PFDV K+R+Q   +   ++  G +         M      I   
Sbjct: 248 FACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKS 307

Query: 265 EGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           EG RALY G +P+V+++ P  A+++  +
Sbjct: 308 EGIRALYTGLLPRVMKIAPSCAIMISTY 335

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 6/112 (5%)

Query: 2   SSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQL------QVSTGAAGASAT 55
           ++ HN      F   F  G++ G    ++ +P DV KTRMQ+      Q++ G       
Sbjct: 233 AATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTD 292

Query: 56  HYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKS 107
             +G+   L+ I K EG   +Y G+   ++  AP  A+  ++ +   K + S
Sbjct: 293 DSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFFTS 344

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 78/198 (39%), Gaps = 28/198 (14%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           +  N    + LP     + GA A I     + PL++++TR+Q   S   A  +      +
Sbjct: 124 LRDNSPLASRLPVANPLVCGAFARILAATTIAPLELLRTRLQ---SVPRARDTERTIYLI 180

Query: 61  IDCLSQI---VKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK--LWKSVFGTKQLT 115
            D L ++   V   G   ++KG+   +  + P  A+ + +  EF K   W     T   +
Sbjct: 181 GDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYWGTY-EFCKTQFWARHAATHNAS 239

Query: 116 QQI----SVLSGASAGITEALVIVPFELVKIRLQDV---------------NSKFKGPVE 156
                  S   G+  G   AL+  PF++ K R+Q                     +G   
Sbjct: 240 NWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFS 299

Query: 157 VLKHIIKQDGLKGLYSGV 174
            L  I K +G++ LY+G+
Sbjct: 300 FLNAIRKSEGIRALYTGL 317

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 83.2 bits (204), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 133/318 (41%), Gaps = 49/318 (15%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-YKG 59
           MS    TQ         + G+IAG    ++ YP D VK R+Q Q           H +  
Sbjct: 1   MSGAEETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQ---------GRHVFPD 51

Query: 60  VIDCLSQIVKKEGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI 118
              C++   K EG +   ++GI+SP+   A + A  F S ++  K  +       LT  +
Sbjct: 52  TWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL 111

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQ---------------DVNSKFKGPVEVLKHIIK 163
             +SGA AG   + V+ P EL+K +LQ                V  +    +  ++ +IK
Sbjct: 112 --ISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIK 169

Query: 164 QDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTR-ND-----LCAGF 217
             G  GL+ G   T  R +     +F     +++ L    + ++ +  ND     L A  
Sbjct: 170 NRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLAS- 228

Query: 218 VGGTFGVMFNT---PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGF 274
            G + G+ FN    P D VKS +Q++   +   ++          KI+ E+G R  Y+G 
Sbjct: 229 -GASAGLAFNASIFPADTVKSMMQTEHLGLKTAIK----------KIFVEKGLRGFYRGL 277

Query: 275 VPKVLRLGPGGAVLLVVF 292
              ++R  P  A +  V+
Sbjct: 278 GITLIRAIPANATVFYVY 295

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 84/363 (23%), Positives = 149/363 (41%), Gaps = 77/363 (21%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAG-ISELMVMYPLDVVKTRMQLQV-----STGAAGA-- 52
           MS + ++ A +  R   M  A AG       + P+DVV+ R+Q QV     S GAA    
Sbjct: 1   MSGDRSSTAIMKER---MLSACAGSFLTSFFLTPMDVVRIRLQQQVMLPDCSCGAASELK 57

Query: 53  -----------------------------------SATHYKGVIDCLSQIVKKEGPMHMY 77
                                              SA  +    +  ++I + EG   ++
Sbjct: 58  GSVGTEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWEAFTKISEVEGLATLW 117

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           +G+S  +LM  P   V F+  + F            L     +  GA+A +  A  + P 
Sbjct: 118 RGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLN---PLFCGATARMVAATTVAPL 174

Query: 138 ELVKIRLQDVNSK---------FKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
           EL+K RLQ +            FK  ++  ++ I+  G K L+ G+E T+WR+  ++A Y
Sbjct: 175 ELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIY 234

Query: 189 FGVIFQVRELLPVAKSKQ----------EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
           +G     ++   +  S+Q          +   N    G V G+   +   PFDV K+R+Q
Sbjct: 235 WGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQ 294

Query: 239 -------SDGNEIINGVRKYNW--TWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289
                     N +++  ++ +    +  +  I   EG+ ALY G +P+V+++ P  A+++
Sbjct: 295 ITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMI 354

Query: 290 VVF 292
             +
Sbjct: 355 STY 357

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 83.2 bits (204), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 128/300 (42%), Gaps = 39/300 (13%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRM---QLQVSTGAAGASATHY 57
           M+ N   Q+ +    + +  A AGI E+ V +P+D +  R+     ++++GA   S    
Sbjct: 1   MAHNDRKQSGVA---RLLGSASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFR 57

Query: 58  KGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFAS--------NDEFIKLWKSVF 109
               +   + V       ++ G+    + +  +R  K+          N  F K + S F
Sbjct: 58  DHAAEAFGKRV-----FTLFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAF 112

Query: 110 GTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKG 169
           G K      S  +G+  GI E +V++P +++KI+ Q     FKG       I+K +G+  
Sbjct: 113 GDKTGKALRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPEAFKG--RGFLKILKDEGIFN 169

Query: 170 LYSGVESTVWRNAVWNAGYFG-VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT 228
           LY G   T  RNA  +   FG   F    +L +    Q     +  +  VG +  ++ + 
Sbjct: 170 LYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSA 229

Query: 229 PFDVVKSRIQSDGNEIINGVRKYNWTWPS-----VMKIYHEEGFRALYKGFVPKVLRLGP 283
           P DV+K+RIQ+            N+  P      V      EGF A +KG  PK+L  GP
Sbjct: 230 PLDVIKTRIQNR-----------NFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGP 278

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F++  +   + L+V  PLDV+KTR+Q +        +  + +     +   +K EG   
Sbjct: 213 NFISSIVGASASLIVSAPLDVIKTRIQNR--------NFDNPESGFKIVKNTLKNEGFTA 264

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
            +KG++  +L   PK    FA     I ++ ++
Sbjct: 265 FFKGLTPKLLTTGPKLVFSFALAQSLIPMFDNM 297

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 82.4 bits (202), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 133/303 (43%), Gaps = 51/303 (16%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F     +GA AG S  +  +P+D +KTR+Q +    A G     YKGV            
Sbjct: 6   FLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANGG----YKGV------------ 49

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLW------KSVFGTKQLTQQISVLSGASA 126
               Y+G+ S ++  AP  ++ F S D  +K++      K V    Q+   +S +  +S 
Sbjct: 50  ----YRGLGSAVIASAPSASLFFVSYDS-MKVYSKPVISKYVTSNNQMADTLSHMFSSSI 104

Query: 127 G-ITEALVIVPFELVKIRLQD--VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           G ++  LV VP E++K R Q    NS ++   ++L++   +  L+ LY G  +T+ R   
Sbjct: 105 GEVSACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIP 164

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-------PFDVVKSR 236
           +      + F + E L   K+  ++   D  A + G   G +          P DV+K+R
Sbjct: 165 FTC----IQFPLYEFL--KKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTR 218

Query: 237 IQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
           +      I       N        IY EEGF+  + G  P+ + +  GGA+ L V+  V 
Sbjct: 219 LMLSHKSIPVAQLAKN--------IYAEEGFKVFFSGVGPRTMWISAGGAIFLGVYETVH 270

Query: 297 NVF 299
           ++ 
Sbjct: 271 SIL 273

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 146/322 (45%), Gaps = 38/322 (11%)

Query: 2   SSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASAT------ 55
           SS  N +   P+ + F+AG I G++  +V  P DVVKTR+Q  V   A  + A       
Sbjct: 42  SSQQNIKEVKPWVH-FVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQ 100

Query: 56  ---------HYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWK 106
                    H+K     +S + + EG   ++KG+   ++   P R++ F +     +++ 
Sbjct: 101 ANVIAQGVRHFKETFGIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYS 160

Query: 107 SVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGPVEVLKHII 162
                 Q    I +++ A+AG   +    P  LVK RLQ        K+K   + LK+++
Sbjct: 161 KTLNNGQEAVWIHLMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVV 220

Query: 163 KQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAK-------SKQEKTRNDLCA 215
           +++G+ GLY G+ S  +  +V     + +  Q++ ++           S+ EK+ +D   
Sbjct: 221 QKEGILGLYKGL-SASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIK 279

Query: 216 GFV--GGTFGV------MFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGF 267
            +    G+ G+      +   P +VV++R++    E  NG  KY     S+  I  EEG 
Sbjct: 280 EWCQRSGSAGLAKFVASIITYPHEVVRTRLRQAPLE--NGKLKYTGLVQSIRVIIKEEGL 337

Query: 268 RALYKGFVPKVLRLGPGGAVLL 289
            ++Y G  P +LR  P   ++ 
Sbjct: 338 ASMYGGLTPHLLRTVPNSIIMF 359

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 17/88 (19%)

Query: 229 PFDVVKSRIQSD-----------------GNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
           PFDVVK+R+QSD                  N I  GVR +  T+  +  +Y  EGFR+L+
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           KG  P ++ + P  ++    +     ++
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIY 159

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 29  MVMYPLDVVKTRM-QLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLME 87
           ++ YP +VV+TR+ Q  +  G        Y G++  +  I+K+EG   MY G++  +L  
Sbjct: 297 IITYPHEVVRTRLRQAPLENGK-----LKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRT 351

Query: 88  APKRAVKFASNDEFIKL 104
            P   + F + +  I+L
Sbjct: 352 VPNSIIMFGTWELVIRL 368

>Kwal_27.12081
          Length = 369

 Score = 83.6 bits (205), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 131/313 (41%), Gaps = 52/313 (16%)

Query: 29  MVMYPLDVVKTRMQLQV------------STGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           +V  P DVVKTR+Q  V            S+    +   H++     +S + K EG   +
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           +KG+   ++   P R++ F +     +++   F   +    I ++S A+AG   +    P
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNP 187

Query: 137 FELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI 192
             L+K RLQ        ++K   + LKHII+++G  GLY G+          +A Y G +
Sbjct: 188 IWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGL----------SASYLGSV 237

Query: 193 FQVRELLPVAKSKQ----------------EKTRNDLCAGFV--GGTFGV------MFNT 228
             + + L   + KQ                EK  ++    +    G+ G+      +   
Sbjct: 238 EGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTY 297

Query: 229 PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
           P +VV++R++    E  N   KY     S   I  EEG  ++Y G  P +LR  P   ++
Sbjct: 298 PHEVVRTRLRQAPLE--NDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIM 355

Query: 289 LVVFTNVMNVFRE 301
              +  V+ +  +
Sbjct: 356 FGTWELVIKLLSD 368

 Score = 68.2 bits (165), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 101/215 (46%), Gaps = 28/215 (13%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N+  +AP       ++ A AG +      P+ ++KTR+QL             YK   DC
Sbjct: 161 NNGEEAPW---IHLISAATAGWATSTATNPIWLIKTRLQLD-----KAGHTRQYKNSWDC 212

Query: 64  LSQIVKKEGPMHMYKGISSP-----------MLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
           L  I++KEG   +YKG+S+            +L E  K+ +K  S ++F  + +    T 
Sbjct: 213 LKHIIQKEGFFGLYKGLSASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTS 272

Query: 113 QLTQQISVLSGASAGITE---ALVIVPFELVKIRLQDV---NSKFK--GPVEVLKHIIKQ 164
           +  ++    SG SAG+ +   ++V  P E+V+ RL+     N K K  G ++  + IIK+
Sbjct: 273 EKIKEWCQRSG-SAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKE 331

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           +GL  +Y G+   + R    +   FG    V +LL
Sbjct: 332 EGLASMYGGLTPHLLRTVPNSIIMFGTWELVIKLL 366

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 15/96 (15%)

Query: 225 MFNTPFDVVKSRIQSD--------------GNEIINGVRKYNWTWPSVMKIYHEEGFRAL 270
           +   PFDVVK+R+QSD               N + +G+R +  T+  +  +Y  EGFR+L
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSL 127

Query: 271 YKGFVPKVLRLGPGGAVLLVVFTNVMNVF-REFHEG 305
           +KG  P ++ + P  ++    +     ++ R F+ G
Sbjct: 128 FKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNG 163

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 23  AGISELM---VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKG 79
           AG+++ +   V YP +VV+TR++              Y G+I     I+K+EG   MY G
Sbjct: 285 AGLAKFLASIVTYPHEVVRTRLR----QAPLENDKLKYTGLIQSFRVIIKEEGLASMYGG 340

Query: 80  ISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
           ++  +L   P   + F + +  IKL   V
Sbjct: 341 LTPHLLRTVPNSIIMFGTWELVIKLLSDV 369

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 83.2 bits (204), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/313 (24%), Positives = 141/313 (45%), Gaps = 49/313 (15%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           ++GA+AG    +++ PLDV KTR+Q Q     AG+   +Y+G++  LS I++ EG   +Y
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQ----GAGSGERYYRGIVGTLSAILRDEGVAGLY 144

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           KG++  +L   P   + F+  ++  + + S      ++   S L   +AG     +  P 
Sbjct: 145 KGLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASAL---TAGAISTALTNPI 201

Query: 138 ELVKIRL---QDV---NSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGV 191
            +VK RL    DV   ++ ++  ++  + + + +GLK  YSG+  +++       G F V
Sbjct: 202 WVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF-------GLFHV 254

Query: 192 I--FQVRELLPV-------AKSKQEKTRNDL------CAGFVGGTFGVMFNTPFDVVKSR 236
              F V E L +       A   Q    N L       A  +      +   P +++++R
Sbjct: 255 AIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTR 314

Query: 237 IQSDGNEIINGVRKYNWTWPSVM----KIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           +Q           +++   PS++    +I   EG+   Y GF   ++R  P   + LV F
Sbjct: 315 MQV----------RHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSF 364

Query: 293 TNVMNVFREFHEG 305
                  R ++EG
Sbjct: 365 EYFRKYLRMWNEG 377

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 80/183 (43%), Gaps = 34/183 (18%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQDGLKGLY 171
           Q++ +SGA AG    +++ P ++ K RLQ   +      ++G V  L  I++ +G+ GLY
Sbjct: 85  QVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLY 144

Query: 172 SGVESTVWRNAVWNAGYFG---VIFQVRELLPVAKSKQEKTRNDLCAGFV--------GG 220
            G+   V        GYF    + F V E     K KQ +  + L  GFV         G
Sbjct: 145 KGLAPIVL-------GYFPTWMLYFSVYE-----KCKQ-RYPSYLPGGFVSHAASALTAG 191

Query: 221 TFGVMFNTPFDVVKSR--IQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
                   P  VVK+R  IQSD   +      Y  T  +  K+Y  EG +  Y G VP +
Sbjct: 192 AISTALTNPIWVVKTRLMIQSD---VSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSL 248

Query: 279 LRL 281
             L
Sbjct: 249 FGL 251

>Kwal_33.12988
          Length = 303

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 128/295 (43%), Gaps = 35/295 (11%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           AG   GI++++V  P D+ K R+Q   +   A          +  +  +VK EG    YK
Sbjct: 29  AGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA----------LRVVQDLVKNEGLRGFYK 78

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKLW--KSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           G + P++      + +F +N+   + +  ++ F +  L        G  +G   A +  P
Sbjct: 79  GTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATP 138

Query: 137 FELVKIRLQ-----DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGV 191
            E V+I LQ       +++++G ++ +K ++K+  L     G   T+ R +      FGV
Sbjct: 139 IEHVRILLQVQTKSRADAEYQGAMDCIKKLLKEGKL---MRGFTPTILRTSHG----FGV 191

Query: 192 IFQVRELLPVAKSKQEKTRND-----LC--AGFVGGTFGVMFNTPFDVVKSRIQSDGNEI 244
            F   E +  ++ ++   R D     LC    F G     M   PFDV+KS +QSD  ++
Sbjct: 192 YFTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVY-PFDVIKSVMQSD--KL 248

Query: 245 INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
              V   N  +     IY+E G +A  KGF P +LR  P        F   M + 
Sbjct: 249 RTPVYGTN-VFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMRIL 302

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 73/177 (41%), Gaps = 9/177 (5%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
            + +G + GI + LV  PF++ K+RLQ  +S     + V++ ++K +GL+G Y G    +
Sbjct: 26  DITAGTTGGIAQVLVGQPFDITKVRLQ-TSSTPTTALRVVQDLVKNEGLRGFYKGTTLPL 84

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQE---KTRNDLCAGFVGGTFGVMFNTPFDVVKS 235
               +  +  FG    ++       + Q    +       GFV G       TP + V+ 
Sbjct: 85  IGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEHVRI 144

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
            +Q       +   +Y      + K+  E     L +GF P +LR   G  V    +
Sbjct: 145 LLQVQTKSRADA--EYQGAMDCIKKLLKEG---KLMRGFTPTILRTSHGFGVYFTSY 196

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 8/71 (11%)

Query: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY 262
           KS   +T  D+ AG  GG   V+   PFD+ K R+Q+        +R        V  + 
Sbjct: 17  KSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTP-TTALR-------VVQDLV 68

Query: 263 HEEGFRALYKG 273
             EG R  YKG
Sbjct: 69  KNEGLRGFYKG 79

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 118/294 (40%), Gaps = 23/294 (7%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MS          F   F+ G ++         P++ VK  MQ Q      G+  T YKG+
Sbjct: 1   MSHTETQTQQSHFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGI 60

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS- 119
           +DC  +    EG +  ++G ++ +L   P +A+ FA  D+   L           +  + 
Sbjct: 61  LDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYDRERDGYAKWFAG 120

Query: 120 -VLSGASAGITEALVIVPFELVKIRL--------QDVNSKFKGPVEVLKHIIKQDGLKGL 170
            + SG +AG    L +   +  + RL             +F G ++V K  +K DGL GL
Sbjct: 121 NLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGL 180

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG---TFGV-MF 226
           Y G   +V    V+   YFG+    + +L               A F+ G   T G    
Sbjct: 181 YRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTG-----ALEGSFVASFLLGWVITMGASTA 235

Query: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
           + P D V+ R+     + I    KY+     + KI  +EG  +L+KG    + R
Sbjct: 236 SYPLDTVRRRMMMTSGQTI----KYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 129/299 (43%), Gaps = 38/299 (12%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           M++N   Q+ L    + +  A AGI E+ V +P+D +  R+   +S     AS +    V
Sbjct: 1   MTTNDKKQSGLA---RVLGSASAGILEIGVFHPVDTISKRL---MSNHTKIASTSQLNSV 54

Query: 61  I--DCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFAS--------NDEFIKLWKSVFG 110
           I  D  S+ + +   + ++ G+      +  +R  K+          N  F   +   FG
Sbjct: 55  IFRDFASEPLGRR-LLSLFPGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFG 113

Query: 111 TKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGL 170
            K      S  +G+  GI E +V++P +++KI+ Q     FKG       IIK +G  GL
Sbjct: 114 EKTGKALRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPESFKG--RGFLKIIKDEGF-GL 169

Query: 171 YSGVESTVWRNAVWNAGYFG-VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTP 229
           Y G   T  RNA  +   FG   F    +L +    Q     +  +  VG +  ++ + P
Sbjct: 170 YRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAP 229

Query: 230 FDVVKSRIQSDGNEIINGVRKYNWTWPS-----VMKIYHEEGFRALYKGFVPKVLRLGP 283
            DV+K+RIQ+            N+  P      +      EGF A +KG  PK+L  GP
Sbjct: 230 LDVIKTRIQNR-----------NFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F++  +   + L+V  PLDV+KTR+Q +        +  + +     +   +K EG   
Sbjct: 212 NFVSSIVGASASLIVSAPLDVIKTRIQNR--------NFDNPESGFKIIKNTLKNEGFTA 263

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
            +KG++  +L   PK    FA     I ++ ++   K
Sbjct: 264 FFKGLTPKLLTTGPKLVFSFALAQTLIPIFDNLVSKK 300

>Kwal_0.232
          Length = 274

 Score = 79.7 bits (195), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 133/301 (44%), Gaps = 47/301 (15%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F    +AGA AG S  +  +P+D +KTR+Q      AAG                    G
Sbjct: 6   FITSLLAGAAAGTSTDLFFFPIDTLKTRLQ------AAGG--------------FFANGG 45

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-----GTKQLTQQISVLSGASAG 127
            + +Y+G+ S ++  AP  ++ F + D      + +F      + Q+ +  + +  +SAG
Sbjct: 46  YLGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAG 105

Query: 128 -ITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKG----LYSGVESTVWRNA 182
            I   +V VP E++K R Q    K    ++ LK +++ +  +G    LY G  +TV R  
Sbjct: 106 EIAACMVRVPAEVIKQRTQ--THKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREI 163

Query: 183 VWNAGYFGVIFQVRELLPVAKSKQEKT--RNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD 240
            +    F +   +++   ++  +++    +   C G V G       TP DV+K+R+   
Sbjct: 164 PFTCIQFPLYEFLKKQWAISGGREQVAPWQGAFC-GCVAGGIAAATTTPLDVLKTRLMLS 222

Query: 241 GNE--IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
                +++  R          +IY  EG++  + G  P+ + +  GGA+ L V+  V ++
Sbjct: 223 HTSVPVLHLAR----------QIYATEGWKVFFSGVGPRTVWISAGGAIFLGVYETVHSI 272

Query: 299 F 299
            
Sbjct: 273 L 273

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 136/302 (45%), Gaps = 32/302 (10%)

Query: 14  RYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGP 73
           R   ++GA+AG+   +V+ PLDV KTR+Q Q           +Y+G I  ++ IV+ EG 
Sbjct: 69  RINAISGALAGLLSGIVVCPLDVAKTRLQAQ-GLQTRTTENLYYRGSIGTMTTIVRDEGV 127

Query: 74  MHMYKGISSPMLMEAPKRAVKFASNDEFIK--LWKSVFGTKQLTQQISVLSGASAGITEA 131
             +YKG+   ++   P   + F S  EF K  L  +      ++   S +   +AG    
Sbjct: 128 RGLYKGLVPIIMGYFPTWMIYF-SVYEFCKDNLRTNSSNWSFVSHSFSAI---TAGAVST 183

Query: 132 LVIVPFELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           +V  P  +VK RL          + ++G  +  K II Q+G+K LY+G+       ++  
Sbjct: 184 VVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVP-----SLLG 238

Query: 186 AGYFGVIFQVRELLPVA--KSKQEKTRND--------LCAGFVGGTFGVMFNTPFDVVKS 235
             +  + F V E L V+    +++++ N+        + A  V      + + P +++++
Sbjct: 239 LLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRT 298

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
           R+Q   +   +  R      P +   Y +EG    Y GF   + R  P  A+ LV F  V
Sbjct: 299 RLQLKSDLPSHQRR----LIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

Query: 296 MN 297
            N
Sbjct: 355 RN 356

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 98/213 (46%), Gaps = 15/213 (7%)

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           ++G +    MEA K  V+     E  ++  ++FG      +I+ +SGA AG+   +V+ P
Sbjct: 34  FRGDTIDNKMEAYKGLVQ-----EVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCP 88

Query: 137 FELVKIRLQ--------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
            ++ K RLQ          N  ++G +  +  I++ +G++GLY G+   +         Y
Sbjct: 89  LDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIY 148

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGV 248
           F V    ++ L    S      +   A   G    V+ N P  VVK+R+      I +  
Sbjct: 149 FSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAVSTVVTN-PIWVVKTRLMLQ-THIGSNT 206

Query: 249 RKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRL 281
             Y  T+ +  KI ++EG +ALY G VP +L L
Sbjct: 207 THYQGTYDAFKKIINQEGVKALYAGLVPSLLGL 239

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 79.7 bits (195), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 126/297 (42%), Gaps = 25/297 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +A    + V  P ++VKTRMQLQ    A       Y+     L  I K EG   +
Sbjct: 27  FIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRI--YRNPFQALGVIFKNEGVKGL 84

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ-----ISVLSGASAGITEA 131
            +G+ S  + +      +    +    +    F  +    +     ++V +GA++GI  A
Sbjct: 85  QRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGA 144

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEV--------LKHIIKQDGLKGLYSGVESTVWRNAV 183
           +V  P  LVK R+Q  ++  K   +         L  I K++G+ GL+ GV++ + R   
Sbjct: 145 IVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGA 204

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGT-FGVMFNTPFDVVKSRI-QSDG 241
            ++    +    +  L      +E T   L +  V G   G++ N P+DVV +R+    G
Sbjct: 205 GSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMN-PWDVVLTRVYNQKG 263

Query: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           N        Y      + K    EG  ALYKGF  ++ R+ P   + L      M +
Sbjct: 264 NT-------YKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKL 313

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 86/193 (44%), Gaps = 14/193 (7%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQ------DVNSK-FKGPVEVLKHIIKQDGLKGLY 171
           S ++G  A      V  PFELVK R+Q        N + ++ P + L  I K +G+KGL 
Sbjct: 26  SFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQ 85

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLP---VAKSKQEKTRN---DLCAGFVGGTFGVM 225
            G+ S        N    G    +R +L      +S   K +N   ++ AG   G  G +
Sbjct: 86  RGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAI 145

Query: 226 FNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284
             +P  +VK+R+QS  N I I     Y      +  I+ +EG   L++G    +LR G G
Sbjct: 146 VGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAG 205

Query: 285 GAVLLVVFTNVMN 297
            +V L ++    N
Sbjct: 206 SSVQLPIYNTTKN 218

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 8/97 (8%)

Query: 200 PVAKSKQEKTR-------NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYN 252
           PVA  + EK+            AG +     V    PF++VK+R+Q  G       R Y 
Sbjct: 7   PVATKEHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYR 66

Query: 253 WTWPSVMKIYHEEGFRALYKGFVPK-VLRLGPGGAVL 288
             + ++  I+  EG + L +G V   V ++G  G+ L
Sbjct: 67  NPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGSRL 103

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 79.7 bits (195), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 132/308 (42%), Gaps = 47/308 (15%)

Query: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL 64
           H T A        +AG + G+  ++  +P D++K R Q           +   K  +D +
Sbjct: 13  HKTDAFRENMKALVAGGVGGVCAVLTGHPFDLIKVRCQ-----------SNQAKSTMDAV 61

Query: 65  SQIVKKEGPMH------------------MYKGISSPMLMEAPKRAVKFASNDEFIKL-- 104
           S I+K+   +                    YKG+  P++   P  AV F   D   +L  
Sbjct: 62  SIILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVT 121

Query: 105 WKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-VEVLKHIIK 163
           WK        T Q++  +G  + I   LV  P E +K+ LQ  NS+FKG  ++  KHI+ 
Sbjct: 122 WKQASDAPLTTAQMAT-AGFISAIPTTLVTAPTERIKVVLQ-TNSEFKGSFIKAAKHIVS 179

Query: 164 QDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLC----AGFVG 219
             G+K L++G  +T+ R+   +A YF      +  L  + +K++K   +L     AG + 
Sbjct: 180 TGGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIA 239

Query: 220 GTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEE-GFRALYKGFVPKV 278
           G    +   P D +K+R+Q      I+ V+       +   IY +  G +  + G  P +
Sbjct: 240 GMSMWLVVFPIDTIKTRLQV-ATTPISMVQ-------ATKDIYIQRGGIKGFFPGLGPAL 291

Query: 279 LRLGPGGA 286
           LR  P  A
Sbjct: 292 LRSFPANA 299

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 80.1 bits (196), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 115/257 (44%), Gaps = 27/257 (10%)

Query: 57  YKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQ 116
           + G ++   +I K EG   +++GIS  +LM  P   V F +  E+++    + G      
Sbjct: 110 FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYF-TGYEYVRDRSPLNGLYPTIN 168

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDV--NSKFKGPV----EVLKHIIKQDGLKG- 169
            +  + GA A    A  + P EL+K +LQ +  +S   G V    ++   I  +  ++G 
Sbjct: 169 PL--ICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGV 226

Query: 170 ---LYSGVESTVWRN----AVWNAGYFGVIFQVRELLPVAKSKQEKT----RNDLCAGFV 218
              ++ G+E T+WR+    A++ A Y     +V  L P    K         N    GF+
Sbjct: 227 AQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFI 286

Query: 219 GGTFGVMFNTPFDVVKSRIQSD---GNEIINGVRKY---NWTWPSVMKIYHEEGFRALYK 272
            G+   +   PFDV K+R Q       ++ N   KY   N  +  +  I   EG  ALY 
Sbjct: 287 SGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYT 346

Query: 273 GFVPKVLRLGPGGAVLL 289
           G  P+V ++ P  A+++
Sbjct: 347 GLAPRVAKIAPSCAIMI 363

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 79/184 (42%), Gaps = 23/184 (12%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL-SQIVKKEGPMH 75
            + GA A       + PL+++KT++Q   S+     S   Y+ + + + S+I  +     
Sbjct: 170 LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQT 229

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIK-----LWKSVF---GTKQLTQQISVLSGASAG 127
           M+KG+   +  + P  A+ +AS  EF K     L  S F    +       S L G  +G
Sbjct: 230 MFKGLEITLWRDVPFSAIYWASY-EFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISG 288

Query: 128 ITEALVIVPFELVKIR----------LQDVNSKFKGPVEV---LKHIIKQDGLKGLYSGV 174
              A+   PF++ K R          L + N K+     +   L +I K +G+  LY+G+
Sbjct: 289 SLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGL 348

Query: 175 ESTV 178
              V
Sbjct: 349 APRV 352

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 148 NSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE 207
           N KF G +E  + I K +G+  L+ G+  T+      N  YF     VR+  P+  +   
Sbjct: 107 NQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPL--NGLY 164

Query: 208 KTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQS 239
            T N L  G    T       P +++K+++QS
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQS 196

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 4/98 (4%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           + N+     F   F+ G I+G    +  +P DV KTR Q+ + T    A++    G  + 
Sbjct: 268 DKNSSNWFHFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNT 327

Query: 64  ----LSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFAS 97
               L+ I K EG   +Y G++  +   AP  A+  +S
Sbjct: 328 MFGFLNYIRKTEGIGALYTGLAPRVAKIAPSCAIMISS 365

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 127/293 (43%), Gaps = 30/293 (10%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRM---QLQVSTGAAGASATHYKG 59
           SN   Q+ L    + +  A AGI E+ V +P+D +  R+     ++ + +   S    + 
Sbjct: 2   SNDKKQSGLA---RVLGSASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVIFREH 58

Query: 60  VIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFAS--------NDEFIKLWKSVFGT 111
             + LS+ V       ++ G+      +  +R  K+          N  F   + + FG 
Sbjct: 59  AAEPLSKRV-----FTLFPGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGE 113

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLY 171
           K      S  +G+  GI E +V++P +++KI+ Q     FKG   V   I+K +GL GLY
Sbjct: 114 KTGKALRSATAGSMIGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEGL-GLY 169

Query: 172 SGVESTVWRNAVWNAGYFG-VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPF 230
            G   T  RNA  +   FG   F    +L +    Q     +  +  VG +  ++ + P 
Sbjct: 170 RGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPL 229

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           DV+K+RIQ+   E           +  V      EGF A +KG  PK+L  GP
Sbjct: 230 DVIKTRIQNKNFE------NPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 42/93 (45%), Gaps = 8/93 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F++  +   + L++  PLDV+KTR+Q          +  + +     +   +K EG   
Sbjct: 211 NFVSSIVGASASLIISAPLDVIKTRIQ--------NKNFENPESGFTIVKNTLKNEGFSA 262

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
            +KG++  +L   PK    FA     I ++ ++
Sbjct: 263 FFKGLTPKLLTTGPKLVFSFALAQTLIPVFDNL 295

>Kwal_14.2210
          Length = 315

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 122/300 (40%), Gaps = 29/300 (9%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F AG IAG     V+ P + VK  +Q+Q ST A      +  G+   + Q+  +EG   +
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSSTHA------YNHGLFRAVKQVYLEEGVPGL 74

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
            +G     +   P  AV+F   +   K W        +     ++SGA  G    L   P
Sbjct: 75  LRGNGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYP 134

Query: 137 FELVKIRLQDVNSKFK--------------GPVEVLKHIIKQDG-LKGLYSGVESTVWRN 181
            +LV+ RL    +                 G  E+L+    Q+G + GLY GV  T    
Sbjct: 135 LDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGV 194

Query: 182 AVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDG 241
             + A  F V  Q+RE +P +      +   L  G + G        PFD+++ R Q   
Sbjct: 195 VPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQV-- 252

Query: 242 NEIINGVRKYNWTWPSV----MKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMN 297
             +  G  +  + + SV    + I   EGF+  YKG    + ++ P  AV  VV+  V +
Sbjct: 253 --LAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRD 310

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 86/179 (48%), Gaps = 14/179 (7%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGA-----AGASATHYKGVIDCLSQIVK 69
           ++ ++GA+ G   ++  YPLD+V+TR+ +Q +  A       ASA    GV + L +   
Sbjct: 116 HRLVSGALCGGCSVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYT 175

Query: 70  KEGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGI 128
           +EG +  +Y+G+    +   P  A+ FA  ++  +   + F     +     +   S G+
Sbjct: 176 QEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGV 235

Query: 129 TEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180
            +  +  PF+L++ R Q       ++   +K   + L  I + +G KG Y G+ + +++
Sbjct: 236 AQT-ITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFK 293

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 78/197 (39%), Gaps = 26/197 (13%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSKF---KGPVEVLKHIIKQDGLKGLYSGV 174
           I+  +G  AG     V+ PFE VKI LQ  +S      G    +K +  ++G+ GL  G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 175 ESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTR-----NDLCAGFVGGTFGVMFNTP 229
                 N +    Y  V F V E       +Q         + L +G + G   V+   P
Sbjct: 79  G----LNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYP 134

Query: 230 FDVVKSRIQSDGNEIINGVRKYNW----------TWPSVMKIYHEE-GFRALYKGFVPKV 278
            D+V++R+     +  N  R +             W  + K Y +E G   LY+G  P  
Sbjct: 135 LDLVRTRLSI---QTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTS 191

Query: 279 LRLGPGGAVLLVVFTNV 295
           + + P  A+   V+  +
Sbjct: 192 IGVVPYVALNFAVYEQL 208

>Kwal_55.20868
          Length = 380

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 128/298 (42%), Gaps = 36/298 (12%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           ++GA+AG    + + PLDV KTR+Q Q   G     + +YKG++  L+ I++ EG   +Y
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQ---GLHSNPSNYYKGILGTLTTIIRDEGARGLY 136

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           KG+   ++   P   + F+  +   KL+  +F +       +  S  +AG    ++  P 
Sbjct: 137 KGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSA--SALTAGTVSTILTNPV 194

Query: 138 ELVKIRL---QDVN---SKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGV 191
            +VK RL     VN   + +    +    +   +GL+  Y+G+  ++        G F V
Sbjct: 195 WVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL-------GLFHV 247

Query: 192 I--FQVRELLPV------AKSKQEKTRNDLCAGFVGGTFGVM----FNTPFDVVKSRIQ- 238
              F + E L V      + S+ E    +L    +  +   M       P +++++R+Q 
Sbjct: 248 AIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQL 307

Query: 239 ----SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
               +D    +    ++      +   Y  EG R  Y GF   + R  P  A+ LV F
Sbjct: 308 KAYPTDPLAALQKTSRHGLIR-LIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSF 364

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 78/171 (45%), Gaps = 8/171 (4%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGL 170
           +I+ LSGA AG    + + P ++ K RLQ      + ++ +KG +  L  II+ +G +GL
Sbjct: 76  EITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGL 135

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPF 230
           Y G+   +         YF V  + ++L P      +   +   A    GT   +   P 
Sbjct: 136 YKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASA-LTAGTVSTILTNPV 194

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRL 281
            VVK+R+    +   N    Y  T+ +  K+Y  EG R  Y G +P +L L
Sbjct: 195 WVVKTRLMLQTHVNKNSTH-YTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL 244

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 199 LPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSV 258
           +P      + T     +G + G    +   P DV K+R+Q+ G    N    Y     ++
Sbjct: 65  IPFVNRSFDDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLH-SNPSNYYKGILGTL 123

Query: 259 MKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
             I  +EG R LYKG VP ++   P   +   V+
Sbjct: 124 TTIIRDEGARGLYKGLVPIIMGYFPTWMIYFSVY 157

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 30  VMYPLDVVKTRMQLQV--STGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLME 87
           + YP ++++TRMQL+   +   A    T   G+I  +    K EG    Y G ++ +   
Sbjct: 294 LTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLART 353

Query: 88  APKRAVKFASNDEFIK 103
            P  A+   S + F K
Sbjct: 354 LPASAITLVSFEYFRK 369

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 128/298 (42%), Gaps = 42/298 (14%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F    ++GA AG S  +V +P+D +KTR+Q +      G     Y+GV            
Sbjct: 5   FLISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNGG----YRGV------------ 48

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASND----EFIKLWKSVFGTKQLTQQISVLSGASAG- 127
               Y+G+ S ++  AP  ++ F + D    E    ++ +  +  +   ++ +  +S G 
Sbjct: 49  ----YRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGE 104

Query: 128 ITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKG----LYSGVESTVWRNAV 183
           I   +V VP E+VK R Q   S      E L+ I+K +  +G    LY G  +T+ R   
Sbjct: 105 IAACMVRVPAEVVKQRSQTHASH--SSWETLREILKNENGEGVRRNLYRGWSTTIMREIP 162

Query: 184 WNAGYFGVIFQVRELLPV--AKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDG 241
           +    F +   ++++        + E  +  +C    GG       TP D +K+R+    
Sbjct: 163 FTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGG-IAAATTTPLDFLKTRLMLCK 221

Query: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
             I  G          V  IY EEGF+  + G  P+ + +  GGA+ L ++  V ++ 
Sbjct: 222 KSIPLGTL--------VSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLL 271

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 89/203 (43%), Gaps = 23/203 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG--- 72
              + ++  I+  MV  P +VVK R Q   S  +            + L +I+K E    
Sbjct: 96  HMFSSSMGEIAACMVRVPAEVVKQRSQTHASHSS-----------WETLREILKNENGEG 144

Query: 73  -PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEA 131
              ++Y+G S+ ++ E P   ++F   +   K+W  +  + ++      + G+ AG   A
Sbjct: 145 VRRNLYRGWSTTIMREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAA 204

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEVL-KHIIKQDGLKGLYSGV-ESTVWRNAVWNAGYF 189
               P + +K RL         P+  L   I K++G K  +SGV   T+W +A   A + 
Sbjct: 205 ATTTPLDFLKTRLMLCKKSI--PLGTLVSTIYKEEGFKVFFSGVGPRTMWISA-GGAIFL 261

Query: 190 GVIFQVRELLPVAKSKQEKTRND 212
           G+   V  LL    + ++ TRN+
Sbjct: 262 GIYETVHSLL---STNKKPTRNE 281

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 36/94 (38%), Gaps = 18/94 (19%)

Query: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
            L +G   GT   +   P D +K+R+Q+ G    NG                  G+R +Y
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNG------------------GYRGVY 49

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVFREFHEG 305
           +G    V+   PG ++  + +       R F  G
Sbjct: 50  RGLGSAVVASAPGASLFFITYDTCKAETRGFFRG 83

>Kwal_27.12481
          Length = 304

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 123/290 (42%), Gaps = 24/290 (8%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F   F+ G ++         P++ VK  +Q Q      G+    Y G+ +C  +    EG
Sbjct: 10  FAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEG 69

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-----SVLSGASAG 127
               ++G ++ ++   P +A+ FA  D+     K++FG K+          ++ SG +AG
Sbjct: 70  IASFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAGNLASGGAAG 125

Query: 128 ITEALVIVPFELVKIRLQDVNSK---------FKGPVEVLKHIIKQDGLKGLYSGVESTV 178
               + +   +  + RL   +SK         F G V+V K  +  DG+ GLY G   +V
Sbjct: 126 GLSLMFVYSLDYARTRLA-ADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSV 184

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
               V+   YFG    ++ LL +  S +         G+   T     + P D V+ R+ 
Sbjct: 185 VGIVVYRGLYFGGYDSLKPLL-LTGSLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMM 243

Query: 239 SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
               + +    KYN  + +  KI   EG ++L+KG    +LR   G  V+
Sbjct: 244 MTSGQAV----KYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 129/299 (43%), Gaps = 47/299 (15%)

Query: 30  VMYPLDVVKTRMQLQV-----------STGAA-----GASATHYKGVIDCLSQIVKKEGP 73
           V  P DVVKTR+Q  V           + G++       S  H+K     +  + ++EG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 74  MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
             ++KG+   ++   P R++ F +      ++       Q    I +L+ A+AG   + V
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTV 186

Query: 134 IVPFELVKIRLQDVNS---KFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG 190
             P  LVK RLQ   +    +K  ++ +K ++K +G+ GLY G+ S  +  +V     + 
Sbjct: 187 TNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGL-SASYLGSVEGILQWI 245

Query: 191 VIFQVRELLPV------------AKSKQEKTRNDLC--------AGFVGGTFGVMFNTPF 230
           +  Q++ ++              AKS  +K + + C        A FV      +   P 
Sbjct: 246 LYEQMKRIIKERSIEKFGHIHEDAKSTSDKVK-EWCQRSGSAGLAKFVAS----IVTYPH 300

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLL 289
           +VV++R++    E  NG  KY     S   I  EEG  ++Y G  P +LR  P   ++ 
Sbjct: 301 EVVRTRLRQAPTE--NGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMF 357

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 104/215 (48%), Gaps = 29/215 (13%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDC 63
           N+  +AP       +A A AG +   V  P+ +VKTR+QL        A    YK  +DC
Sbjct: 163 NNGQEAPW---IHLLAAATAGWATSTVTNPIWLVKTRLQLD------KAGTKTYKNSLDC 213

Query: 64  LSQIVKKEGPMHMYKGISSP-----------MLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
           +  +VK EG + +YKG+S+            +L E  KR +K  S ++F  + +    T 
Sbjct: 214 IKSVVKNEGVLGLYKGLSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTS 273

Query: 113 QLTQQISVLSGASAGITE---ALVIVPFELVKIRLQDVNS-----KFKGPVEVLKHIIKQ 164
              ++    SG SAG+ +   ++V  P E+V+ RL+   +     K+ G V+  + IIK+
Sbjct: 274 DKVKEWCQRSG-SAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKE 332

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           +GL  +YSG+   + R    +   FG    V +LL
Sbjct: 333 EGLVSMYSGLTPHLLRTVPNSIIMFGTWELVIKLL 367

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 19/97 (19%)

Query: 229 PFDVVKSRIQSD--------------GNEIINGVRK----YNWTWPSVMKIYHEEGFRAL 270
           PFDVVK+R+QSD              G+  ++ V +    +  T+  +  +Y +EGFR+L
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 271 YKGFVPKVLRLGPGGAVLLVVFTNVMNVF-REFHEGR 306
           +KG  P ++ + P  ++  + +    +++ R  + G+
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQ 166

>Scas_562.12
          Length = 300

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 136/304 (44%), Gaps = 47/304 (15%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYK-G 59
           M+SN   Q+ +    + +  A AGI E+ V +P+D +  R+            + H K G
Sbjct: 1   MASNDRKQSGVA---RLLGSASAGILEIGVFHPVDTISKRLM-----------SNHTKIG 46

Query: 60  VIDCLSQIVKKEG---PM-----HMYKGISSPMLMEAPKRAVKFAS--------NDEFIK 103
               L++++ +E    P+      ++ G+      +  +R  K+          N  + K
Sbjct: 47  NSHELNRVIFREHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKK 106

Query: 104 LWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIK 163
            + S FG K      S  +G+  GI E +V++P +++KI+ Q     FKG   V   I+K
Sbjct: 107 DFDSAFGEKTGKAMRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILK 163

Query: 164 QDGLKGLYSGVESTVWRNAVWNAGYFG-VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTF 222
            +G+  LY G   T  RNA  +   FG   F    +L +    Q     +  +  VG + 
Sbjct: 164 DEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASC 223

Query: 223 GVMFNTPFDVVKSRIQSDGNEIINGVRKYN--WTWPSVMK-IYHEEGFRALYKGFVPKVL 279
            ++ + P DV+K+RIQ+         R ++   T  +++K  +  EG  A +KG  PK+L
Sbjct: 224 SLIVSAPLDVIKTRIQN---------RSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLL 274

Query: 280 RLGP 283
             GP
Sbjct: 275 TTGP 278

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 8/94 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F++  +     L+V  PLDV+KTR+Q +        S  + +  +  +    K EG   
Sbjct: 213 NFISSIVGASCSLIVSAPLDVIKTRIQNR--------SFDNPETGLTIVKNTFKNEGITA 264

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF 109
            +KG++  +L   PK    FA     I  + S+ 
Sbjct: 265 FFKGLTPKLLTTGPKLVFSFALAQSLIPKFDSLL 298

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 133/298 (44%), Gaps = 39/298 (13%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           MS+N    A    +Y +  G  AGI   MV +PLD+ K R+Q         A+      +
Sbjct: 1   MSTNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQ---------AAPMPKPTL 51

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ--- 117
              L  I+  EG + +Y G+S+ +L +     V+F + D    L ++V   +QLT     
Sbjct: 52  FRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYD---LLKENVIPREQLTNMAYL 108

Query: 118 --ISVLSGASAGITEALVIVPFELVKIRLQDVNS-------KFKGPVEVLKHIIK-QDGL 167
              S+ SGA  G+         ++V IR+Q+ ++        +K  ++ +  I + + GL
Sbjct: 109 LPCSMFSGAIGGLAGNFA----DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGL 164

Query: 168 KGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRN--DLCAGFVGGTFGVM 225
           K L++G +  + R  +  A    V + V +   V K   + ++N   L A  + G     
Sbjct: 165 KTLFTGWKPNMVRGILMTASQV-VTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATT 223

Query: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
             +P DV+K+R       I+NG   +      +     +EG   +++G++P   RLGP
Sbjct: 224 VCSPADVMKTR-------IMNGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 124/282 (43%), Gaps = 30/282 (10%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVI--DCLSQIVKKEGP 73
           + +  A AGI E+ V +P+D +  R+   +S      S      VI  D  S+ + K   
Sbjct: 13  RLLGSASAGIMEIAVFHPVDTISKRL---MSNHTKITSGQELNRVIFRDHFSEPLGKR-L 68

Query: 74  MHMYKGISSPMLMEAPKRAVKFAS--------NDEFIKLWKSVFGTKQLTQQISVLSGAS 125
             ++ G+      +  +R  K+          N  + K + ++FG K      S  +G+ 
Sbjct: 69  FTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSL 128

Query: 126 AGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
            GI E +V++P +++KI+ Q     FKG   +   I++ +GL  LY G   T  RNA  +
Sbjct: 129 IGIGE-IVLLPLDVLKIKRQTNPESFKGRGFI--KILRDEGLFNLYRGWGWTAARNAPGS 185

Query: 186 AGYFG-VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQS---DG 241
              FG   F    +L +    Q     +  +  VG    ++ + P DV+K+RIQ+   D 
Sbjct: 186 FALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDN 245

Query: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
            E  +G+R        V      EG  A +KG  PK+L  GP
Sbjct: 246 PE--SGLR-------IVKNTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F++  +   S L+V  PLDV+KTR+Q          +  + +  +  +   +K EG   
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTRIQ--------NRNFDNPESGLRIVKNTLKNEGVTA 264

Query: 76  MYKGISSPMLMEAPKRAVKFA 96
            +KG++  +L   PK    FA
Sbjct: 265 FFKGLTPKLLTTGPKLVFSFA 285

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 77.0 bits (188), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 126/296 (42%), Gaps = 25/296 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
              AGA+ G+  ++  +P D++K R Q   S  A+G      K +++  +Q       M 
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQ---SNQASGTVDAVRKILVEARAQSGLSAVNMM 106

Query: 76  --MYKGISSPMLMEAPKRAVKFASNDEFIKL--WKSVFGTKQLTQQISVLSGASAGITEA 131
              YKG+  P+L   P  AV F   D   KL  W    G K  T Q++  +G  + I   
Sbjct: 107 RGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSG-KLTTAQLAT-AGFISAIPTT 164

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGV 191
           LV+ P E VK+ LQ  ++   G     KHI+   G++ L+ G  +T+ R+   +A YF  
Sbjct: 165 LVMAPTERVKVVLQTQSNHSLG--SAAKHILATGGVRSLFRGSLATLARDGPGSALYFAS 222

Query: 192 IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT---PFDVVKSRIQSDGNEIINGV 248
               +  L       E +  ++C    GG  GV       P D +K+ +QS         
Sbjct: 223 YEATKAYLNARSGTNELSIKNVC--LAGGMAGVSMWVGVFPIDTIKTELQSSNTR----- 275

Query: 249 RKYNWTWPSVMKIYHEE-GFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREFH 303
                   +  KIY+   G +  + G  P +LR  P  A   +      ++F++++
Sbjct: 276 ---QTMMEATRKIYNTRGGIKGFFPGIGPALLRSFPANAATFLGVELTHSLFKKYN 328

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/317 (24%), Positives = 135/317 (42%), Gaps = 50/317 (15%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  +  ++G I G      M+ LD VKTR Q          +   Y+ +I     I  +E
Sbjct: 52  PIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ-------GAPNVKKYRNMISAYRTIWLEE 104

Query: 72  GPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAG-IT 129
           G    +Y G  + ML   P  A+ F +  E+ K  +++    Q+   I+ LS    G   
Sbjct: 105 GVRRGLYGGYMAAMLGSFPSAAIFFGTY-EYTK--RTMIEDWQINDTITHLSAGFLGDFI 161

Query: 130 EALVIVPFELVKIRLQDVNSKFKGPV-----------EVLKHIIKQDGLKGLYSGVESTV 178
            + V VP E++K RLQ +  +F  P              +K +IK++G + L+ G ++T+
Sbjct: 162 SSFVYVPSEVLKTRLQ-LQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATL 220

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTR-------NDLCAGFVGGTFGVMFNTPFD 231
            R+  ++A  F    + R+L    K +Q+  R       N++  G   G    +  TP D
Sbjct: 221 ARDLPFSALQFAFYEKFRQL--AFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMD 278

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWP----------------SVMKIYHEEGFRALYKGFV 275
           VVK+R+Q+         + Y+ T P                S+  +Y  EG    + G  
Sbjct: 279 VVKTRVQTQ-QPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVG 337

Query: 276 PKVLRLGPGGAVLLVVF 292
           P+ +      +++L+++
Sbjct: 338 PRFVWTSVQSSIMLLLY 354

>Kwal_27.11419
          Length = 298

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 110/243 (45%), Gaps = 25/243 (10%)

Query: 14  RYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGP 73
           R  F+ G + G++  +++ P D++KTR+Q   S+       +     I+   Q+ K   P
Sbjct: 8   RSHFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRS-----IETPGQLWKGTLP 62

Query: 74  MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS----VLSGASAGIT 129
             +   + S + +      V+ A  D+ +K      G+     Q+S    ++SGA     
Sbjct: 63  SALRTSVGSALFLSTLN-IVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAA 121

Query: 130 EALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
             +  +P  ++K+R +     +K   E   HI + +G++GL+SG  +TV R+A + AG +
Sbjct: 122 VGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPY-AGLY 180

Query: 190 GVIF-----QVRELLPV---------AKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKS 235
            + +     Q+  +LPV           S +  T  +  A F   +      +PFD +K+
Sbjct: 181 VLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIKT 240

Query: 236 RIQ 238
           R+Q
Sbjct: 241 RMQ 243

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 18/99 (18%)

Query: 204 SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD-GNEIINGVRKYNWTWPSVMKIY 262
           S++ + R+    GFVGG    +   PFD++K+R+Q +  + +++ VR             
Sbjct: 2   SERPRGRSHFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNLLDVVRSI----------- 50

Query: 263 HEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
             E    L+KG +P  LR   G A    +F + +N+ R 
Sbjct: 51  --ETPGQLWKGTLPSALRTSVGSA----LFLSTLNIVRS 83

>Kwal_23.2913
          Length = 320

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 127/308 (41%), Gaps = 49/308 (15%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIV----KKEGPM 74
           AG + G+  ++  +P D++K R Q           +    G +D +S+++     K GP+
Sbjct: 34  AGGVGGVCAVLTGHPFDLLKVRCQ-----------SNQASGTLDAISRVLHEAKSKSGPL 82

Query: 75  HM------YKGISSPMLMEAPKRAVKFASNDEFIKL--WKS-----VFGTKQ----LTQQ 117
            +      Y+G+  P+L   P  AV F   D   +L  W S     + G+      LT  
Sbjct: 83  PLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTS 142

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNS-KFKGPVEVLKHIIKQDGLKGLYSGVES 176
              L+G  + I   L+  P E VK+ LQ   S  F G    L   I++ G++ L+ G  +
Sbjct: 143 QLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAARTL---IREGGVRSLFQGTLA 199

Query: 177 TVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLC-AGFVGGTFGVMFNTPFDVVKS 235
           T+ R+   +A YF      +  L   +     +   +C AG V G    +   P D +K+
Sbjct: 200 TLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMWIGVFPIDTIKT 259

Query: 236 RIQSD--GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFT 293
           ++QS      ++   R          +IY   G R  + G  P ++R  P  A   +   
Sbjct: 260 KLQSSSRSQSMVQAAR----------EIYTRAGLRGFFPGLGPALMRSFPANAATFLGVE 309

Query: 294 NVMNVFRE 301
               +F++
Sbjct: 310 FTHQLFKQ 317

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 87/189 (46%), Gaps = 21/189 (11%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL      +AG  + I   ++  P + VK  +Q   S    GA+ T           +++
Sbjct: 138 PLTTSQLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLGAART-----------LIR 186

Query: 70  KEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS----GAS 125
           + G   +++G  + +  + P  A+ FAS +    + K      Q T  +SV+S    G  
Sbjct: 187 EGGVRSLFQGTLATLARDGPGSALYFASYE----VSKRFLSRNQDTDALSVVSICVAGGV 242

Query: 126 AGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           AG++  + + P + +K +LQ  +S+ +  V+  + I  + GL+G + G+   + R+   N
Sbjct: 243 AGMSMWIGVFPIDTIKTKLQS-SSRSQSMVQAAREIYTRAGLRGFFPGLGPALMRSFPAN 301

Query: 186 AGYF-GVIF 193
           A  F GV F
Sbjct: 302 AATFLGVEF 310

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 80/197 (40%), Gaps = 35/197 (17%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQ----------DGLK 168
           S+ +G   G+   L   PF+L+K+R Q  +++  G ++ +  ++ +          + +K
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLLKVRCQ--SNQASGTLDAISRVLHEAKSKSGPLPLNQIK 88

Query: 169 GLYSGV------ESTVWRNAVW--NAGYFGVIFQVRELLPVAKSKQE----KTRNDLCAG 216
           G Y GV       + ++  + W  + G   V +    +  +A S  +     T     AG
Sbjct: 89  GFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTSQLALAG 148

Query: 217 FVGGTFGVMFNTPFDVVKSRIQ-SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFV 275
           F       +   P + VK  +Q S+    +   R           +  E G R+L++G +
Sbjct: 149 FFSAIPTTLITAPTERVKVVLQTSESGSFLGAAR----------TLIREGGVRSLFQGTL 198

Query: 276 PKVLRLGPGGAVLLVVF 292
             + R GPG A+    +
Sbjct: 199 ATLARDGPGSALYFASY 215

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           +S N +T A L      +AG +AG+S  + ++P+D +KT++Q          S++  + +
Sbjct: 222 LSRNQDTDA-LSVVSICVAGGVAGMSMWIGVFPIDTIKTKLQ----------SSSRSQSM 270

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKF 95
           +    +I  + G    + G+   ++   P  A  F
Sbjct: 271 VQAAREIYTRAGLRGFFPGLGPALMRSFPANAATF 305

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 122/293 (41%), Gaps = 30/293 (10%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F   F+ G ++         P++ VK  +Q Q      G+    Y G+++C  +    EG
Sbjct: 10  FAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEG 69

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSG-----ASAG 127
               ++G ++ ++   P +A+ FA  D+     K++FG K+        +G       AG
Sbjct: 70  VASFWRGNTANVIRYFPTQALNFAFKDKI----KAMFGFKKEEGYAKWFAGNLASGGLAG 125

Query: 128 ITEALVIVPFELVKIRL-QDVNS-------KFKGPVEVLKHIIKQDGLKGLYSGVESTVW 179
               L +   +  + RL  D  S       +F G V+V K  +  DG+ GLY G   +V 
Sbjct: 126 GLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVV 185

Query: 180 RNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG----TFGVMFNTPFDVVKS 235
              V+   YFG+   ++ LL           N   A F+ G    T     + P D V+ 
Sbjct: 186 GIVVYRGLYFGLYDSLKPLLLTG-----SLENSFLASFLLGWAVTTGASTASYPLDTVRR 240

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
           R+     + +    KY+  + +  KI   EG ++L+KG    +LR   G  V+
Sbjct: 241 RMMMTSGQAV----KYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

 Score = 35.0 bits (79), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 71/183 (38%), Gaps = 18/183 (9%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQD---------VNSKFKGPVEVLKHII 162
           KQ    I  L G  +         P E VK+ +Q+         ++ ++ G VE  K   
Sbjct: 6   KQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTA 65

Query: 163 KQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAG-----F 217
             +G+   + G  + V R     A  F    +++ +      K+E+      AG      
Sbjct: 66  ADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGF---KKEEGYAKWFAGNLASGG 122

Query: 218 VGGTFGVMFNTPFDVVKSRIQSDGNEIIN-GVRKYNWTWPSVMKIYHEEGFRALYKGFVP 276
           + G   ++F    D  ++R+ +D       G R++N       K    +G   LY+GF+P
Sbjct: 123 LAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLP 182

Query: 277 KVL 279
            V+
Sbjct: 183 SVV 185

>Kwal_23.3965
          Length = 307

 Score = 74.3 bits (181), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 126/309 (40%), Gaps = 27/309 (8%)

Query: 1   MSSNHNTQA-PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKG 59
           M+ +H  +   +P     +AG ++GIS  +V  PLD +K R+QLQ+      A+   Y G
Sbjct: 1   MAEDHLRKGQEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL------ANEAQYGG 54

Query: 60  VIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS 119
           ++    ++V++EG   ++KG    M M     + +F S     KL        QL  QI 
Sbjct: 55  ILVTFKRLVRQEGVRALWKGNVPAMAMYILYGSTQFTSYAILNKL----LSKSQLPAQIH 110

Query: 120 V-LSGASAGITEALVIVPFELVKIR-LQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST 177
             + GA +G   A+   P ++++ R + + + +    +   + I + +G +G + GV S+
Sbjct: 111 TGMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSS 170

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDL--CAGFVGGTFGVMFNTPFDVVKS 235
           +   AV  +        V+        +       L   A  + G        P D V+ 
Sbjct: 171 IVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRK 230

Query: 236 RIQ----------SDGNEIINGVRKYNWT--WPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           R Q             N+     + Y  T      + I  +EG  ALY G+   + +  P
Sbjct: 231 RYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVP 290

Query: 284 GGAVLLVVF 292
              V L V+
Sbjct: 291 STVVSLGVY 299

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 92/191 (48%), Gaps = 12/191 (6%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQ---DVNSKFKGPVEVLKHIIKQDGLKGLYSGVE 175
           S+++G  +GI+  +V  P + +KIRLQ      +++ G +   K +++Q+G++ L+ G  
Sbjct: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNV 76

Query: 176 STVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKS 235
             +    ++ +  F     + +LL  +KS+     +    G + GT   + + P DV+++
Sbjct: 77  PAMAMYILYGSTQFTSYAILNKLL--SKSQLPAQIHTGMVGALSGTCSAIASYPCDVLRT 134

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
           R       I N  R+ +    +  +I+  EGFR  +KG    ++ +    + +L  + +V
Sbjct: 135 RF------IANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESV 188

Query: 296 MNVFREFHEGR 306
             +F E    R
Sbjct: 189 -KIFCEQRPDR 198

>Scas_558.2
          Length = 289

 Score = 73.6 bits (179), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 133/310 (42%), Gaps = 46/310 (14%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F    ++GA AG S  +V +P+D +KTR+Q +      G     Y G+            
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNGG----YHGI------------ 49

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEF-------IKLWKSVFGTKQ---LTQQISVLS 122
               Y+G+ S ++  AP  ++ F + D         ++   +  GT+    +   + +++
Sbjct: 50  ----YRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIA 105

Query: 123 GASAGITEALVIVPFELVKIRLQ--DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWR 180
            +   +   LV VP E++K R Q    NS ++    +LK+  ++  ++ LY G  +T+ R
Sbjct: 106 SSMGELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMR 165

Query: 181 NAVWNAGYFGVI-FQVRE--LLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRI 237
              +    F +  F  +E  L        +  +  +C    GG       TP D +K+R+
Sbjct: 166 EIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGG-IAAATTTPLDFLKTRL 224

Query: 238 QSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
             + + I I  +         +  IY EEGF+  + G  P+ + +  GGA+ L V+  + 
Sbjct: 225 MLNKDSIPIKSL---------IRNIYKEEGFKIFFSGIYPRTMWISAGGAIFLGVYETMH 275

Query: 297 NVFREFHEGR 306
            + +   E +
Sbjct: 276 FMLQSLEETK 285

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 73.6 bits (179), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 132/297 (44%), Gaps = 40/297 (13%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F    ++GA AG S  +V +P+D +KTR+Q +      G     Y+G+            
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGG----YRGI------------ 48

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS-----VLSGASAG 127
               Y+G+ S ++  AP  ++ F + D   +  + V G    ++Q++     +LS +   
Sbjct: 49  ----YRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGE 104

Query: 128 ITEALVIVPFELVKIRLQ--DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           ++  LV VP E++K R Q    NS  +    +L+    +  ++GLY G  +T+ R   + 
Sbjct: 105 MSACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT 164

Query: 186 AGYFGVI-FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEI 244
              F +  +  ++    A+ ++         G + G       TP DV+K+R+      +
Sbjct: 165 CIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRV 224

Query: 245 --INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
             ++  R           ++ EEG R  ++G  P+ + +  GGA+ L V+  V ++F
Sbjct: 225 PMLHLART----------LFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 36/89 (40%), Gaps = 18/89 (20%)

Query: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
            L +G   GT   +   P D +K+R+Q+ G                    +H  G+R +Y
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG------------------FFHNGGYRGIY 49

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
           +G    V+   PG ++  V + ++    R
Sbjct: 50  RGLGSAVVASAPGASLFFVTYDSMKQQLR 78

>Scas_662.12
          Length = 308

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/306 (21%), Positives = 145/306 (47%), Gaps = 31/306 (10%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKK- 70
           P + + ++G  AG    ++++PLD++K R+QL  +T     +  H KG    +++++   
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATT----TTQQHQKGYTYLINELINNS 61

Query: 71  -----EGPMH-----MYKGISSPMLMEAPKRAVKFA-SNDEFIKLWKSVFGTKQLTQQIS 119
                +GP++      Y+G+   +L  A   ++ F   N     ++++ +     T  I 
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNT-TIF 120

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKH----IIKQDGLKGLYSGVE 175
           + SG  +GI+  L+  P  ++K R+   +   K   + ++H    ++ ++G K ++ G+ 
Sbjct: 121 LTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLL 180

Query: 176 STVWRNAVWNAGYFGVIFQVREL---LPVAKSKQEKTRNDLCAGFVGG---TFGVMFNTP 229
            ++    V     + +I+   +L   + + KSK++    +L    +        VM   P
Sbjct: 181 PSLL--GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYP 238

Query: 230 FDVVKSRIQSDGNEIINGVRKYNWTWPSVM-KIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
           F ++KS +Q+    + N + + ++ + +++ KIY + G + LYKG    +LR  P   + 
Sbjct: 239 FQLLKSNLQT-FRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCIT 297

Query: 289 LVVFTN 294
             ++ N
Sbjct: 298 FCIYEN 303

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQ-LQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           +  +++ +  +M +YP  ++K+ +Q  +  T     +  H+   I  + +I +  G   +
Sbjct: 223 LISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHF---ITLIRKIYRDNGIKGL 279

Query: 77  YKGISSPMLMEAPKRAVKFASNDEF 101
           YKG+S+ +L   P   + F   + F
Sbjct: 280 YKGLSANLLRAIPSTCITFCIYENF 304

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (43%), Gaps = 17/230 (7%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AGAI   +    M P+DVVKTR+QL+ +         + KG+I    QI+  EG   + 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTV--------YNKGMISSFKQIISSEGAGALL 69

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITE---ALVI 134
            G    +L  + + + KF   + F KL+  V G  Q     + +   SA I E    + +
Sbjct: 70  TGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIAL 129

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            P E  +IRL    +   G V     I+K++G    Y+G    +++   +N   F V  +
Sbjct: 130 CPLEATRIRLVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFER 189

Query: 195 VREL-LPVAKSKQ-----EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
             E+   +A  K+       T  +L +G   G    + + P D + S++ 
Sbjct: 190 AAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKVN 239

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 78/188 (41%), Gaps = 20/188 (10%)

Query: 121 LSGASAGITEALVIVPFELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTVW 179
           L+GA    T    +VP ++VK R+Q   + + KG +   K II  +G   L +G   T+ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 180 RNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGT-----FGVMFNTPFDVVK 234
             ++  +  FG  ++V + L +     ++  N   + ++G       F  +   P +  +
Sbjct: 78  GYSLQGSFKFGG-YEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATR 136

Query: 235 SRIQSD---GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVV 291
            R+ S     N ++ G  +          I  EEG  + Y GF P + +  P      +V
Sbjct: 137 IRLVSQPTFANGLVGGFSR----------ILKEEGAGSFYNGFTPILFKQIPYNIAKFLV 186

Query: 292 FTNVMNVF 299
           F     V+
Sbjct: 187 FERAAEVY 194

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 132/300 (44%), Gaps = 37/300 (12%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG + G     V+ P++ VK  +Q+Q ST A      +  G++  + Q+ K+EG   +
Sbjct: 20  FVAGGVGGAVSRTVVSPVERVKILLQVQSSTTA------YNGGLVHAVKQVYKEEGVKGL 73

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-----GTKQLTQQISVLSGASAGITEA 131
           ++G     L   P  AV++A   EF K    VF     G +QL     ++ GA  G    
Sbjct: 74  FRGNGINCLRIFPYSAVQYAVY-EFCK--TRVFHVGQSGHEQLRSWERLVGGALGGGASV 130

Query: 132 LVIVPFELVKIRL--QDVN------------SKFKGPVEVLKHIIKQD-GLKGLYSGVES 176
           LV  P +LV+ RL  Q  N             +  G VE+L+ I +++ GL+G Y GV  
Sbjct: 131 LVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYP 190

Query: 177 TVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSR 236
           T      + A  F +  +++ L+P            L  G V G        PFD+++ R
Sbjct: 191 TSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRR 250

Query: 237 IQSDGNEIINGVRKYNWTWPSVMK----IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
            Q     +  G  +  + + SV      I  +EG R  YKG    ++++ P  AV   V+
Sbjct: 251 FQV----LTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 85/180 (47%), Gaps = 14/180 (7%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSKFK---GPVEVLKHIIKQDGLKGLYSGV 174
           I+ ++G   G     V+ P E VKI LQ  +S      G V  +K + K++G+KGL+ G 
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEGVKGLFRGN 77

Query: 175 ESTVWRNAVWNAGYFGVI-FQVRELLPVAKSKQEKTRN--DLCAGFVGGTFGVMFNTPFD 231
                R   ++A  + V  F    +  V +S  E+ R+   L  G +GG   V+   P D
Sbjct: 78  GINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLD 137

Query: 232 VVKSR--IQSDGNEIINGVRKYNWTWPS-----VMKIYHEE-GFRALYKGFVPKVLRLGP 283
           +V++R  IQ+     ++  + ++   P      + +I+ EE G R  Y+G  P  L + P
Sbjct: 138 LVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLGVVP 197

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 143/328 (43%), Gaps = 49/328 (14%)

Query: 4   NHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASA--------- 54
           NH T  P      F+AG I G++  +V  P D+VKTR+Q  +   A  + A         
Sbjct: 46  NHPTVKPW---VHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTR 102

Query: 55  -----------THYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK 103
                      TH+K  +  +  + K+EG   ++KG+   ++   P R++ F +      
Sbjct: 103 PKSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKD 162

Query: 104 LWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ-DVNSK-----FKGPVEV 157
           ++   F   Q T  I +++ A+AG   A    P  L+K R+Q D   K     +K   + 
Sbjct: 163 MYAKAFNNGQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDC 222

Query: 158 LKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPV------------AKSK 205
           LK +I+ +G  GLY G+ S  +  +V     + +  Q++ L+               KS 
Sbjct: 223 LKSVIRNEGFTGLYKGL-SASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKST 281

Query: 206 QEKTRNDLC--AGFVG-GTFGVMFNT-PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKI 261
            EK + + C  +G  G   F     T P +VV++R++    E  NG RKY     S   I
Sbjct: 282 SEKVK-EWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKE--NGKRKYTGLVQSFKVI 338

Query: 262 YHEEGFRALYKGFVPKVLRLGPGGAVLL 289
             EEG  ++Y G  P ++R  P   ++ 
Sbjct: 339 IKEEGLFSMYSGLTPHLMRTVPNSIIMF 366

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 23/101 (22%)

Query: 229 PFDVVKSRIQSD----------------------GNEIINGVRKYNWTWPSVMKIYHEEG 266
           PFD+VK+R+QSD                       N +I     +  T   +  +Y +EG
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 267 FRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF-REFHEGR 306
           FR+L+KG  P ++ + P  ++    +    +++ + F+ G+
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQ 172

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 39/86 (45%), Gaps = 4/86 (4%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           +  +A     +  YP +VV+TR++              Y G++     I+K+EG   MY 
Sbjct: 294 SAGLAKFVASIATYPHEVVRTRLRQTPKENGK----RKYTGLVQSFKVIIKEEGLFSMYS 349

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKL 104
           G++  ++   P   + F + +  I+L
Sbjct: 350 GLTPHLMRTVPNSIIMFGTWEIVIRL 375

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 72.8 bits (177), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 17/229 (7%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AGAI   S    M P+DVVKTR+QL+ +         + KG++    +I+ +EG   + 
Sbjct: 18  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTV--------YNKGMVGSFRKIIAEEGAGALL 69

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG---TKQLTQQISVLSGASAGITEALVI 134
            G    +L  + + A KF   + F K +    G     +    + + S A+A     + +
Sbjct: 70  TGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIAL 129

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            P E  +IRL    +   G V     I+K++G+   YSG    +++   +N   F V  +
Sbjct: 130 CPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFER 189

Query: 195 VREL-LPVAKSKQEKTRNDLCA-----GFVGGTFGVMFNTPFDVVKSRI 237
             EL   +A  K   ++  L A     G   G    + + P D + S++
Sbjct: 190 ASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKV 238

 Score = 34.3 bits (77), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 71/169 (42%), Gaps = 8/169 (4%)

Query: 134 IVPFELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG-- 190
           +VP ++VK R+Q   + + KG V   + II ++G   L +G   T+   ++  A  FG  
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 191 VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRK 250
            +F+   +  +      + +N +   ++G      F    D+    +++    +++    
Sbjct: 91  EVFKKFFIDTLGYDTAARYKNSV---YIGSAAAAEFLA--DIALCPLEATRIRLVSQPTF 145

Query: 251 YNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
            N       +I  EEG  + Y GF P + +  P      +VF     ++
Sbjct: 146 ANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELY 194

>Kwal_33.15597
          Length = 305

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (43%), Gaps = 17/230 (7%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AGAI   +    M P+DVVKTR+QL+ +         + KG+I    QI+  EG   + 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTV--------YNKGMISSFKQIISSEGAGALL 69

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITE---ALVI 134
            G    +L  + + + KF   + F KL+    G  Q     + +   SA I E    + +
Sbjct: 70  TGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIAL 129

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            P E  +IRL    +   G V     I+K++GL   Y+G    +++   +N   F V  +
Sbjct: 130 CPLEATRIRLVSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFER 189

Query: 195 VREL-LPVAKSKQ-----EKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
             E+   +A  K+       T  +L +G   G    + + P D + S++ 
Sbjct: 190 AAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKVN 239

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 78/188 (41%), Gaps = 20/188 (10%)

Query: 121 LSGASAGITEALVIVPFELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTVW 179
           L+GA    T    +VP ++VK R+Q   + + KG +   K II  +G   L +G   T+ 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 180 RNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGT-----FGVMFNTPFDVVK 234
             ++  +  FG  ++V + L +     ++  N   + ++G       F  +   P +  +
Sbjct: 78  GYSLQGSFKFGG-YEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATR 136

Query: 235 SRIQSD---GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVV 291
            R+ S     N ++ G  +          I  EEG  + Y GF P + +  P      +V
Sbjct: 137 IRLVSQPTFANGLVGGFSR----------ILKEEGLSSFYNGFTPILFKQIPYNIAKFLV 186

Query: 292 FTNVMNVF 299
           F     V+
Sbjct: 187 FERAAEVY 194

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 128/313 (40%), Gaps = 47/313 (15%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE----GPM 74
           AG + G+  ++  +P D+VK R Q           +   +  +D +S I++      GP 
Sbjct: 34  AGGVGGVCAVLTGHPFDLVKVRCQ-----------SNQARSAMDAVSHILQAARQAAGPT 82

Query: 75  HM------YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK---------QLTQQIS 119
            +      YKG+  P+L   P  AV F   D   KL  SV  +          +LT    
Sbjct: 83  SLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQM 142

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVW 179
             +G  + I   LV  P E VK+ LQ    K    ++  K I++  G + L+ G  +T+ 
Sbjct: 143 AAAGFISAIPTTLVTAPTERVKVVLQTTQGK-ASFLDAAKQIVRTQGFQSLFKGSLATLS 201

Query: 180 RNAVWNAGYFGVIFQVRELLPVAK--SKQEKTRNDLCAGFVGGTFGV---MFNTPFDVVK 234
           R+   +A YF      +E L  A   +  E +  ++C    GG  GV   +   P D VK
Sbjct: 202 RDGPGSALYFASYEICKEYLNKASGHTSGELSITNVC--ISGGMAGVSMWVVVFPIDTVK 259

Query: 235 SRIQSDGNEIINGVRKYNWTWPSVMKIYHEE-GFRALYKGFVPKVLRLGPGGAVLLVVFT 293
           +++QS          K          IY+   G +  + G  P +LR  P  A   +   
Sbjct: 260 TQLQSS--------SKRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLGVE 311

Query: 294 NVMNVFREFHEGR 306
              ++F++F + +
Sbjct: 312 LTHSLFKKFEQQK 324

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 201 VAKSKQEKTRN--DLCAGFVGGTFGVMFNTPFDVVKSRIQSD-GNEIINGVRKYNWTWPS 257
           V+++K + T N   L AG VGG   V+   PFD+VK R QS+     ++ V         
Sbjct: 18  VSQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQ 77

Query: 258 VMKIYHEEGFRALYKGFVPKVLRLGP 283
                     R  YKG VP +L + P
Sbjct: 78  AAGPTSLNAVRGFYKGVVPPLLGVTP 103

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 89/201 (44%), Gaps = 31/201 (15%)

Query: 113 QLTQQI-SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQ------- 164
           QLT+ + S+ +G   G+   L   PF+LVK+R Q  +++ +  ++ + HI++        
Sbjct: 24  QLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ--SNQARSAMDAVSHILQAARQAAGP 81

Query: 165 ---DGLKGLYSGV-ESTVWRNAVWNAGYFGVIFQVRELLPVAKS--------KQEKTRND 212
              + ++G Y GV    +    ++   ++G     + +  V  S        + E T + 
Sbjct: 82  TSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQ 141

Query: 213 LCA-GFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
           + A GF+      +   P + VK  +Q+       G   +     +  +I   +GF++L+
Sbjct: 142 MAAAGFISAIPTTLVTAPTERVKVVLQTT-----QGKASF---LDAAKQIVRTQGFQSLF 193

Query: 272 KGFVPKVLRLGPGGAVLLVVF 292
           KG +  + R GPG A+    +
Sbjct: 194 KGSLATLSRDGPGSALYFASY 214

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 18/117 (15%)

Query: 2   SSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVI 61
           +S H T   L      ++G +AG+S  +V++P+D VKT++Q          S++  + ++
Sbjct: 224 ASGH-TSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQ----------SSSKRQSML 272

Query: 62  DCLSQIVKKEGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ 117
           +    I    G +   + G+   +L   P  A  F      ++L  S+F  K+  QQ
Sbjct: 273 EVTRMIYNTRGGIKGFFPGVGPAILRSFPANAATFLG----VELTHSLF--KKFEQQ 323

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 108/246 (43%), Gaps = 29/246 (11%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-YKGVIDCLSQIVKK 70
           P  + F+AG + GI     M+ LD VKTR Q        GA   H YK ++     +  +
Sbjct: 52  PIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ--------GAPNVHKYKHMLQAYRTMFIE 103

Query: 71  EGPMH-MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAG-I 128
           EG    +Y G  + ML   P  A+ F S  EF K  +++     L    S L+    G  
Sbjct: 104 EGFRRGLYGGYCAAMLGSFPSAAI-FFSTYEFTK--RTMINDYHLNDTFSHLTAGFLGDF 160

Query: 129 TEALVIVPFELVKIRLQ--------DVNS--KFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
             + V VP E++K RLQ          NS   +K     +  I + +G+  L+ G ++T+
Sbjct: 161 FSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATL 220

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSK-----QEKTRNDLCAGFVGGTFGVMFNTPFDVV 233
            R+  ++A  F    + R+   + + K          N++  G   G    +  TP DVV
Sbjct: 221 ARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVV 280

Query: 234 KSRIQS 239
           K+R+Q+
Sbjct: 281 KTRVQT 286

>Kwal_27.11626
          Length = 299

 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 122/281 (43%), Gaps = 33/281 (11%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRM---QLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           +  A AGI E+ V +P+D V  R+     ++S+ A   S    +   + L + +      
Sbjct: 14  LGSASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRL-----F 68

Query: 75  HMYKGISSPMLMEAPKRAVKFAS--------NDEFIKLWKSVFGTKQLTQQISVLSGASA 126
            ++ G+      +  +R  K+          N  F   + + FG K      S  +G+  
Sbjct: 69  TLFPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLI 128

Query: 127 GITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
           GI E +V++P +++KI+ Q     FKG   +   I+K +G  GLY G   T  RNA  + 
Sbjct: 129 GIGE-IVLLPLDVLKIKRQTNPESFKGRGFI--KILKDEGF-GLYRGWGWTAARNAPGSF 184

Query: 187 GYFGVIFQVRELLPVAKSKQEKT-RNDLCAGFVGGTFGVMFNTPFDVVKSRIQS---DGN 242
             FG     +E +   K     T   +  +  VG +  ++ + P DV+K+RIQ+   D  
Sbjct: 185 ALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNP 244

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           E  +G R        V      EG  A +KG  PK+L  GP
Sbjct: 245 E--SGFR-------IVQNTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 14/100 (14%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHY---KGVIDCLSQIVKKEG 72
            F++  +   + L+V  PLDV+KTR+Q +           H+   +     +   +K EG
Sbjct: 211 NFVSSIVGASASLIVSAPLDVIKTRIQNR-----------HFDNPESGFRIVQNTLKNEG 259

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK 112
               +KG++  +L   PK    FA     I  +  + G K
Sbjct: 260 ITAFFKGLTPKLLTTGPKLVFSFALAQSLIPAFDKMLGQK 299

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 130/300 (43%), Gaps = 27/300 (9%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P + + ++G  AG    ++++PLD+ K R+QL ++       +T  KG  +  S+IV  +
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLIT-------STTKKGYRNLWSEIVGSD 59

Query: 72  GPM--HMYKGISSPMLMEAPKRAVKFAS----NDEFIKLWKSVFGTKQLTQQISVLSGAS 125
             +   +Y+G++  ++       + FAS     D  I     +   K L+  + + + AS
Sbjct: 60  LSLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASAS 119

Query: 126 AGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
           +G+   ++  P  ++K R+    +     ++VL+ +IK DG++GL+ G+   +       
Sbjct: 120 SGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPAL-VGVSQG 178

Query: 186 AGYFGVIFQVRELLPVAKSKQEKTRN--DLCAGFVGGTFGVMFNTPFDVVKSRIQS-DGN 242
           A +F     ++  L +     ++  N   +    V          PF ++KS +QS   +
Sbjct: 179 ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQSFQAS 238

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREF 302
           E  N  +      P    IY   G    YKG    +LR  P   +   ++ N    F+ F
Sbjct: 239 E--NDFK----LLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYEN----FKSF 288

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 72.0 bits (175), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 137/317 (43%), Gaps = 55/317 (17%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQ---LQVS---TGAAGASAT-----HYKGVIDCLSQ 66
           ++GA+AG    +++ PLDV KTR+Q   LQ++   T   G+ AT     +Y G+   L+ 
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 67  IVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ-LTQQISVLSGAS 125
           IV+ E    +YKGI   +L   P   + F+  +     +   F   + L+  +S L+   
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALT--- 224

Query: 126 AGITEALVIVPFELVKIRLQDVNSK-------FKGPVEVLKHIIKQDGLKGLYSGVESTV 178
           AG     +  P  +VK RL   + K       +K  ++    I K +G+K  YSG+  ++
Sbjct: 225 AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSL 284

Query: 179 WRNAVWNAGYFGVIFQVRELL---PVAKSKQEK-----TRNDLCAGFVGGTFGVM----- 225
           +   +  A +F V  +++++L   P  +  QE        N    G      G +     
Sbjct: 285 F-GLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLIVASC 343

Query: 226 --------FNTPFDVVKSRIQ--SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFV 275
                      P +++++R+Q  SD    I  +         +   Y +EG R  Y GF+
Sbjct: 344 GSKMIASTLTYPHEILRTRLQLKSDMKPSIKSI---------IRTTYAKEGIRGFYSGFL 394

Query: 276 PKVLRLGPGGAVLLVVF 292
             + R  P  A+ LV F
Sbjct: 395 TNMFRTVPASAITLVSF 411

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 76/185 (41%), Gaps = 21/185 (11%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVE-------------------- 156
           +I+ LSGA AG    +++ P ++ K RLQ    +  GPV                     
Sbjct: 104 EITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWG 163

Query: 157 VLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAG 216
            L  I++ + ++GLY G+   V         YF V  + +   P   +  E   + + A 
Sbjct: 164 TLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSA- 222

Query: 217 FVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVP 276
              G        P  VVK+R+     + I G+  Y  T  + +KIY  EG ++ Y G +P
Sbjct: 223 LTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIP 282

Query: 277 KVLRL 281
            +  L
Sbjct: 283 SLFGL 287

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 70.9 bits (172), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 81/159 (50%), Gaps = 2/159 (1%)

Query: 123 GASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNA 182
           G +AGI   +   P +L K+RLQ         V++L+ I+K +G+ GLY+G+ +++ R  
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQC 72

Query: 183 VWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGN 242
            +    FG+   ++E + + + K       L A  V G  G +     D++  R+Q+D  
Sbjct: 73  TYTTARFGMYDALKEHV-IPRDKLTNMWYLLGASMVSGALGGLAGNFADLINIRMQNDSA 131

Query: 243 EIINGVRKYNWTWPSVMKIYHEEGFRALY-KGFVPKVLR 280
             ++  R Y      ++KIY  EG ++L+  G+ P ++R
Sbjct: 132 LPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVR 170

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 127/289 (43%), Gaps = 43/289 (14%)

Query: 14  RYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGP 73
           +Y +  G  AGI  +M  +PLD+ K R+Q         A+      ++  L  I+K EG 
Sbjct: 7   KYPWWYGGAAGIFAVMNTHPLDLTKVRLQ---------AAPIPKPTIVQMLRSILKNEGI 57

Query: 74  MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ-----ISVLSGASAGI 128
           + +Y G+S+ +L +      +F   D    L + V    +LT        S++SGA  G+
Sbjct: 58  VGLYAGLSASLLRQCTYTTARFGMYDA---LKEHVIPRDKLTNMWYLLGASMVSGALGGL 114

Query: 129 TEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLY-SGVESTVWR 180
                    +L+ IR+Q       D    +K  ++ +  I K +G K L+ +G +  + R
Sbjct: 115 AGNFA----DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVR 170

Query: 181 NAVWNAGYFGVIFQVRELLPVAKSKQEKTRN------DLCAGFVGGTFGVMFNTPFDVVK 234
             +  A    V + + +   V K   +  +N       L AGFV  T      +P DV+K
Sbjct: 171 GVLMTASQV-VTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVC----SPADVIK 225

Query: 235 SRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           + +    N        ++ ++  +M+  ++EG   +++G+VP   RL P
Sbjct: 226 TIVM---NAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAP 271

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 71.6 bits (174), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 125/287 (43%), Gaps = 35/287 (12%)

Query: 30  VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-MYKGISSPMLMEA 88
            M+ LD VKTR Q          S   YK +I     I+ +EG    +Y G S  ML   
Sbjct: 72  AMHSLDTVKTRQQ-------GAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSF 124

Query: 89  PKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAG-ITEALVIVPFELVKIRLQDV 147
           P  A+ FA+  E+ K  + + G   + +  S L+    G    + V VP E++K RLQ +
Sbjct: 125 PSAAIFFATY-EYTK--RKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQ-L 180

Query: 148 NSKFKGP-----------VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVR 196
             ++  P            + +  I++++G   L+ G ++T+ R+  ++   F    + R
Sbjct: 181 QGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFR 240

Query: 197 ELLPVAKSK----QEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRK-- 250
           +L    ++K         N++  G   G    +  TP DVVK+RIQ+   +I     +  
Sbjct: 241 QLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNL 300

Query: 251 -----YNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
                 N     +M +Y  EG   L+ G  P+ +      +++L+++
Sbjct: 301 KQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 28/182 (15%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQ-VSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
              AG +       V  P +V+KTR+QLQ         S  +YK + D ++ IV++EG  
Sbjct: 153 HLTAGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWP 212

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS----VLSGASAGITE 130
            ++ G  + +  + P   ++FA  ++F +L  +V   K   + +S    +++GA+AG   
Sbjct: 213 TLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAV-ENKTFDEDLSLSNEIITGAAAGGLA 271

Query: 131 ALVIVPFELVKIRLQD------------------VNSKFKGPVEVLKHIIKQDGLKGLYS 172
            ++  P ++VK R+Q                    NS  KG    +  + K +GL GL+S
Sbjct: 272 GIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKG----MMTVYKTEGLAGLFS 327

Query: 173 GV 174
           GV
Sbjct: 328 GV 329

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 72.0 bits (175), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 135/315 (42%), Gaps = 33/315 (10%)

Query: 17  FMAGAIAGISELMVMYPLDVVK----TRMQLQV----STGAAGASATHYKG------VID 62
           F+AG I+G+       P D +K     R  L      ST    A   H K       ++ 
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG---TKQLTQQIS 119
            +  + ++ G    Y G     L   P+ ++KF S +   KL   V     TK L++  +
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 120 VLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLYSGV 174
            ++G  AG+     + P + +K R+Q   +N++ KG    ++  K +  + GLK  Y GV
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGV 383

Query: 175 ESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND---------LCAGFVGGTFGVM 225
              V     + A   G    +++    +K+K+   + +         L  G   GTFG  
Sbjct: 384 TVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGAT 443

Query: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285
              P +++++R+Q+ G        +Y+     ++K    EG+  L+KG VP + ++ P  
Sbjct: 444 VVYPINLLRTRLQAQGT--FAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAV 501

Query: 286 AVLLVVFTNVMNVFR 300
           ++  + + N+  + +
Sbjct: 502 SISYLCYENLKKLMK 516

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 127/283 (44%), Gaps = 23/283 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
            +AGA++G+    +  P+D +K R+QL  + G     +     V++    ++K EG    
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQ----VMEVARSMIKNEGIRSF 75

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           +KG     L+     + +F+S   F + + + FG +     + V  GA AGIT ++V  P
Sbjct: 76  WKGNIPGSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLHSLVV--GAFAGITSSIVSYP 132

Query: 137 FELVKIRLQDVNSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV 195
           F++++ RL   N      +   ++ I K +GL G + G  +++    +  +  FG    +
Sbjct: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192

Query: 196 R------ELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249
           R      E    A  K E    +  AG +GG    +   P + ++ R+Q   ++ +    
Sbjct: 193 RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFS 252

Query: 250 KYNWTWPSV---------MKIYHEEGFRALYKGFVPKVLRLGP 283
           +++  + S          ++I  +EG  +LY+G +  + +  P
Sbjct: 253 RHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 81/184 (44%), Gaps = 35/184 (19%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           +  + GA AGI+  +V YP DV++TR+           +  H   +   +  I K EG  
Sbjct: 114 HSLVVGAFAGITSSIVSYPFDVLRTRL--------VANNQMHSMSITREVRDIWKLEGLP 165

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLW-----KSVFGTKQLTQQISVL---SGASA 126
             +KG  + M       ++ F +  E I+++     K+    K+   +++ L   +G   
Sbjct: 166 GFFKGSIASMTTITLTASIMFGTY-ETIRIYCDENEKTTAAHKKW--ELATLNHSAGTIG 222

Query: 127 GITEALVIVPFELVKIRLQDVNSK--------------FKGP--VEVLKHIIKQDGLKGL 170
           G+   ++  P E ++ R+Q +NSK              +KG     +   I+KQ+G+  L
Sbjct: 223 GVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSL 282

Query: 171 YSGV 174
           Y G+
Sbjct: 283 YRGI 286

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/183 (19%), Positives = 78/183 (42%), Gaps = 15/183 (8%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-----VEVLKHIIKQDGLKGLYSG 173
           ++L+GA +G+    +  P + +KIRLQ   +    P     +EV + +IK +G++  + G
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

Query: 174 -VESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232
            +  ++      +A +       R L P      E   + L  G   G    + + PFDV
Sbjct: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFG---LEARLHSLVVGAFAGITSSIVSYPFDV 135

Query: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           +++R+ ++       + +       V  I+  EG    +KG +  +  +    +++   +
Sbjct: 136 LRTRLVANNQMHSMSITR------EVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTY 189

Query: 293 TNV 295
             +
Sbjct: 190 ETI 192

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-----YKG--VIDCLSQIVKKE 71
           AG I G+   ++ +PL+ ++ RMQ   S      S        YKG        QI+K+E
Sbjct: 218 AGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQE 277

Query: 72  GPMHMYKGISSPMLMEAPKRAVKF 95
           G   +Y+GI   +    P   V F
Sbjct: 278 GVSSLYRGILVALSKTIPTTFVSF 301

>Scas_715.45
          Length = 305

 Score = 70.5 bits (171), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 116/265 (43%), Gaps = 33/265 (12%)

Query: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92
           PLD++K R+Q+           T Y+     + QI+KKEG   ++ G+ +  +  + + A
Sbjct: 36  PLDLIKCRLQVD---------PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 93  VKFASNDEFIKLWKSVFGTKQLT-----QQISVLSGASAGITEALVIVPFELVKIRLQDV 147
            K+   + F +L+ +     + T       I +LS A+A     +++ PFE +K++ Q  
Sbjct: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146

Query: 148 NSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVREL----LPVA 202
              +   V E  K +  ++GL G Y G+     R   +    F    ++ E     LP  
Sbjct: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK 206

Query: 203 KSKQEKTRN---DLCAGFVGGTFGVMFNTPFDVVKSRIQSDG--NEIINGVRKYNWTWPS 257
           KS+    +        G++ G    + + P DV+ S+I ++   NE +N   K       
Sbjct: 207 KSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALK------- 259

Query: 258 VMKIYHEEGFRALYKGFVPKVLRLG 282
             +IY   GF  L+ G   ++L +G
Sbjct: 260 --RIYSRIGFVGLWNGLPVRILMIG 282

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 20/160 (12%)

Query: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193
           + P +L+K RLQ   + ++     +  I+K++GL  L++GV +T    ++  AG +G   
Sbjct: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93

Query: 194 QVRELLPVAKSKQE------KTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD----GNE 243
             + L      K E      +T   L +      F  +   PF+ +K + Q+      N 
Sbjct: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN 153

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           +I G +          K+Y +EG    YKG  P   R  P
Sbjct: 154 VIEGWK----------KMYAKEGLNGFYKGITPLWCRQIP 183

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 71/164 (43%), Gaps = 14/164 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
            ++ A A     +++ P + +K + Q  +              VI+   ++  KEG    
Sbjct: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWC--------NNVIEGWKKMYAKEGLNGF 170

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ----LTQQISV--LSGASAGITE 130
           YKGI+     + P    KF S +  ++   +   TK+      QQISV  + G  AGI  
Sbjct: 171 YKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILC 230

Query: 131 ALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174
           A+V  P +++  ++ +     +     LK I  + G  GL++G+
Sbjct: 231 AIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 98/230 (42%), Gaps = 17/230 (7%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AGAI   S    M P+DVVKTR+QL+ +         + KG++    QI+  EG   + 
Sbjct: 22  LAGAIGCGSTHSSMVPIDVVKTRIQLEPTV--------YNKGMVGSFKQIIAGEGAGALL 73

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV---I 134
            G    +L  + + A KF   + F K +    G    ++  + +   SA + E L    +
Sbjct: 74  TGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIAL 133

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            P E  +IRL        G V     I+K++G+   YSG    +++   +N   F V  +
Sbjct: 134 CPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFER 193

Query: 195 VRELL-----PVAK-SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
             E       P  K S    T  +L +G   G    + + P D + S++ 
Sbjct: 194 ASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVN 243

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 69/172 (40%), Gaps = 8/172 (4%)

Query: 134 IVPFELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG-- 190
           +VP ++VK R+Q   + + KG V   K II  +G   L +G   T+   ++  A  FG  
Sbjct: 35  MVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 191 VIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRK 250
            +F+   +  +      + +N +  G        M     D+    +++    +++  + 
Sbjct: 95  EVFKKFFIDNLGYDTASRYKNSVYMGSA-----AMAEFLADIALCPLEATRIRLVSQPQF 149

Query: 251 YNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREF 302
            N       +I  EEG  + Y GF P + +  P      +VF      +  F
Sbjct: 150 ANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGF 201

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 125/289 (43%), Gaps = 33/289 (11%)

Query: 7   TQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQ 66
           + AP P +Y +  G   GI   +  +PLD+ K R+Q      A     T    ++   SQ
Sbjct: 2   SSAPEPVKYPWWYGGFGGIVACVATHPLDLAKVRLQT-----APAPKPT----LVRMASQ 52

Query: 67  IVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK---LWKSVFGTKQLTQQISVLSG 123
           I++ EG   +Y G+++ +L +      +F   D F+K   + K    +       S+ SG
Sbjct: 53  ILRNEGVPGLYSGLTAAILRQCTYTTARFGVYD-FVKERYIPKEYLNSMLYLLPCSMFSG 111

Query: 124 ASAGITEALVIVPFELVKIRLQDVNS-------KFKGPVEVLKHIIKQDGLKGLYSGVES 176
           A  G    L+  P ++V IR+Q+ +S        +K   + L  I   +G+  L++G + 
Sbjct: 112 AVGG----LIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQP 167

Query: 177 TVWRNAVWNAGYFGVIFQVRE--LLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVK 234
            + R  +  +    V + + +  L+      ++       +  + G       +P DV+K
Sbjct: 168 NLVRGILMTSSQV-VTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIK 226

Query: 235 SRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           +R+ +      +   +       ++    +EG   +++G++P  +RLGP
Sbjct: 227 TRVMNAHKHSHDSAVRI------LLDAVKQEGPSFMFRGWLPSFVRLGP 269

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 8/88 (9%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F +  +AG+    V  P DV+KTR+          A    +   +  L   VK+EGP  
Sbjct: 204 HFASSLLAGLVATTVCSPADVIKTRVM--------NAHKHSHDSAVRILLDAVKQEGPSF 255

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIK 103
           M++G     +   P   + F + ++  K
Sbjct: 256 MFRGWLPSFVRLGPNTILIFLTVEQLRK 283

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 124/299 (41%), Gaps = 65/299 (21%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH--YKGVIDCLSQIVKKEGPMHMY 77
           GA+A       +YPLD+ KT +Q Q     +G S     YK VIDC+ +I KK G + +Y
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVF---------GTKQLTQ-----QISVLS- 122
           +G+++ +       A  F  N  +   W S+          G  QL       ++S +  
Sbjct: 70  QGLATNV-------AANFVQNFIYF-FWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEE 121

Query: 123 ---GASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVW 179
              G SAG    +V  P  ++  R Q       G    LK +IKQ     +Y   ES   
Sbjct: 122 LALGMSAGAMTQVVTNPISVISTRQQLTKD---GEDASLKAVIKQ-----IYE--ESNGD 171

Query: 180 RNAVWN------------AGYFGVIFQVRELLPVAK--SKQEKTRNDLCAG--FVGGTFG 223
             A W             A  +G   +++ ++  AK  S  +K    L AG  F+ G F 
Sbjct: 172 LTAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFS 231

Query: 224 VMFNT----PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
            M +T    P  V K  +Q  G+       K+      +  IY  EGF +L+KG +P+V
Sbjct: 232 KMISTFVTQPLIVAKITLQGKGS-------KFKTFQEVLQHIYQNEGFLSLWKGVIPQV 283

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 94/208 (45%), Gaps = 22/208 (10%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY-K 78
           G  AG    +V  P+ V+ TR QL       G  A+  K VI  + +  +  G +  + K
Sbjct: 125 GMSAGAMTQVVTNPISVISTRQQLT----KDGEDAS-LKAVIKQIYE--ESNGDLTAFWK 177

Query: 79  GISSPMLMEAPKRAVKFASNDEF---IKLWKSVFGTKQLTQQISV----LSGASAGITEA 131
           G    +++ +   A+ + S  +    I   K + G+++++ Q+S     L G  + +   
Sbjct: 178 GFKVALVL-STNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMIST 236

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFG- 190
            V  P  + KI LQ   SKFK   EVL+HI + +G   L+ GV   V +  +     F  
Sbjct: 237 FVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQVSKGVIVQGLLFTY 296

Query: 191 ---VIFQVRELLPVAKSKQEKTRNDLCA 215
              ++  +R+LL + K+     RN L A
Sbjct: 297 KDEIVRVIRKLLFLYKNI--IARNKLVA 322

>Scas_697.47
          Length = 328

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 128/303 (42%), Gaps = 29/303 (9%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG + G+  ++  +P D++K R Q    +G A ++    K ++     I      ++
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ----SGQASSTIHAIKIILKDARAIPTSNMLVN 94

Query: 76  ----MYKGISSPMLMEAPKRAVKFASNDEFIKL-WKSVFGTKQLTQQISVLSGASAGITE 130
                YKG+  P+L   P  AV F   D   K+  +S   + QLT      +G  + I  
Sbjct: 95  SVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPT 154

Query: 131 ALVIVPFELVKIRLQDVNSKFKGP-VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
            LV  P E +K+ LQ   +  K   +   K+I+K  G+K L+ G  +T+ R+   +A YF
Sbjct: 155 TLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYF 214

Query: 190 GV------IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD--G 241
                       R     +K+ +    N   AG + G    +   P D +K+++QS    
Sbjct: 215 ASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKLQSSSGS 274

Query: 242 NEIINGVRKYNWTWPSVMKIYHEE-GFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
             ++   R          +IY +  G +  + G  P +LR  P  A   +      ++F+
Sbjct: 275 QSMVAATR----------EIYVKRGGIKGFFPGLGPALLRSFPANAATFLGVELTHSLFK 324

Query: 301 EFH 303
           +++
Sbjct: 325 KYN 327

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 88/195 (45%), Gaps = 15/195 (7%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           ++ + ++ A L       AG I+ I   +V  P + +K  +Q         A A      
Sbjct: 128 VTRSDSSSAQLTMGQMAAAGFISAIPTTLVTAPTERIKVVLQT--------AGANSKTSF 179

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFAS---NDEFIKLWKSVFGTKQLTQQ 117
           I     IVK  G   ++KG  + +  + P  A+ FAS   + +F+    +   +K     
Sbjct: 180 IGAAKNIVKDGGVKSLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVN 239

Query: 118 IS--VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHI-IKQDGLKGLYSGV 174
           I+   L+G  AG++  LV+ P + +K +LQ  +S  +  V   + I +K+ G+KG + G+
Sbjct: 240 IANVCLAGGIAGMSMWLVVFPIDTIKTKLQS-SSGSQSMVAATREIYVKRGGIKGFFPGL 298

Query: 175 ESTVWRNAVWNAGYF 189
              + R+   NA  F
Sbjct: 299 GPALLRSFPANAATF 313

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 127/303 (41%), Gaps = 31/303 (10%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK----KE 71
            F+AG + G+  +   +P D++K R Q     G A ++      +I      VK      
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQ----NGQANSTVHAITNIIKEAKTQVKGTLFTN 93

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASND---EFIKLWKSVFGTKQLTQQISVLSGASAGI 128
                YKG+  P+L   P  AV F   D   + +       G+ +LT      +G  + I
Sbjct: 94  SVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAI 153

Query: 129 TEALVIVPFELVKIRLQDVNSKFKGP-VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAG 187
              LV  P E VK+ LQ  +   KG  ++  K I+K+ G+  L+ G  +T+ R+   +A 
Sbjct: 154 PTTLVTAPTERVKVVLQTSS---KGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSAL 210

Query: 188 YFGVIFQVRELLPVAKSKQEKTRND------LC-AGFVGGTFGVMFNTPFDVVKSRIQSD 240
           YF      +  L   + +Q+  +++      +C AG + G    +   P D +K+++Q+ 
Sbjct: 211 YFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQAS 270

Query: 241 GNEIINGVRKYNWTWPSVMKIYHEE-GFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
                           +  +IY +  G +  + G  P +LR  P  A   +      ++F
Sbjct: 271 STR--------QNMLSATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGVEMTHSLF 322

Query: 300 REF 302
           +++
Sbjct: 323 KKY 325

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 8/89 (8%)

Query: 200 PVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ-----SDGNEIINGVRKYNWT 254
           P+  +   +      AG VGG   V    PFD++K R Q     S  + I N +++    
Sbjct: 26  PIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQ 85

Query: 255 WPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
               +     +GF   YKG +P +L + P
Sbjct: 86  VKGTLFTNSVKGF---YKGVIPPLLGVTP 111

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 120/281 (42%), Gaps = 31/281 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             + G + G++  +V+ P D++KTR+Q    T   G         I    Q+ +   P  
Sbjct: 10  HLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKE-----IRSPKQLWRGALPSS 64

Query: 76  MYKGISSPMLMEAPK--RAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
           +   I S + +      R        + +    S     QLT   ++ SGA        +
Sbjct: 65  LRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFL--PQLTMYENLASGAFTRGVVGFI 122

Query: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193
            +P  ++K+R +     +K   E  +HI   +G++G ++G  +TV R+A + AG + +++
Sbjct: 123 TMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPY-AGLYVLLY 181

Query: 194 Q-----VRELLPVAK---------SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQS 239
           +     V  +LP +          +    T  +  + F+  +      +PFD +K+R+Q 
Sbjct: 182 EKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQL 241

Query: 240 DGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
           D         K++  + +++ I  +E F+ L+ G   ++ R
Sbjct: 242 DPT-------KFSGFYKTLVLIVSKEKFKNLFDGLTLRLTR 275

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 16/97 (16%)

Query: 204 SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYH 263
           +++ KT + L  GFVGG    +   PFD++K+R+Q + +  +         W ++ +I  
Sbjct: 2   AERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTL---------WGTLKEIRS 52

Query: 264 EEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
               + L++G +P  LR   G A+ L    + +NVFR
Sbjct: 53  P---KQLWRGALPSSLRTSIGSALYL----STLNVFR 82

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 79/185 (42%), Gaps = 26/185 (14%)

Query: 120 VLSGASAGITEALVIVPFELVKIRL-QDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
           ++ G   G+T A+V+ PF+L+K RL Q+ ++   G ++ ++        K L+ G   + 
Sbjct: 11  LIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSP------KQLWRGALPSS 64

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSK----------QEKTRNDLCAG-FVGGTFGVMFN 227
            R ++ +A Y   +   R  +   K++          Q     +L +G F  G  G +  
Sbjct: 65  LRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFI-T 123

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            P  ++K R +S        +  Y     +   IY  EG R  + G    V+R  P   +
Sbjct: 124 MPITIIKVRYEST-------MYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGL 176

Query: 288 LLVVF 292
            ++++
Sbjct: 177 YVLLY 181

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 69/170 (40%), Gaps = 22/170 (12%)

Query: 30  VMYPLDVVKTRMQLQVSTGAAGASATHY-------KGVIDCLSQIVKKEGP-----MHMY 77
           +  P+ ++K R +  + +  +   AT +       +G  +     V ++ P     + +Y
Sbjct: 122 ITMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLY 181

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           +     + M  P   + +     F         T  +   IS    AS   T   +  PF
Sbjct: 182 EKAKLLVPMMLPSSTISYDEAGMFTTY------TSTVVNSISAFMSASLATT---ITSPF 232

Query: 138 ELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAG 187
           + +K R+Q   +KF G  + L  I+ ++  K L+ G+   + R A ++AG
Sbjct: 233 DTIKTRMQLDPTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKA-FSAG 281

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 85/192 (44%), Gaps = 26/192 (13%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQDGLKG--- 169
           Q  V+SG SAG    LV+ P +L+K+RLQ           GP  V+K II+     G   
Sbjct: 10  QKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSV 69

Query: 170 ---LYSGVESTVWRNAVWNAGYFGVIFQVRELL--PVAKSKQEKTR---ND--------L 213
              LY G+   ++ NA+    YFG+    +EL+   VAK  + + +   ND        L
Sbjct: 70  TNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYL 129

Query: 214 CAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKG 273
            AG   G    +   P  V+K+RI S           Y   +  V ++   +GF+ L+KG
Sbjct: 130 SAGASSGLMTAILTNPIWVIKTRIMSTSK---GAQGAYTSMYNGVQQLLRTDGFQGLWKG 186

Query: 274 FVPKVLRLGPGG 285
            VP +  +  G 
Sbjct: 187 LVPALFGVSQGA 198

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 132/321 (41%), Gaps = 58/321 (18%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P + + ++G  AG    +V++PLD++K R+QL     A  A   HY G    + +I++  
Sbjct: 8   PLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLS----ATSAQKAHY-GPFMVIKEIIRSS 62

Query: 72  G------PMHMYKGISSPMLMEAPKRAVKF---ASNDEFI---------KLWKSVFGTKQ 113
                     +Y+G+S  +   A    V F       E I            K V    +
Sbjct: 63  ANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHK 122

Query: 114 LTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVL----KHIIKQDGLKG 169
           +   I + +GAS+G+  A++  P  ++K R+   +   +G    +    + +++ DG +G
Sbjct: 123 MNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQG 182

Query: 170 LYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGF------------ 217
           L+ G+       A++      + F V + L     KQ K R     G             
Sbjct: 183 LWKGLVP-----ALFGVSQGALYFAVYDTL-----KQRKLRRKRENGLDIHLTNLETIEI 232

Query: 218 --VGGTFGVMFNTPFDVVKSRIQS-DGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGF 274
             +G    V    PF ++KS +QS   NE     +K+   +P +  I   +GF  LYKG 
Sbjct: 233 TSLGKMVSVTLVYPFQLLKSNLQSFRANE-----QKFR-LFPLIKLIIANDGFVGLYKGL 286

Query: 275 VPKVLRLGPGGAVLLVVFTNV 295
              ++R  P   +   V+ N+
Sbjct: 287 SANLVRAIPSTCITFCVYENL 307

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 115/283 (40%), Gaps = 38/283 (13%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV---IDCLSQIVKKEG 72
             ++G   G++ +  + PLD++KTR+Q         A A+  + V   +    ++ +   
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQ--------QAQASSLRSVLREVRTTRELWRGTL 62

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEAL 132
           P  +   I S + +     +    +     +   S+    Q  Q +  L+GA +     L
Sbjct: 63  PSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNL--LTGALSRAAVGL 120

Query: 133 VIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI 192
           V +P  ++K+R +     + G  E  +HI + +G +G + G  +T  R+A +   Y  + 
Sbjct: 121 VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY 180

Query: 193 FQVRELLPVA----------KSKQEKTRNDLCAG---FVGGTFGVMFNTPFDVVKSRIQS 239
            Q +E+LP A            K     + +  G   F+  +       PFD +K+R+Q 
Sbjct: 181 EQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQL 240

Query: 240 DGNEI--INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
             + +  +  +R           I  EE  R L+ G   ++ R
Sbjct: 241 QSHPVGFVQTLR----------HIVCEERARTLFDGLSLRLCR 273

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 76/184 (41%), Gaps = 26/184 (14%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQ-DGLKGLYSGVESTV 178
           ++SG   G+     + P +L+K RLQ   +        L+ ++++    + L+ G   + 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQA------SSLRSVLREVRTTRELWRGTLPSA 65

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRN----------DLCAGFVGGTFGVMFNT 228
            R ++ +A Y  ++   R  L  A+  + +TR+          +L  G +      +   
Sbjct: 66  LRTSIGSALYLSLLNYSRSAL--ARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTM 123

Query: 229 PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVL 288
           P  V+K R +S        +  YN    +   I+  EG R  +KG     LR  P   + 
Sbjct: 124 PITVIKVRYEST-------LYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 289 LVVF 292
           ++++
Sbjct: 177 VLLY 180

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 10/72 (13%)

Query: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92
           P D +KTRMQLQ          +H  G +  L  IV +E    ++ G+S  +  +A    
Sbjct: 230 PFDTIKTRMQLQ----------SHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSAC 279

Query: 93  VKFASNDEFIKL 104
           + +   +E +KL
Sbjct: 280 IAWGIYEELLKL 291

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 133/307 (43%), Gaps = 32/307 (10%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P + + ++G  AG    +  +PLD+VK R+QL        A+    +G  D + +IVK +
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLL-------ATNKKPQGYYDVVKRIVK-D 58

Query: 72  GPMH-----MYKGISSPML------------MEAPKRAVKFASNDEFIKLWKSVFGTKQL 114
              H      Y+G+   +L              A K  V    N +  +   ++   K++
Sbjct: 59  SKQHSFFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEM 118

Query: 115 TQQISVLSGASAGITEALVIVPFELVKIRLQD---VNSK-FKGPVEVLKHIIKQDGLKGL 170
           T  + +L+ A +G+  +++  P  ++K R+     V+S+ ++  V+ +K + + +GL G 
Sbjct: 119 TSLMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGF 178

Query: 171 YSGVESTVW---RNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFN 227
           + G+  +++   + A++   Y  + +       V K K+      +    +     V   
Sbjct: 179 WRGLVPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAV 238

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAV 287
            P  ++KS +QS     +   +  +  W  +  IY  +G   LYKG +  ++R  P   +
Sbjct: 239 YPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCI 298

Query: 288 LLVVFTN 294
              V+ N
Sbjct: 299 TFCVYEN 305

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 87/206 (42%), Gaps = 22/206 (10%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGPVEVLKHIIKQDG----LKGL 170
           Q  ++SG +AG    +   P +LVK+RLQ    N K +G  +V+K I+K        +  
Sbjct: 9   QKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRET 68

Query: 171 YSGVESTVWRNAVWNAGYFGV-------IFQ-----VRELLPVAKSKQEKTR-NDLCAGF 217
           Y G+   +  N+V    YFG+       +FQ     V+       + +E T    L A  
Sbjct: 69  YRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAA 128

Query: 218 VGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPK 277
           + G    +   P  V+K+RI S     ++  R Y  T   + K+Y  EG    ++G VP 
Sbjct: 129 MSGVATSVLTNPIWVIKTRIMS--TSFVDS-RSYRSTVDGIKKLYRIEGLAGFWRGLVPS 185

Query: 278 VLRLGPGGAVLLVVFTNVMNVFREFH 303
           +  +  G     V  T   + F   H
Sbjct: 186 LFGVSQGAIYFTVYDTLKYHYFAAKH 211

>Kwal_23.3529
          Length = 395

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 126/293 (43%), Gaps = 29/293 (9%)

Query: 30  VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-MYKGISSPMLMEA 88
           VM+ LD VKTR Q          +A  Y+ +I    +I  +EG    +Y G ++ ML   
Sbjct: 102 VMHSLDTVKTRQQ-------GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSF 154

Query: 89  PKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ--- 145
           P  A+ F + +   +     +G  +    ++  +G S  +  ++V VP E++K RLQ   
Sbjct: 155 PSAAIFFGTYELTKRKLIDDWGVNETLSHLT--AGLSGDLVSSVVYVPSEVLKTRLQLQG 212

Query: 146 -------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRE- 197
                       ++   + +  I++ +G + L+ G ++T+ R+  ++A  F    + R+ 
Sbjct: 213 CYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQW 272

Query: 198 ---LLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD-----GNEIINGVR 249
              L     S+     N+L  G   G    +  TP DV+K+RIQ+       ++    VR
Sbjct: 273 AFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVR 332

Query: 250 KYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFREF 302
             N     +  +Y  EG    + G  P+ +      +++L+++   +     F
Sbjct: 333 IENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLYQVTLKSLDRF 385

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 29  MVMYPLDVVKTRMQLQVSTGAAGASATHYK---GVIDCLSQIVKKEGPMHMYKGI 80
           ++  P+DV+KTR+Q Q+ +  A  S    +    +I  L+ + + EG +  + G+
Sbjct: 303 IITTPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGV 357

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 132/293 (45%), Gaps = 34/293 (11%)

Query: 30  VMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH-MYKGISSPMLMEA 88
           VM+ LD VKTR Q     GA G     Y+ +I     +  +EG    +Y G  + ML   
Sbjct: 70  VMHSLDTVKTRQQ-----GAPG--EVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSF 122

Query: 89  PKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAG-ITEALVIVPFELVKIRLQ-- 145
           P  AV F +  E++K  + +    Q+ +  S L+    G +  ++V VP E++K RLQ  
Sbjct: 123 PSAAVFFGTY-EWVK--RQMINEWQIHETYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQ 179

Query: 146 --------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRE 197
                        ++G  + ++ I++ +G+  L+ G ++T+ R+  ++A  F    + R+
Sbjct: 180 GCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRK 239

Query: 198 LLPVAKSKQEKTRNDLCAGFV-----GGTFGVMFNTPFDVVKSRIQ-----SDGNEIING 247
              + + K         A  V     GG  G++  TP DVVK+RIQ     S G    + 
Sbjct: 240 WAFLLERKPVDGHLSFTAEVVTGASAGGLAGII-TTPLDVVKTRIQTQPRGSAGTPDASA 298

Query: 248 VRKYNWT-WPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
             + N + + S++ +   EG    + G  P+ +      +++L+++   +   
Sbjct: 299 PARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTALRTL 351

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 85/177 (48%), Gaps = 19/177 (10%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQ-VSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
              AG +  +   +V  P +V+KTR+QLQ         S  +Y+G+ D +  IV+ EG  
Sbjct: 151 HLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVS 210

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQIS----VLSGASAGITE 130
            ++ G  + +  + P  A++FA  + F K W  +   K +   +S    V++GASAG   
Sbjct: 211 ALFFGYKATLSRDLPFSALQFAFYERFRK-WAFLLERKPVDGHLSFTAEVVTGASAGGLA 269

Query: 131 ALVIVPFELVKIRLQ------------DVNSKFKGPV-EVLKHIIKQDGLKGLYSGV 174
            ++  P ++VK R+Q               ++  G +   L  +++ +GL G +SGV
Sbjct: 270 GIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGV 326

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQ----VSTGAAGASATHYKGVIDCLSQ 66
           L F  + + GA AG    ++  PLDVVKTR+Q Q      T  A A A     +   L  
Sbjct: 253 LSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLV 312

Query: 67  IVKKEGPMHMYKGI 80
           +++ EG    + G+
Sbjct: 313 VLRYEGLGGAFSGV 326

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 131/304 (43%), Gaps = 52/304 (17%)

Query: 13  FRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           F    ++GA AG S  +  +P+D +KTR+Q +    A G     YKGV            
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANGG----YKGV------------ 49

Query: 73  PMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-------GTKQLTQQISVLSGAS 125
               Y+G+ S ++  AP  ++ F + D  +K W           G  Q    +S +  +S
Sbjct: 50  ----YRGLGSAVVASAPSASLFFVAYDS-MKCWSRPVIGQLLPKGEDQTADTLSHMVSSS 104

Query: 126 AG-ITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKG----LYSGVESTVWR 180
            G I+  +V VP E++K R Q    +    ++ L+ +++ +  +G    LY G  +T+ R
Sbjct: 105 FGEISACMVRVPAEVIKQRTQ--THRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMR 162

Query: 181 NAVWNAGYFGVIFQVRELLPVAKSK-QEKTRNDLCAGFV----GGTFGVMFNTPFDVVKS 235
              +      + F + E +    ++ Q K R     G V     G       TP DV+K+
Sbjct: 163 EIPFTC----IQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKT 218

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNV 295
           RI    ++ ++ +            +  EEG +  + G  P+ + +  GGA+ L V+  V
Sbjct: 219 RIMLH-HKSVSALHLAK-------TMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETV 270

Query: 296 MNVF 299
            ++F
Sbjct: 271 HSLF 274

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 121/299 (40%), Gaps = 42/299 (14%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV-I 61
           SN   Q+ L    + +  A AGI E+ V +P+D +  R+            + H K    
Sbjct: 2   SNDQKQSGLA---RVVGSASAGILEIGVFHPVDTISKRLM-----------SNHTKITNA 47

Query: 62  DCLSQIVKKEGP--------MHMYKGISSPMLMEAPKRAVKFAS--------NDEFIKLW 105
             L+ +V +E            ++ G+      +  +R  K+          N  F   +
Sbjct: 48  QQLNDVVFREHASKPFGQRLFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADF 107

Query: 106 KSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQD 165
              FG K      S  +G+  GI E +V++P +++KI+ Q     F+G       I++ +
Sbjct: 108 DGAFGEKTGKALRSATAGSLIGIGE-IVLLPLDVLKIKRQTNPESFRG--RGFLRILRDE 164

Query: 166 GLKGLYSGVESTVWRNAVWNAGYF-GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGV 224
           G+ GLY G   T  RNA  +   F G  F    +L +    Q     +  +   G +  +
Sbjct: 165 GM-GLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASL 223

Query: 225 MFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           + + P DV+K+RIQS   E           +  V      EG  A +KG  PK+L  GP
Sbjct: 224 IVSAPLDVIKTRIQSRNFESAES------GFTIVKNTLKNEGATAFFKGLTPKLLTTGP 276

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 8/93 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            F++      + L+V  PLDV+KTR+Q +    A              +   +K EG   
Sbjct: 211 NFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESG--------FTIVKNTLKNEGATA 262

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV 108
            +KG++  +L   PK    FA     I ++ ++
Sbjct: 263 FFKGLTPKLLTTGPKLVFSFAIAQTLIPMFDNM 295

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 139/326 (42%), Gaps = 42/326 (12%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGA--------------------SAT 55
            F+AG I G++  +V  P D+VKTR+Q  +      +                    +AT
Sbjct: 59  HFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAAT 118

Query: 56  HYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLT 115
           H+K  +  +  + ++EG   ++KG+   ++   P R++ F +      ++   F   Q  
Sbjct: 119 HFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEA 178

Query: 116 QQISVLSGASAGITEALVIVPFELVKIRLQ-DVNSK---FKGPVEVLKHIIKQDGLKGLY 171
             I +++ A+AG   A    P  +VK R+Q D   K   +K   + LK I++ +G+ GLY
Sbjct: 179 PWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLY 238

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPV-------AKSKQEKTRNDLCAGFVGGTFGV 224
            G+ S  +  +V     + +  Q++ L+         A  +   T  D    +   + G 
Sbjct: 239 RGL-SASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGA 297

Query: 225 --------MFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVP 276
                   +   P +VV++R++    E  NG  KY     S   I  EEG  ++Y G  P
Sbjct: 298 GLAKFMASIVTYPHEVVRTRLRQSPLE--NGKVKYTGLVQSFRVIIKEEGLASMYSGLTP 355

Query: 277 KVLRLGPGGAVLLVVFTNVMNVFREF 302
            ++R  P   ++   +  V+ +  + 
Sbjct: 356 HLMRTVPNSIIMFGTWEVVIKLLSDI 381

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 45/101 (44%), Gaps = 23/101 (22%)

Query: 229 PFDVVKSRIQSD----------------------GNEIINGVRKYNWTWPSVMKIYHEEG 266
           PFD+VK+R+QSD                       N  +     +  T   +  +Y +EG
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 267 FRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF-REFHEGR 306
           FR+L+KG  P ++ + P  ++    +    +++ + F+ G+
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQ 176

>Kwal_23.4731
          Length = 314

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/311 (22%), Positives = 131/311 (42%), Gaps = 39/311 (12%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P + + +AG  AG    +  +PLD+VK R+QL V+T       TH  G  + +  I++  
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNT-------THSHGYKEVIKTIIRDS 64

Query: 72  GP-----MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQL---TQ------- 116
                     Y+G+   ++  +    + F     F K     +G  Q+   TQ       
Sbjct: 65  KADSNVFREAYRGLGVNLIGNSIAWGLYFGLY-RFTKDMVYRYGVAQMKTPTQSSFQKDK 123

Query: 117 ----QISVLSGASAGITEALVIVPFELVKIRLQDVNS----KFKGPVEVLKHIIKQDGLK 168
                + + S A +G+  A++  P  ++K R+   +S    ++K   + ++ +   +G  
Sbjct: 124 AMGPSLYLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFS 183

Query: 169 GLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAK--SKQEKTRN--DLCAGFVGGTFGV 224
           G + G+  +++      A YF +   +R      +  ++ EK  N  ++    V     V
Sbjct: 184 GFWRGLVPSLF-GVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSV 242

Query: 225 MFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284
               PF ++KS +QS     +     Y + W  V  I+ +EG + LYKG    +LR  P 
Sbjct: 243 TAVYPFQLLKSNLQSFA--AVEKRDSYRF-WNLVKSIHQKEGLQGLYKGLSANLLRAIPS 299

Query: 285 GAVLLVVFTNV 295
             +   ++ N+
Sbjct: 300 TCITFCIYENL 310

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 93/204 (45%), Gaps = 25/204 (12%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDV--NSKFKGPVEVLKHIIKQDG-----LKG 169
           Q  +++G +AG    +   P +LVK+RLQ +   +   G  EV+K II+         + 
Sbjct: 14  QREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFRE 73

Query: 170 LYSGVESTVWRNAVWNAGYFGVIFQVRELL---PVAKSK---QEKTRND--------LCA 215
            Y G+   +  N++    YFG+    ++++    VA+ K   Q   + D        L +
Sbjct: 74  AYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLAS 133

Query: 216 GFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFV 275
             + G    +   P  V+K+RI S  ++      +Y  TW  + K+Y  EGF   ++G V
Sbjct: 134 AALSGLGTAILTNPIWVIKTRIMSTSSQ---ASERYKTTWDGIRKVYAHEGFSGFWRGLV 190

Query: 276 PKVLRLGPGGAVLLVVFTNVMNVF 299
           P +  +   GA+   ++ ++ + +
Sbjct: 191 PSLFGVAQ-GAIYFTIYDSLRHQY 213

>Scas_673.17
          Length = 314

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 99/230 (43%), Gaps = 17/230 (7%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AGAI   +    + P+DVVKTR+QL+ +         + KG++    +I+  EG   + 
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTV--------YNKGMVGSFKKIIADEGAGALL 76

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV---I 134
            G    +L  + + A KF   + F KL     G +      + +   SA + E L    +
Sbjct: 77  TGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIAL 136

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            P E  +IRL    +   G V     I+K++G+   YSG    +++   +N   F V  +
Sbjct: 137 CPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFER 196

Query: 195 VREL---LPVAK---SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
             E+   +  AK   S    T  +L +G   G      + P D + S++ 
Sbjct: 197 ASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVN 246

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 74/187 (39%), Gaps = 18/187 (9%)

Query: 121 LSGASAGITEALVIVPFELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTVW 179
           L+GA    T    +VP ++VK R+Q   + + KG V   K II  +G   L +G   T+ 
Sbjct: 25  LAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLL 84

Query: 180 RNAVWNAGYFG--VIFQVRELLPVAKSKQEKTRNDLCAG--FVGGTFGVMFNTPFDVVKS 235
             +V  A  FG   +F+   +  +        +N +  G   V      +   P +  + 
Sbjct: 85  GYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRI 144

Query: 236 RIQSD---GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           R+ S     N ++ G  +          I  EEG  + Y GF P + +  P      +VF
Sbjct: 145 RLVSQPTFANGLVGGFSR----------ILKEEGVGSFYSGFTPILFKQIPYNIAKFLVF 194

Query: 293 TNVMNVF 299
                V+
Sbjct: 195 ERASEVY 201

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 113/280 (40%), Gaps = 24/280 (8%)

Query: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92
           P++ VKTR+QLQ     AG S   Y G    +S I + EG   + +G++     +     
Sbjct: 31  PIETVKTRLQLQGEL-VAGVSRL-YSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNG 88

Query: 93  VKFASNDEFIKLW-------KSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ 145
            +    D             +  +GT  L    +  + A      A +  P +LVK R+Q
Sbjct: 89  SRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGM--IGAALGSPLQLVKTRMQ 146

Query: 146 DVNSKFKGPV-----EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLP 200
            +  +   P+       L  + K  G++GLY GV++ + R  V +A    V    +E L 
Sbjct: 147 ALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEAL- 205

Query: 201 VAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK 260
            ++   +       A  +      +   PFDV  +R+      +      Y      + K
Sbjct: 206 -SRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHRGGL------YRGPLDCLCK 258

Query: 261 IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
              +EGF ALYKG + ++LR+ P   + L +    + V R
Sbjct: 259 TVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 226 FNTPFDVVKSRIQSDGNEIINGV-RKYNWTWPSVMKIYHEEGFRALYKGF 274
           F  P + VK+R+Q  G E++ GV R Y+    +V  IY  EG R L +G 
Sbjct: 28  FTNPIETVKTRLQLQG-ELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGL 76

>Scas_716.29
          Length = 316

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 138/305 (45%), Gaps = 36/305 (11%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVS-TGAAGASATHYKGVIDCLSQIVKKEGPMH 75
            +AG+++G+    V+ PLD +K R+QL+ S TG A +      G++  +  ++  EG + 
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPS------GLLKMMKGMILNEGGLR 79

Query: 76  -MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG-TKQLTQQI-SVLSGASAGITEAL 132
             +KG     +M       +F+S       + ++FG T  +  Q+ S++ GA AG+T + 
Sbjct: 80  SFWKGNVPGTMMYVLYGGAQFSS----YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSF 135

Query: 133 VIVPFELVKIRL---QDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
           V  P ++++ R    QDV           K I   +G+ G + G  ++++   +  +  F
Sbjct: 136 VSYPTDVLRTRFIANQDV--ALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILF 193

Query: 190 GVIFQVRELLPVAKSKQEKTRNDL--CAGFVGGTFGVMFNTPFDVVKSRIQSDG------ 241
           G  ++  ++     SK+    N L   A  + G    M   P D ++ RIQ         
Sbjct: 194 GT-YESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQH 252

Query: 242 ---NEIINGVRKYNWTWPSVMK----IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTN 294
              N+I+  + + ++   S ++    I  +EG  +LY+G    + +  P   V L  +  
Sbjct: 253 NVENKIVTEIYQ-SYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYET 311

Query: 295 VMNVF 299
           VM ++
Sbjct: 312 VMRLY 316

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQ--------VSTGAAGASATHYKGV--IDCLS 65
           ++ A +I+G++  MV YPLD ++ R+Q++        V           YKG   I    
Sbjct: 217 RYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGL 276

Query: 66  QIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLW 105
            I+++EG + +Y+G+S  +    P   V   + +  ++L+
Sbjct: 277 NILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/183 (18%), Positives = 75/183 (40%), Gaps = 14/183 (7%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKG--PVEVLK----HIIKQDGLKGLYS 172
           S+++G+ +G+    VI P + +KIRLQ +   + G  P  +LK     I+ + GL+  + 
Sbjct: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQ-LRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83

Query: 173 GVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDV 232
           G         ++    F   +     L    S        L  G + G      + P DV
Sbjct: 84  GNVPGTMMYVLYGGAQFSS-YSFYNNLFGETSDMNGQLQSLVVGALAGMTSSFVSYPTDV 142

Query: 233 VKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           +++R  ++ +  ++ +           +I++ EG    ++G    +  +    ++L   +
Sbjct: 143 LRTRFIANQDVALSSLSH------GCKEIWNMEGIPGFFRGCTASMFTITLSASILFGTY 196

Query: 293 TNV 295
            ++
Sbjct: 197 ESI 199

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 12/104 (11%)

Query: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ---SDGNEIINGVRKYNWTWPSVM 259
           K +  K    L AG V G        P D +K R+Q   S   +  +G+ K       +M
Sbjct: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLK-------MM 68

Query: 260 K--IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
           K  I +E G R+ +KG VP  +     G      ++   N+F E
Sbjct: 69  KGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE 112

>Scas_669.6
          Length = 373

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 107/233 (45%), Gaps = 31/233 (13%)

Query: 31  MYPLDVVKTRMQLQVSTGAAGASAT-HYKGVIDCLSQIVKKEGPMH-MYKGISSPMLMEA 88
           M+ LD VKTR Q        GA  T  YK +      I  +EG    +Y G  + ML   
Sbjct: 69  MHSLDTVKTRQQ--------GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSF 120

Query: 89  PKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAG-ITEALVIVPFELVKIRLQ-- 145
           P  A+ F +  E+ K  + + G       +S LS    G    + V VP E++K RLQ  
Sbjct: 121 PSAAIFFGTY-EWCK--RKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQ 177

Query: 146 -DVNSKF-------KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRE 197
             VN+ F       +     ++ I+  +G+K L+ G ++T+ R+  ++A  FG   + R+
Sbjct: 178 GRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQ 237

Query: 198 LLPVAKSKQEKTR------NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEI 244
                  K++ T+      N++  G + G    +  TP DV+K+R+Q+   +I
Sbjct: 238 T-AFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADI 289

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQ 44
           + HN   P     +   GAIAG    ++  P+DV+KTR+Q Q
Sbjct: 248 TKHNLSIP----NEIFTGAIAGGLAGIITTPMDVIKTRLQTQ 285

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 82/180 (45%), Gaps = 12/180 (6%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AGAI   +    M P+DVVKTR+QL+           +  G++    +IV +EG   + 
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLE--------PLKYSSGMVGSFRKIVGEEGAAALL 71

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITE---ALVI 134
            G    +L  + + A KF   + F K +    G +   Q  + +   SA I E    + +
Sbjct: 72  TGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIAL 131

Query: 135 VPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            P E  +IRL    +   G V     I+K++G+   Y+G    +++   +N   F V+F+
Sbjct: 132 CPLEATRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKF-VVFE 190

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 20/189 (10%)

Query: 120 VLSGA-SAGITEALVIVPFELVKIRLQDVNSKFK-GPVEVLKHIIKQDGLKGLYSGVEST 177
            L+GA   G T +  +VP ++VK R+Q    K+  G V   + I+ ++G   L +G   T
Sbjct: 19  ALAGAIGCGATHS-AMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPT 77

Query: 178 VWRNAVWNAGYFG--VIFQ--VRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVV 233
           +   ++  A  FG   +F+    + L    + Q +T   + +  +   F  +   P +  
Sbjct: 78  LLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEAT 137

Query: 234 KSRIQSD---GNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290
           + R+ S     N ++ G  +          I  EEG  + Y GF P + +  P      V
Sbjct: 138 RIRLVSQPTFANGLVGGFAR----------ILKEEGIGSFYNGFTPILFKQIPYNIAKFV 187

Query: 291 VFTNVMNVF 299
           VF +  N +
Sbjct: 188 VFEHAANAY 196

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/332 (21%), Positives = 134/332 (40%), Gaps = 64/332 (19%)

Query: 19  AGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           AG+++G+    + YP + +KT +QL  +  AA           + L   V+       + 
Sbjct: 15  AGSVSGLFSATITYPFEFLKTGLQLHRNVVAAKP--------FEVLGYQVRT-----YFA 61

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKLWK--SVFGTKQLTQQISVLSGASAGITEALVIVP 136
           G S+  +    K +++F + D+  +  +  ++     L+    +++GA  G  E+L I+P
Sbjct: 62  GCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIP 121

Query: 137 FELVKI-----------RLQDVNSKFKG----------------------------PVEV 157
           FE VK+           RL    S  +G                            P  V
Sbjct: 122 FENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNV 181

Query: 158 LK---HIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLC 214
           L     + +Q GL+  + G   T+ R    +   F     +++  P  K  Q        
Sbjct: 182 LTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAP--KEYQNNEYFATL 239

Query: 215 AGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGF 274
            G +     V    P DV+K+R+Q+  + ++     Y  +     +I+ EEGF  L+KG+
Sbjct: 240 LGLISSCAVVGATQPLDVIKTRMQAKDSVLL-----YRNSINCAYRIFVEEGFAMLWKGW 294

Query: 275 VPKVLRLGPGGAVLLVVFTNVMNVFREFHEGR 306
           +P+++++G  G+V   ++    N+     + R
Sbjct: 295 LPRLMKVGLSGSVSFGIYQYTENMIALMRQER 326

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           + G I+  + +    PLDV+KTRMQ       A  S   Y+  I+C  +I  +EG   ++
Sbjct: 239 LLGLISSCAVVGATQPLDVIKTRMQ-------AKDSVLLYRNSINCAYRIFVEEGFAMLW 291

Query: 78  KG 79
           KG
Sbjct: 292 KG 293

>Scas_687.15*
          Length = 328

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 128/330 (38%), Gaps = 70/330 (21%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVST-GAAGASATHYKGVIDCLSQIVKKEGPM 74
           Q +AG+ A + E  + YP + +KT  QL   T GA    A                  P+
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQLHRRTVGAKPFEALR----------------PI 54

Query: 75  HMY-KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ--LTQQISVLSGASAGITEA 131
            +Y  G ++  L    K +V+FA+ D+  ++ +     K   L     +L+G   G  E+
Sbjct: 55  KVYFAGCTALNLSAIVKTSVRFATFDKACQILRDPNLPKDSLLKGPRLLLAGILTGAVES 114

Query: 132 LVIVPFELVKIRL-----------------------------------------QDVNSK 150
           L I+PFE VK+ +                                         + V SK
Sbjct: 115 LCIIPFENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSK 174

Query: 151 FKGP--VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEK 208
           +       V+K I    GL+G   G   TV+R    +   F     +++L+   +   E 
Sbjct: 175 YPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQPLNEV 234

Query: 209 TRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFR 268
               +  G       V    P DVVK+R+QS           Y  +     +++ EEG  
Sbjct: 235 YAFGI--GLFSSCAVVALTQPIDVVKTRMQSKTAHYF-----YKNSLNCAYRVFVEEGMV 287

Query: 269 ALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           +L+KG++P++ ++G  G +   V+  V N+
Sbjct: 288 SLWKGWLPRLFKVGLSGGISFGVYQYVENL 317

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL   Y F  G  +  + + +  P+DVVKTRMQ       +  +   YK  ++C  ++  
Sbjct: 230 PLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQ-------SKTAHYFYKNSLNCAYRVFV 282

Query: 70  KEGPMHMYKG 79
           +EG + ++KG
Sbjct: 283 EEGMVSLWKG 292

>Kwal_23.3042
          Length = 542

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/310 (20%), Positives = 133/310 (42%), Gaps = 33/310 (10%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAA-------------GASATHYKG-VID 62
           F+AG ++G+       P D +K  +  +    +               A  +  K  ++ 
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG---TKQLTQQIS 119
             + + ++ G    Y G     +   P+ A+KF S +   +L   + G   T  L++  +
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 120 VLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLYSGV 174
            L+G   G+   L + P + +K R+Q   +N++ KG    +   K + K+ GL+  Y G+
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGI 407

Query: 175 E---STVWRNAVWNAGYFGVI---FQVRELLPVAKSKQEKTRND---LCAGFVGGTFGVM 225
                 ++  A  + G F  +   +  R+       + + T ++   L  G   GT G  
Sbjct: 408 TVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAFSGTVGAT 467

Query: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285
              P +++++R+Q+ G        +YN     ++K    EG++ L+KG VP + ++ P  
Sbjct: 468 AVYPVNLLRTRLQAQGT--FAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAV 525

Query: 286 AVLLVVFTNV 295
           ++  + + N+
Sbjct: 526 SISYLCYENL 535

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           +  + GA +G      +YP+++++TR+Q Q       A    Y G  D L + V++EG  
Sbjct: 453 FVLLMGAFSGTVGATAVYPVNLLRTRLQAQ----GTFAHPHRYNGFRDVLLKTVQREGYQ 508

Query: 75  HMYKGISSPMLMEAPKRAVKF 95
            ++KG+   +    P  ++ +
Sbjct: 509 GLFKGLVPNLAKVCPAVSISY 529

>Scas_702.10
          Length = 302

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 77/165 (46%), Gaps = 14/165 (8%)

Query: 123 GASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNA 182
           G +AGI   ++  P +L K+RLQ           +L  I++ + + GLYSG+ + V R  
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQC 75

Query: 183 VWNAGYFGVIFQVRE-LLPVAKSKQEKTRNDL-----CAGFVGGTFGVMFNTPFDVVKSR 236
            +    FG    ++E L+P      +   ND+     C+ F G   G++ N   DVV  R
Sbjct: 76  TYTTVRFGAYDLMKENLIP------QGHINDMVYLLPCSMFSGAIGGLVGNFA-DVVNIR 128

Query: 237 IQSDGNEIINGVRKYNWTWPSVMKIY-HEEGFRALYKGFVPKVLR 280
           +Q+D        R Y      V KIY HE G + L  G+ P ++R
Sbjct: 129 MQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVR 173

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 127/286 (44%), Gaps = 40/286 (13%)

Query: 14  RYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGP 73
           +Y +  G  AGI   ++ +PLD+ K R+Q         A+      +   L+ I++ E  
Sbjct: 10  KYPWWYGGAAGIFACVMTHPLDLAKVRLQ---------AAPLPKPTLGRMLTTILRNENV 60

Query: 74  MHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI-----SVLSGASAGI 128
           M +Y G+S+ +L +     V+F + D    + +++     +   +     S+ SGA  G+
Sbjct: 61  MGLYSGLSAAVLRQCTYTTVRFGAYDL---MKENLIPQGHINDMVYLLPCSMFSGAIGGL 117

Query: 129 TEALVIVPFELVKIRLQ-------DVNSKFKGPVE-VLKHIIKQDGLKGLYSGVESTVWR 180
                    ++V IR+Q       ++   ++  ++ V K  + + G+K L +G +  + R
Sbjct: 118 VGNFA----DVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVR 173

Query: 181 NAVWNAGYFGVIFQVRELLPVAKSKQEKTRND--LCAGFVGGTFGVMFNTPFDVVKSRI- 237
             +  A    V + V +   V K   +  +N   L A  + G       +P DV+K+RI 
Sbjct: 174 GVLMTASQV-VTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKTRIM 232

Query: 238 QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
            +   E  + ++       S +K   +EG   +++G++P   RLGP
Sbjct: 233 NAHKTESESAIKILT----SAIK---KEGPSFMFRGWLPIFTRLGP 271

>Kwal_23.5757
          Length = 307

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 113/263 (42%), Gaps = 30/263 (11%)

Query: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92
           PLD+VK R Q+          A+ YK  +D   QIV+ EG   ++ G+ +  +  + + A
Sbjct: 39  PLDLVKCRRQVD---------ASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89

Query: 93  VKFASNDEFIKLWKSVFGTKQLTQQ----ISVLSGASAGITEALVIVPFELVKIRLQD-V 147
            K+    EF K   S   + +        I + + ASA     + + P+E +K+R Q  V
Sbjct: 90  FKYGGY-EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAV 148

Query: 148 NSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVREL----LPVA 202
              F   V +    ++  +G   LY G+    +R   +    F    ++ E+    LP  
Sbjct: 149 PPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTP 208

Query: 203 K---SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVM 259
           K   S+  +       G++ G    + + P DV+ S++    NE  +G      T  +  
Sbjct: 209 KREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVN---NERKSG----ESTLQATS 261

Query: 260 KIYHEEGFRALYKGFVPKVLRLG 282
           +IY + GF  L+ G   ++L +G
Sbjct: 262 RIYGKIGFPGLWNGLAVRILMIG 284

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 71/152 (46%), Gaps = 13/152 (8%)

Query: 29  MVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEA 88
           + + P + +K R Q  V    A       + V D  S++V  EG   +YKGI+     + 
Sbjct: 132 IFLCPWEAIKVRQQTAVPPPFA-------RNVFDAYSKMVGAEGFASLYKGITPLWFRQI 184

Query: 89  PKRAVKFASNDEFIKLWKSVFGT--KQLTQ--QISV--LSGASAGITEALVIVPFELVKI 142
           P    KF S +  +++  +   T  ++++Q  QISV    G  AGI  A+V  P +++  
Sbjct: 185 PYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVS 244

Query: 143 RLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174
           ++ +     +  ++    I  + G  GL++G+
Sbjct: 245 KVNNERKSGESTLQATSRIYGKIGFPGLWNGL 276

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 65/157 (41%), Gaps = 13/157 (8%)

Query: 133 VIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV----WRNAVWNAGY 188
            + P +LVK R Q   S +K  ++  + I++ +G   +++GV +T      + A    GY
Sbjct: 36  AVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGY 95

Query: 189 FGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEII--N 246
                Q  +L+    +   +T   L A         +F  P++ +K R Q+        N
Sbjct: 96  EFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFARN 155

Query: 247 GVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
               Y+       K+   EGF +LYKG  P   R  P
Sbjct: 156 VFDAYS-------KMVGAEGFASLYKGITPLWFRQIP 185

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 130/294 (44%), Gaps = 46/294 (15%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASAT-------HYKGVIDCLSQIVKK 70
           + GA+A     + +YPLD+ KT +Q QVS  ++  S          YK V+DC+  I K+
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKE 67

Query: 71  EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIK---LWKSVFGTKQL----------TQQ 117
           +G + +Y+G++   +    +  V F     FI+   +   + G + L          T +
Sbjct: 68  KGILGLYQGMTVTTVATFVQNFVYFFWYT-FIRKSYMKHKLLGLQSLKNRDGPITPSTIE 126

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGP-VEVLKHIIKQDG------LKGL 170
             VL  A+A I++ L   P  +V  R Q V+S        V+K I +++        KGL
Sbjct: 127 ELVLGVAAASISQ-LFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKGL 185

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-- 228
            +G+  T+  +  + +      FQ  + +       +         F+ G    M +T  
Sbjct: 186 RTGLALTINPSITYAS------FQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLV 239

Query: 229 --PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
             P  V K+ +QS G+       K+     +++ +Y  EG ++L+KG +P++ +
Sbjct: 240 TQPLIVAKAMLQSAGS-------KFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 85/206 (41%), Gaps = 30/206 (14%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVN-------SKFKGPVEVLKHIIKQDGLKGLY 171
           S L+G  AG     +I P + +KI  Q  N         F+G +    HI  +D L+G++
Sbjct: 56  SGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G  +T+ R   + A  F    Q+R ++  +K  +   R  LC+G + G   V    P D
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRR-LCSGSLAGLCSVFCTYPLD 174

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRAL----------------YKGFV 275
           +++ R+        + VR     WP V +IY E    AL                Y+G++
Sbjct: 175 LIRVRLAYVTEH--HKVR----VWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYI 228

Query: 276 PKVLRLGPGGAVLLVVFTNVMNVFRE 301
           P V+ + P   V         ++ R 
Sbjct: 229 PTVIGMIPYAGVSFFAHDLFHDILRH 254

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 126/324 (38%), Gaps = 58/324 (17%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AG +AG     ++ PLD +K  +  Q S       A  ++G+++    I  ++    ++
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIK--ILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVF 115

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVL-SGASAGITEALVIVP 136
           +G S+ +L   P  AVKF + ++   +   +  +K+       L SG+ AG+       P
Sbjct: 116 QGHSATLLRIFPYAAVKFIAYEQIRNV---IIPSKEYETHFRRLCSGSLAGLCSVFCTYP 172

Query: 137 FELVKIRLQDVNSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV 195
            +L+++RL  V    K  V  ++K I  +   + L S      W  A W   Y G I  V
Sbjct: 173 LDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKW-FAQWCNFYRGYIPTV 231

Query: 196 RELLPVA-----------------------------------KSKQEKTRN--------- 211
             ++P A                                   K   + TR          
Sbjct: 232 IGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNTW 291

Query: 212 -DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK--IYHEEGFR 268
            +L AG + G        PF++++ R+Q      +    ++ +T  S M   I+HE G+R
Sbjct: 292 AELLAGGLAGMASQTAAYPFEIIRRRLQVGA---VTNPLEHKFTSMSEMAKIIFHERGWR 348

Query: 269 ALYKGFVPKVLRLGPGGAVLLVVF 292
             + G     +++ P  A    V+
Sbjct: 349 GFFVGLSIGYIKVTPMVACSFFVY 372

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 22/38 (57%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVST 47
           PL    + +AG +AG++     YP ++++ R+Q+   T
Sbjct: 287 PLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVT 324

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/285 (19%), Positives = 113/285 (39%), Gaps = 34/285 (11%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             + G   G+S  + + PLD++KTR Q        G +       +D   Q+ +   P  
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRFQ-----QTKGGTLWQTVKSLDTPWQLWRGTLPSA 61

Query: 76  MYKGISSPMLME-------APKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGI 128
           +   + S + +        A  +  +F + D  +    S     QL+   ++++GA A  
Sbjct: 62  IRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNL--PQLSMYENLVTGAFARG 119

Query: 129 TEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY 188
           T   + +P  ++K+R +     +K   E  K I  Q+G++G + G   T  R+A ++  Y
Sbjct: 120 TVGYITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLY 179

Query: 189 FGVIFQVRELLPVAKSKQ-------------EKTRNDLCAGFVGGTFGVMFNTPFDVVKS 235
             +  +++  LP    K                T  +  +  +  +       PFD +K+
Sbjct: 180 VLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKT 239

Query: 236 RIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
           R+Q +         K+   W ++  I  +E    ++ G   ++ R
Sbjct: 240 RMQLEPT-------KFKTFWSTLTTIVTQEHPIKIFSGLSMRLTR 277

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 18/89 (20%)

Query: 213 LCAGFVGGTFGVMFNTPFDVVKSRI-QSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
           L  GF GG    +   P D++K+R  Q+ G  +   V+  +  W              L+
Sbjct: 8   LIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTVKSLDTPW-------------QLW 54

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
           +G +P  +R   G A+ L    + +N+ R
Sbjct: 55  RGTLPSAIRTSVGSALYL----SSLNLMR 79

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 136/310 (43%), Gaps = 33/310 (10%)

Query: 17  FMAGAIAGISELMVMYPLD------VVKTRMQLQVSTGAAGASATHYKGVIDCLSQ---- 66
           F+AG I+G+       P D      + +T +   +        A +    I+ +S     
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 67  ----IVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG---TKQLTQQIS 119
               + ++ G    Y G    ++   P+ ++KF S +   K+   + G   TK L++  +
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 120 VLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLYSGV 174
            ++G  AG+     + P + +K R+Q   +++K KG     +  K + ++ GL+  Y GV
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGV 410

Query: 175 ESTV---WRNAVWNAGYFGVI---FQVRELLPVAKSKQEKTRNDLCA---GFVGGTFGVM 225
              +   +  A  + G F  +   +  ++   +   + + T ++L     G   GT G  
Sbjct: 411 TVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAFSGTVGAS 470

Query: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285
              P +++++R+Q+ G      V  YN     ++K    EG++ L+KG VP + ++ P  
Sbjct: 471 VVYPINLLRTRLQAQGTYAHPYV--YNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAV 528

Query: 286 AVLLVVFTNV 295
           ++  + + N+
Sbjct: 529 SISYLCYENL 538

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 122/313 (38%), Gaps = 48/313 (15%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AG IAG     ++ PLD +K  +  Q S       A    G++     I+  +GP   +
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIK--ILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 78  KGISSPMLMEAPKRAVKFASNDEF----IKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
           +G S+ +L   P  A+KF + ++     I  W+     ++L      LSG+ AG+    V
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL------LSGSLAGLCSVFV 135

Query: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHII----KQDGLKGLYSGVESTVWRN-------- 181
             P +LV++RL  V  +    V  +   I      + L+  Y       W N        
Sbjct: 136 TYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGYTPT 195

Query: 182 AVWNAGYFGVIFQVRELL----------------PVAKSKQE-----KTRNDLCAGFVGG 220
            +    Y GV F   +L                 P   S  +     KT   L AG + G
Sbjct: 196 VIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVAGGLAG 255

Query: 221 TFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVL 279
                   PF++++ R+Q   + I +  R++      + K IY E G+R  + G     +
Sbjct: 256 MASQTAAYPFEIIRRRLQV--SAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSIGYI 313

Query: 280 RLGPGGAVLLVVF 292
           ++ P  A    ++
Sbjct: 314 KVTPMVACSFFIY 326

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 81/205 (39%), Gaps = 29/205 (14%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFK-------GPVEVLKHIIKQDGLKGLY 171
           S L+G  AG     ++ P + +KI  Q  N +F        G V   K+I+  DG +G +
Sbjct: 22  SGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFF 81

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G  +T+ R   + A  F    Q+R ++ +   + E     L +G + G   V    P D
Sbjct: 82  QGHSATLLRIFPYAAIKFIAYEQIRSVV-IPTWRHESHWRRLLSGSLAGLCSVFVTYPLD 140

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRAL---------------YKGFVP 276
           +V+ R+          VRK       +  IY+E    AL               Y+G+ P
Sbjct: 141 LVRVRLAYVTERHDAKVRKI------MACIYNERPSEALRKWYIPQWFAHWSNFYRGYTP 194

Query: 277 KVLRLGPGGAVLLVVFTNVMNVFRE 301
            V+ + P   V         ++FR 
Sbjct: 195 TVIGMIPYAGVSFFAHDLCQDIFRH 219

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 80/194 (41%), Gaps = 39/194 (20%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCL-----SQIVKK 70
           + ++G++AG+  + V YPLD+V+ R+        A       + ++ C+     S+ ++K
Sbjct: 121 RLLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKV-----RKIMACIYNERPSEALRK 175

Query: 71  -------EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWK-------SVFG------ 110
                      + Y+G +  ++   P   V F ++D    +++       SV        
Sbjct: 176 WYIPQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSA 235

Query: 111 ---TKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ------DVNSKFKGPVEVLKHI 161
              T  L     +++G  AG+       PFE+++ RLQ           F G  E+ K I
Sbjct: 236 YDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKII 295

Query: 162 IKQDGLKGLYSGVE 175
             + G +G + G+ 
Sbjct: 296 YTEGGWRGFFVGLS 309

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 2   SSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVI 61
           SS ++   PL    Q +AG +AG++     YP ++++ R+Q+   T     +  H+ G+ 
Sbjct: 233 SSAYDRTVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAIT---DPTRRHFVGIN 289

Query: 62  DCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKF 95
           +    I  + G    + G+S   +   P  A  F
Sbjct: 290 EIAKIIYTEGGWRGFFVGLSIGYIKVTPMVACSF 323

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 13/176 (7%)

Query: 18  MAGAI-AGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           +AGAI  GI+    M P+DVVKTR+QL+ +         + KG++    QI+  EG   +
Sbjct: 18  LAGAIGCGITH-SSMVPIDVVKTRIQLEPTV--------YNKGMVSSFKQIISSEGAGAL 68

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITE---ALV 133
             G    +L  + + + KF   + F KL     G        + +   SA I E    + 
Sbjct: 69  LTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIA 128

Query: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189
           + P E  +IRL    +   G       I+K++G+   Y+G    +++   +N   F
Sbjct: 129 LCPLEATRIRLVSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKF 184

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 6/181 (3%)

Query: 121 LSGA-SAGITEALVIVPFELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYSGVESTV 178
           L+GA   GIT +  +VP ++VK R+Q   + + KG V   K II  +G   L +G   T+
Sbjct: 18  LAGAIGCGITHS-SMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTL 76

Query: 179 WRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ 238
              ++  +  FG  +++ + L +     +   N     ++G      F    D+    ++
Sbjct: 77  LGYSLQGSFKFGG-YELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFA--DIALCPLE 133

Query: 239 SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           +    +++     N  +    +I  EEG  + Y GF P + +  P       VF +  N 
Sbjct: 134 ATRIRLVSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANA 193

Query: 299 F 299
           +
Sbjct: 194 Y 194

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 125/301 (41%), Gaps = 33/301 (10%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +AG+++G+     + PLD VK ++Q+           T +    + L  I+K+EG   
Sbjct: 18  SLVAGSLSGLFARTCIAPLDTVKIKLQV-----------TPHNKNANVLINILKREGIRG 66

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135
            +KG     +M       +F S        +         Q  S L G+ AG+T +L   
Sbjct: 67  FWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASY 126

Query: 136 PFELVKIRLQDVNSK---FKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI 192
           PF++++ R    NS+    K   E++  I   +GL G +SG  S++    +  A  FGV 
Sbjct: 127 PFDVLRTRFA-ANSQGQLIKLRDEIMA-IWSHEGLMGFFSGCGSSMINIGLNTAIMFGV- 183

Query: 193 FQVRELLPVAKSKQEKTRNDLC-----AGFVGGTFGVMFNTPFDVVKSRIQ--------S 239
           ++  ++    +SK    R+        AG + G    +   P D V+ RIQ         
Sbjct: 184 YESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEER 243

Query: 240 DGNEIINGVRKY--NWTWPSV-MKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
              E    + K   N  +  V + +  +EG  +LY+G    +++  P  A+ L  +   M
Sbjct: 244 HDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISLWSYELFM 303

Query: 297 N 297
           N
Sbjct: 304 N 304

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 86/191 (45%), Gaps = 10/191 (5%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLY 171
           ++++   S+++G+ +G+     I P + VKI+LQ V    K    VL +I+K++G++G +
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ-VTPHNKN-ANVLINILKREGIRGFW 68

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLC-AGFVGGTFGVMFNTPF 230
            G         ++    FG    +   L          +   C  G + G    + + PF
Sbjct: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPF 128

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290
           DV+++R  ++    +  +R        +M I+  EG    + G    ++ +G   A++  
Sbjct: 129 DVLRTRFAANSQGQLIKLRD------EIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182

Query: 291 VFTNVMNVFRE 301
           V+ ++  +F E
Sbjct: 183 VYESI-KIFTE 192

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 59/141 (41%), Gaps = 11/141 (7%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  Y  + G++AG++  +  YP DV++TR         A  S      + D +  I   E
Sbjct: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRF--------AANSQGQLIKLRDEIMAIWSHE 157

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDE---FIKLWKSVFGTKQLTQQISVLSGASAGI 128
           G M  + G  S M+      A+ F   +    F +    +   +     ++ L+G  +G 
Sbjct: 158 GLMGFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGF 217

Query: 129 TEALVIVPFELVKIRLQDVNS 149
           T  L   P + V+ R+Q  NS
Sbjct: 218 TSKLATFPLDTVRRRIQIRNS 238

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY 262
           K ++  T N L AG + G F      P D VK ++Q         V  +N     ++ I 
Sbjct: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ---------VTPHNKNANVLINIL 59

Query: 263 HEEGFRALYKGFVP-KVLRLGPGGA 286
             EG R  +KG VP  ++ +  GGA
Sbjct: 60  KREGIRGFWKGNVPGSIMYIIYGGA 84

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 83/187 (44%), Gaps = 23/187 (12%)

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGPVEVLKHIIK-----QDGLKG 169
           Q  ++SG +AG    +V  P +L+K+RLQ   ++ K       ++ IIK     Q  LK 
Sbjct: 13  QKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKE 72

Query: 170 LYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSK---QEKTRND--------LCAGFV 218
            Y G+   +  NAV    YFG+    ++++    S+   Q K  ND        L +   
Sbjct: 73  AYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVSAGA 132

Query: 219 GGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
            G    +   P  V+K+RI S  +      + Y     ++ +IY EEG +  ++G VP +
Sbjct: 133 SGLATALLTNPMWVIKTRIMSTKSS-----QGYTSILNAITRIYTEEGLKTFWRGLVPSL 187

Query: 279 LRLGPGG 285
             +  G 
Sbjct: 188 FGVTQGA 194

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 125/299 (41%), Gaps = 27/299 (9%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLS--QIVK 69
           P + + ++G  AG    +V +PLD++K R+QL        +     + +I   S  Q + 
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLL 70

Query: 70  KEGPMHMYKGISSPMLMEAPKRAVKF----ASNDEFIKL------WKSVFGTKQLTQQIS 119
           KE     Y+G+   ++  A    + F     S D    L             +++T  + 
Sbjct: 71  KEA----YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMY 126

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSK--FKGPVEVLKHIIKQDGLKGLYSGVEST 177
           ++S  ++G+  AL+  P  ++K R+    S   +   +  +  I  ++GLK  + G+  +
Sbjct: 127 LVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPS 186

Query: 178 VWRNAVWNAGYFGVIFQVR-ELLPVAKSKQEKTRNDL-CAGFVGGTFGVMFNT--PFDVV 233
           ++      A YF +   ++ + L      QE+  N +   G +  +  +  ++  P  ++
Sbjct: 187 LF-GVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQLL 245

Query: 234 KSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           K+ +Q+   E  N   K N     +  I+H  G    YKG    ++R  P   +   V+
Sbjct: 246 KTNLQTFRTEH-NENSKMN---SLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 83/179 (46%), Gaps = 24/179 (13%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+AG +AG     V+ P + VK  +Q+Q ST A      +  G+I+ + Q+ K+EG   +
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSSTSA------YNHGIINAVGQVYKEEGVAGL 68

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGT---KQLTQQISVLSGASAGITEALV 133
           ++G     +   P  AV+F   +   K    V GT   +QL     + +GA  G    L 
Sbjct: 69  FRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLA 128

Query: 134 IVPFELVKIRL--QDVN------------SKFKGPVEVLKHIIKQD-GLKGLYSGVEST 177
             P +LV+ RL  Q  N            +K  G  E+L    K++ G++GLY G+  T
Sbjct: 129 TYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGIYPT 187

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 80/186 (43%), Gaps = 24/186 (12%)

Query: 112 KQLTQQ---ISVLSGASAGITEALVIVPFELVKIRLQ---DVNSKFKGPVEVLKHIIKQD 165
           KQL +Q   I+ ++G  AG     V+ PFE VKI LQ     ++   G +  +  + K++
Sbjct: 4   KQLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEE 63

Query: 166 GLKGLYSGVESTVWRNAVWNAGYFGV-------IFQVRELLPVAKSKQEKTRNDLCAGFV 218
           G+ GL+ G      R   ++A  F V       IF V         +Q      L AG +
Sbjct: 64  GVAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVD---GTVGKEQLLNWQRLSAGAL 120

Query: 219 GGTFGVMFNTPFDVVKSRIQSDGNEI-------INGVRKYNWTWPSVMKIYHEE-GFRAL 270
            G   V+   P D+V++R+      +          + K    W  ++K + EE G R L
Sbjct: 121 CGGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGL 180

Query: 271 YKGFVP 276
           Y+G  P
Sbjct: 181 YRGIYP 186

 Score = 30.8 bits (68), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 9/91 (9%)

Query: 204 SKQEKTRNDLCAGFVGGTFGVMFNTPFDVVK--SRIQSDGNEIINGVRKYNWTWPSVMKI 261
           +KQE +     AG V G       +PF+ VK   ++QS  +   +G+        +V ++
Sbjct: 7   AKQESS-IAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIIN------AVGQV 59

Query: 262 YHEEGFRALYKGFVPKVLRLGPGGAVLLVVF 292
           Y EEG   L++G     +R+ P  AV  VV+
Sbjct: 60  YKEEGVAGLFRGNGLNCVRIFPYSAVQFVVY 90

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 126/326 (38%), Gaps = 58/326 (17%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAA--------------GASATHYKGVIDC 63
           +AG+ A + +  + YP + +KT +QL  S   A              G +A +   +   
Sbjct: 99  VAGSCASVFQTTISYPFEFLKTGLQLHRSLPNAHPFNMMHQFKYYFSGCAALNVGTLFKT 158

Query: 64  LSQIVKKEGPMHMYKGISSP-MLMEAPKRAVKFASNDEFIKLWKSVFGTKQLT--QQISV 120
           +++    E    + K  SSP   +  P+  +  A       LW   F   + T  +   V
Sbjct: 159 VTRFTTFEKACQLLKDPSSPSAFISGPRLLMAGAITGFMESLWVVPFENIKTTMVENALV 218

Query: 121 LSG-----------ASAGITEALV---------IVPFELVKIRLQD-VNSKFKGPVEVLK 159
           LSG           A  G    +          I P E + +  ++   S+F      +K
Sbjct: 219 LSGRFQKEIEDKGKAETGSKREVRATFHKQTPGISPRERLFLHYEEHPTSRF---FSTVK 275

Query: 160 HIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVG 219
            I    GL+G   G   T++R    +A  F     +++L+   K   E        GF+ 
Sbjct: 276 EIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNEYY--AFVLGFIS 333

Query: 220 GTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNW-----TWPSVMKIYHEEGFRALYKGF 274
               V    P DV+K+R+QS          KY W     +     +I+ EEG    +KG+
Sbjct: 334 SCAVVAVTQPIDVIKTRMQS----------KYAWANYKNSLNCAYRIFVEEGIPKFWKGW 383

Query: 275 VPKVLRLGPGGAVLLVVFTNVMNVFR 300
            P+++++G  G V   V+  V N+ +
Sbjct: 384 APRLMKVGLSGGVSFGVYQYVENLIK 409

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL   Y F+ G I+  + + V  P+DV+KTRMQ       +  +  +YK  ++C  +I  
Sbjct: 320 PLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQ-------SKYAWANYKNSLNCAYRIFV 372

Query: 70  KEGPMHMYKGISSPMLME 87
           +EG    +KG  +P LM+
Sbjct: 373 EEGIPKFWKGW-APRLMK 389

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/315 (19%), Positives = 129/315 (40%), Gaps = 33/315 (10%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAA-------------GASATHYKG-VID 62
           F+AG  +G+       P D +K  +  +    +               A  +  K  +I 
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASND---EFIKLWKSVFGTKQLTQQIS 119
             + + ++ G    Y G    ++   P+ A+KF S +     +   ++V  T +L++  +
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLST 322

Query: 120 VLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLYSGV 174
            ++G   G+     + P + +K R+Q   +N+  K     ++  K + +Q G++  Y GV
Sbjct: 323 YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 175 ESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND---------LCAGFVGGTFGVM 225
              V     + A   G    +++     ++K+     D         L  G   GT G  
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGAT 442

Query: 226 FNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGG 285
              P +++++R+Q+ G         YN     + K    EG++ L+KG VP + ++ P  
Sbjct: 443 LVYPINLLRTRLQAQGT--YAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAV 500

Query: 286 AVLLVVFTNVMNVFR 300
           ++  + + N+  + +
Sbjct: 501 SISYLCYENLKRLMK 515

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 125 SAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVW 184
           S  +T  LV +  +L + +  D N++ K  +E +K I ++DGL G Y+G+ES ++  A+ 
Sbjct: 27  SMALTYPLVTITTKL-QTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALT 85

Query: 185 N-AGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNE 243
           N   Y+      R +L V K K+  T   +  G V G+   + + P  V  +R+    +E
Sbjct: 86  NFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE 145

Query: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPK-VLRLGPGGAVLLVVFTNVMNV 298
                        ++++I  ++  + L+ G  P  VL + P   V   VF  + N+
Sbjct: 146 --------KTALATIIEIVKKDSAKTLFNGLKPALVLVMNP--IVQYTVFEQLKNL 191

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/300 (21%), Positives = 129/300 (43%), Gaps = 31/300 (10%)

Query: 28  LMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLME 87
           + + YPL  + T++Q Q             K  ++ + +I +K+G +  Y G+ S +   
Sbjct: 28  MALTYPLVTITTKLQTQ-----GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGM 82

Query: 88  APKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDV 147
           A    V +   +   +    V   K+L    S+L+G  AG   A+   P  +   R+   
Sbjct: 83  ALTNFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVT 142

Query: 148 NSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQE 207
            S+ K  +  +  I+K+D  K L++G++  +    V N      +F+  + L +A +KQ 
Sbjct: 143 KSE-KTALATIIEIVKKDSAKTLFNGLKPALV--LVMNPIVQYTVFEQLKNLVLAWNKQG 199

Query: 208 KTRNDLCAGFVGGTFGVMFNT----PFDVVKSRIQ---------SDGNEIINGVRKYNWT 254
                    F+ G  G +  T    P+  +K+R+           D  +   G +  + +
Sbjct: 200 ILSPSW--AFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKS 257

Query: 255 WPSVM-KIYHEEGFRALYKGFVPKVLRLGPGGAVL------LVVFT-NVMNVFREFHEGR 306
             S++ +I  ++G   LY+G   K+ +     A L      LV+++  V+ +FR+ ++ R
Sbjct: 258 MLSLITEIVKKDGVSGLYRGVGIKLAQSILTAAFLFFFKEGLVLWSIKVLKLFRQINQRR 317

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 6   NTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVS---------TGAAGASATH 56
           N Q  L   + F+ GA+  ++     YP   +KTRM L  S           A G  A+ 
Sbjct: 196 NKQGILSPSWAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASS 255

Query: 57  YKGVIDCLSQIVKKEGPMHMYKGI 80
            K ++  +++IVKK+G   +Y+G+
Sbjct: 256 -KSMLSLITEIVKKDGVSGLYRGV 278

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 28/175 (16%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
            + G +AG    +   P+ V  TRM +  S   A A+          + +IVKK+    +
Sbjct: 115 MLTGCVAGSVTAIASNPIWVANTRMTVTKSEKTALAT----------IIEIVKKDSAKTL 164

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           + G+  P L+      V++   ++   L  +      L+   + L GA   +       P
Sbjct: 165 FNGLK-PALVLVMNPIVQYTVFEQLKNLVLAWNKQGILSPSWAFLLGALGKLAATGSTYP 223

Query: 137 FELVKIRLQ----------DVNSKFKGP-------VEVLKHIIKQDGLKGLYSGV 174
           +  +K R+           D   K KG        + ++  I+K+DG+ GLY GV
Sbjct: 224 YITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRGV 278

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 114/258 (44%), Gaps = 19/258 (7%)

Query: 60  VIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFG---TKQLTQ 116
           ++   + + ++ G    Y G    ++   P+ A+KF S +   ++   + G   T +L++
Sbjct: 236 LVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSR 295

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLY 171
             + ++G   GI     + P + +K R+Q   ++++ +G    ++  K + ++ GL+  Y
Sbjct: 296 LSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLRLFY 355

Query: 172 SGVEST---VWRNAVWNAGYFGVI---FQVRELLPVAKSKQEKTRNDLCA---GFVGGTF 222
            G+      V+  A  + G F  +   +  R    +  S+ E   ++L     G   GT 
Sbjct: 356 RGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTV 415

Query: 223 GVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLG 282
           G     P +++++R+Q+ G        +Y+       K    EG   LYKG VP + ++ 
Sbjct: 416 GATVVYPINLLRTRLQAQGT--YAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTLAKVC 473

Query: 283 PGGAVLLVVFTNVMNVFR 300
           P  A+  + + N+    R
Sbjct: 474 PAVAISYLCYENLKRAMR 491

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 127/319 (39%), Gaps = 41/319 (12%)

Query: 17  FMAGAIAGISELMVMYPLDVVK----TRMQL---------QVSTGAAGASATHYKG-VID 62
           F+AG  +G+       P D +K     R  L         +V      A  +  K  +I 
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 63  CLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASND---EFIKLWKSVFGTKQLTQQIS 119
             + + ++ G    Y G    ++   P+ A+KF S +   + +   + V  T +L++  +
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 120 VLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLYSGV 174
            ++G   G+     + P + +K R+Q   +++  KG    +   + + +  GLK  Y GV
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 175 ESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND---------LCAGFVGGTFGVM 225
              V     + A   G    +++     ++K      D         L  G   GT G  
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGAT 438

Query: 226 FNTPFDVVKSRIQSDGN----EIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRL 281
              P +++++R+Q+ G         G R   W      K    EG++ L+KG VP + ++
Sbjct: 439 VVYPINLLRTRLQAQGTYAHPHTYTGFRDVLW------KTVQREGYQGLFKGLVPNLAKV 492

Query: 282 GPGGAVLLVVFTNVMNVFR 300
            P  ++  + + N   + +
Sbjct: 493 CPAVSISYLCYENFKRLMK 511

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 121/283 (42%), Gaps = 27/283 (9%)

Query: 27  ELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLM 86
           E  V YP +  KTR+QL      A   +   +  +  L +  + +G   +Y G  + ++ 
Sbjct: 24  EGCVTYPFEFAKTRLQL------AQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVG 77

Query: 87  EAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEA-LVIVPFELVKIRL- 144
              K  V+F   D   +  +   G   L+    +L+G  AG+ E+ L + PFE VK  L 
Sbjct: 78  NTCKAGVRFLGFDALRRALQDERGA--LSGPRGMLAGLGAGLLESVLAVTPFEAVKTALI 135

Query: 145 ---QDVNSKF----KGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRE 197
              Q    ++    +G       ++++ GL+GLY G+     R A   A  FG   Q+++
Sbjct: 136 DDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQ 195

Query: 198 LLP----VAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNW 253
            +         +   +      G + G   V    P D VK+R+Q+     ++  R Y  
Sbjct: 196 AVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA-----LDAAR-YGS 249

Query: 254 TWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVM 296
           T      +  EEG RAL++G  P++ RL   G ++   +  ++
Sbjct: 250 TVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEKLL 292

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 9/76 (11%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL     F+ GA++GI  +    P+D VKTRMQ           A  Y   + C   +V+
Sbjct: 208 PLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ--------ALDAARYGSTVGCFRAVVR 259

Query: 70  KEGPMHMYKGISSPML 85
           +EG   +++G ++P L
Sbjct: 260 EEGVRALWRG-ATPRL 274

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 126/309 (40%), Gaps = 43/309 (13%)

Query: 10  PLPFRYQFMAGAIAGISELMVM-YPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIV 68
           P+ F    + GA   + E+  +  PL+V+KT M       AA  S + +    + +  + 
Sbjct: 15  PISFS-NILLGAGLNMCEVTTLGQPLEVIKTTM-------AANRSFSFF----NAIKHVW 62

Query: 69  KKEGPMHMYKGISSPMLMEAPKRA-----VKFASNDEFIKLWKSVFGTKQLTQQISVLSG 123
            + G    Y+G+     +EA  +      V   S  +F ++  S FG+        ++ G
Sbjct: 63  SRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAESEYQFKRMGLSNFGS-------GIMGG 115

Query: 124 ASAGITEALVIVPF-------ELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVES 176
            + G+ +A + + F       E+ K +     +  +      K I K+DG+KG+  GV +
Sbjct: 116 VTGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNA 175

Query: 177 TVWRNAVWNAGYFGVIFQVRELLPVAKSKQE-----KTRNDLCAGFVGGTFGVMFNTPFD 231
              R        FG    V E +  A  K            + A  +GG     +N P +
Sbjct: 176 VAIRQMTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSA-WNQPIE 234

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLV 290
           V++  +QS   E  N  R  N T  S  K IY   G + LY+G  P++  LG    V +V
Sbjct: 235 VIRVEMQSK-KEDPN--RPKNLTVSSAFKYIYQSSGIKGLYRGVAPRI-GLGVWQTVFMV 290

Query: 291 VFTNVMNVF 299
            F ++   F
Sbjct: 291 GFGDMARDF 299

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 115/299 (38%), Gaps = 31/299 (10%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           +  +AG+++G+    V  P+D VK R QLQ+      AS   Y G++     + ++EG  
Sbjct: 26  HAVVAGSVSGLVARSVTAPMDTVKIRRQLQL------ASEHKYHGILHTFRTVAREEGVR 79

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVI 134
            ++KG      M     +++F +   +  L  +        Q  S+  GA AG+  +L+ 
Sbjct: 80  ALWKGNVPASAMYVLYGSLQFGT---YAWLNTAAASAGLPPQAHSLAVGALAGLVSSLLT 136

Query: 135 VPFELVKIRL-QDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193
            P +L++ RL  + ++ F       + I   +G  G + G     W  A       G+IF
Sbjct: 137 YPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG---GAWAIAA-TTLTTGLIF 192

Query: 194 QVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQ-SDGNEI-------- 244
            + E   +A            A    G        P D V+ R+Q  D   I        
Sbjct: 193 GIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFFTRDPG 252

Query: 245 ----INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
               + G R         + +   EG  +LYKG    + +  P   + L V+   + + 
Sbjct: 253 AYSALRGTRFLGL----AVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 71/179 (39%), Gaps = 29/179 (16%)

Query: 12  PFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKE 71
           P  +    GA+AG+   ++ YPLD+++TR+    S         H+  +      I   E
Sbjct: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRS--------AHFFSLRRQARVIWDTE 168

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEA 131
           GP   ++G +  +        + F    E   +    +G   L    S     +AG+   
Sbjct: 169 GPAGFFRGGAWAIAATTLTTGLIFGIY-ETCTIAADTYGLPWLAAAAS----PTAGLVSK 223

Query: 132 LVIVPFELVKIRLQDVNSKF-------KGPVEVLK---------HIIKQDGLKGLYSGV 174
             + P + V+ RLQ V++K         G    L+         H+++ +G+  LY G+
Sbjct: 224 AAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGL 282

>Kwal_26.7972
          Length = 358

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 80/208 (38%), Gaps = 34/208 (16%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKF-------KGPVEVLKHIIKQDGLKGLY 171
           S L+G  AG     +I P + +KI  Q  N  +        G +    HI   DG++G Y
Sbjct: 30  SGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFY 89

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G  +T+ R   + A  F    Q+R  +  +K  +   R  L +G + G   V    P D
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARR-LASGSMAGLCSVFMTYPLD 148

Query: 232 VVKSRIQ--SDGNEIINGVRKYNWTWPSVMKIYHEEGFRAL----------------YKG 273
           +++ R+   +D + I           P + +IY E    +L                Y+G
Sbjct: 149 LIRVRLAYVTDRSRI--------KMLPVIKQIYTERASESLTSKSYVPRWFAHWCNFYRG 200

Query: 274 FVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
           F P VL + P   V         ++ R 
Sbjct: 201 FTPTVLGMIPYAGVSFFAHDLCGDILRS 228

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 126/308 (40%), Gaps = 50/308 (16%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AG IAG     ++ PLD +K   Q         + +T   G+I   + I   +G    Y
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGST--MGLIRAGAHINAHDGIRGFY 89

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
           +G S+ ++   P  A+KF + ++       +   +  T    + SG+ AG+    +  P 
Sbjct: 90  QGHSATLIRIFPYAAIKFIAYEQIRHFM--IPSKEYETHARRLASGSMAGLCSVFMTYPL 147

Query: 138 ELVKIRLQDVNSKFK-GPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVR 196
           +L+++RL  V  + +   + V+K I  +   + L S      W  A W   Y G    V 
Sbjct: 148 DLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRW-FAHWCNFYRGFTPTVL 206

Query: 197 ELLPVA----------------------------------KSKQEKTR-----NDLCAGF 217
            ++P A                                  +SK++ +R      +L AG 
Sbjct: 207 GMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAELVAGG 266

Query: 218 VGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNW-TWPSVMK-IYHEEGFRALYKGFV 275
           + G      + PF++++ R+Q     +++    +N+ T P +++ IY E G+R  + G  
Sbjct: 267 LAGMASQTASYPFEIIRRRLQV---SVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVGLS 323

Query: 276 PKVLRLGP 283
              +++ P
Sbjct: 324 IGYIKVTP 331

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 45/95 (47%), Gaps = 3/95 (3%)

Query: 1   MSSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
           + S   +  PL    + +AG +AG++     YP ++++ R+Q+ V    +  S  +++ +
Sbjct: 246 IRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSV---VSPTSIHNFQTI 302

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKF 95
            D +  I K+ G    + G+S   +   P  A  F
Sbjct: 303 PDMIRIIYKERGWRGFFVGLSIGYIKVTPMVACSF 337

>Kwal_47.19228
          Length = 281

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 68/151 (45%), Gaps = 17/151 (11%)

Query: 155 VEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLC 214
           +  ++ I +  G++G   G   T+ R    +A  F     +++++   K   E     L 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL- 190

Query: 215 AGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWT-----WPSVMKIYHEEGFRA 269
            GF+     V    P DV+K+R+QS          KY W+          +I+ EEGF  
Sbjct: 191 -GFISSCAVVAVTQPIDVIKTRMQS----------KYTWSNYKNSLNCAYRIFVEEGFTK 239

Query: 270 LYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
            +KG+ P+++++G  G V   V+  V N+ +
Sbjct: 240 FWKGWAPRLMKVGLSGGVSFGVYQYVDNLMK 270

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL   Y F  G I+  + + V  P+DV+KTRMQ       +  + ++YK  ++C  +I  
Sbjct: 181 PLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQ-------SKYTWSNYKNSLNCAYRIFV 233

Query: 70  KEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQ 117
           +EG    +KG +  ++       V F        L K+V G ++++ +
Sbjct: 234 EEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAVNGQQEMSHE 281

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 118/278 (42%), Gaps = 36/278 (12%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           + G IA       + PLD+VK R+Q+         +   Y   +    +I+  EG   +Y
Sbjct: 23  LGGIIACGPTHSSITPLDLVKCRLQV---------NPKLYTSNLQGFRKIIANEGWKKVY 73

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISV--LSGASAGITEALVIV 135
            G  +  +  + + A K+   + F  L+ S      L+  ++V  ++ A+A     +++ 
Sbjct: 74  TGFGATFVGYSLQGAGKYGGYEYFKHLYSS-----WLSPGVTVYLMASATAEFLADIMLC 128

Query: 136 PFELVKIRLQDVNSKF-KGPVEVLKHIIKQD-GLKGLYSGVESTVWRNAVWNAGYFG--- 190
           PFE +K++ Q     F    V+  K +  +  G+K  Y G+     R   +    F    
Sbjct: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFE 188

Query: 191 -VIFQVRELLPVAKSKQEKTRN---DLCAGFVGGTFGVMFNTPFDVVKSRIQSD--GNEI 244
            ++ ++  +LP  K +    +        G++ G      + P DV+ S+I S+   NE 
Sbjct: 189 KIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANES 248

Query: 245 INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLG 282
           ++   K         +IY + GF  L+ G + +++ +G
Sbjct: 249 MSVASK---------RIYQKIGFTGLWNGLMVRIVMIG 277

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/287 (20%), Positives = 119/287 (41%), Gaps = 44/287 (15%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV--IDCLSQIVKKEGP 73
             + G   G+   +++ P D++KTR+Q          ++T +K +  I+  SQ+ +   P
Sbjct: 10  HLIGGFSGGLVSAIILQPFDLLKTRLQ-------QDKTSTLWKTLKSIETPSQLWRGALP 62

Query: 74  MHMYKGISSPM---LMEAPKRAVKFASNDEFIKLWKSVFGTK---QLTQQISVLSGASAG 127
             +   + S M   ++ + ++A+    N           G+    QL    ++ SGA   
Sbjct: 63  SCIRTSVGSAMYLTMLNSIRQAISKGKNT-------GSTGSSYLPQLNMYENMFSGAVTR 115

Query: 128 ITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAG 187
               L+ +P  ++K+R +    ++        HI + +GL+G + G  +T  R+A + AG
Sbjct: 116 ALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPY-AG 174

Query: 188 YFGVIFQ-----VRELLP--VAKSKQEKTRNDLCAGFVGGT-------FGVMFNTPFDVV 233
            + + +      V  LLP  V K   +   +   +  + G+              PFD V
Sbjct: 175 LYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTV 234

Query: 234 KSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
           K+R+Q +         K++    +   I  +E  R L+ G   ++ R
Sbjct: 235 KTRMQLEPA-------KFHSFTSTFWHIATKESVRNLFAGISLRLTR 274

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 84/198 (42%), Gaps = 22/198 (11%)

Query: 111 TKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGL 170
           ++Q      ++ G S G+  A+++ PF+L+K RLQ    K     + LK I   +    L
Sbjct: 2   SEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQ--DKTSTLWKTLKSI---ETPSQL 56

Query: 171 YSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSK---------QEKTRNDLCAGFVGGT 221
           + G   +  R +V +A Y  ++  +R+ +   K+          Q     ++ +G V   
Sbjct: 57  WRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRA 116

Query: 222 FGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRL 281
              +   P  V+K R +S        + +Y     +   I+  EG R  ++GF    LR 
Sbjct: 117 LTGLITMPITVIKVRYEST-------LYQYTSLRYATSHIFRTEGLRGFFRGFGATALRD 169

Query: 282 GPGGAVLLVVFTNVMNVF 299
            P  A L ++F + M V 
Sbjct: 170 AP-YAGLYMLFYDRMKVL 186

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 119/299 (39%), Gaps = 42/299 (14%)

Query: 20  GAIAGISELMVM-YPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           GA   + E+  +  PL+V KT M           +A    G    +  +  + G    Y+
Sbjct: 23  GAALNMCEVTTLGQPLEVTKTTM-----------AANRQFGFSQAVRHVWSRGGVFGFYQ 71

Query: 79  GISSPMLMEAPKRA-----VKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
           G+     +EA  +      V   +  +F +L  S FG         +L G S G+ +A +
Sbjct: 72  GLIPWAWIEASTKGAVLLFVSAEAEYQFRRLGLSNFGA-------GILGGVSGGVAQAYL 124

Query: 134 IVPF----ELVKIRLQDVNSKFKGPV----EVLKHIIKQDGLKGLYSGVESTVWRNAVWN 185
            + F    + V+I      S    PV    +V K I   +GL+G+  GV +   R     
Sbjct: 125 TMGFCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNAVAIRQMTNW 184

Query: 186 AGYFGVIFQVRELLPVAKSKQEKTR----NDLCAGFVGGTFGVMFNTPFDVVKSRIQSDG 241
              FG+   V + +     K+   +      + A  +GG     +N P +V++  +QS  
Sbjct: 185 GSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGLSA-WNQPIEVIRVEMQSRT 243

Query: 242 NEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           N+     R  N T     + IY   G R LY+G  P++  LG    + +V F ++   F
Sbjct: 244 NDP---NRPKNLTVGKTFRYIYENNGLRGLYRGVTPRI-GLGVWQTIFMVGFGDIARDF 298

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 89/184 (48%), Gaps = 34/184 (18%)

Query: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKK 70
           LP     +A   +GI+  ++  P+ V+KTR+   ++T  AG     YK   D + ++ + 
Sbjct: 111 LPAHAYMLAAGSSGIATAVLTNPIWVIKTRI---MATSRAGP----YKSTFDGVYKLYQT 163

Query: 71  EGPMHMYKGISSPMLMEAPKRAVKFASND--EFIKLWKS------------VFGTKQLTQ 116
           EG +  ++G+  P L+   + A+ FA  D  +F  L  S            + G   +++
Sbjct: 164 EGVLAFWRGV-VPSLLGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISK 222

Query: 117 QISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVES 176
            ISV S           + PF+L+K +LQD  +   G  ++++ +  ++G++G Y G+ +
Sbjct: 223 MISVTS-----------VYPFQLLKSKLQDFGAP-SGITQLVQTVYSREGIRGFYRGLSA 270

Query: 177 TVWR 180
            + R
Sbjct: 271 NLLR 274

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 79/189 (41%), Gaps = 13/189 (6%)

Query: 112 KQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSK--FKGPVEVLKHIIKQDGLKG 169
           ++L     +L+  S+GI  A++  P  ++K R+   +    +K   + +  + + +G+  
Sbjct: 109 RRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLA 168

Query: 170 LYSGVEST---VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMF 226
            + GV  +   V + A++ A Y  + F           ++      +    +     V  
Sbjct: 169 FWRGVVPSLLGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTS 228

Query: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGA 286
             PF ++KS++Q  G    +G+ +       V  +Y  EG R  Y+G    +LR  P   
Sbjct: 229 VYPFQLLKSKLQDFGAP--SGITQL------VQTVYSREGIRGFYRGLSANLLRAVPATC 280

Query: 287 VLLVVFTNV 295
           +   V+ N+
Sbjct: 281 ITFFVYENI 289

 Score = 35.0 bits (79), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 80/190 (42%), Gaps = 23/190 (12%)

Query: 110 GTKQLTQQISVLSGASAGITEALVIVPFELVKIRL-----QDVNSKFKGPVEVLKHIIKQ 164
           G +  + Q  V+SG +AG    +   P +L+K+RL        N+ + G +  +    +Q
Sbjct: 2   GHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFE--RQ 59

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKT----------RNDLC 214
              + LY G+   +  N+V  A YFG     +++       +  T             L 
Sbjct: 60  QWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLA 119

Query: 215 AGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGF 274
           AG  G    V+ N P  V+K+RI +           Y  T+  V K+Y  EG  A ++G 
Sbjct: 120 AGSSGIATAVLTN-PIWVIKTRIMATSR-----AGPYKSTFDGVYKLYQTEGVLAFWRGV 173

Query: 275 VPKVLRLGPG 284
           VP +L +  G
Sbjct: 174 VPSLLGVSQG 183

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 79/192 (41%), Gaps = 30/192 (15%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPV----EVLKHIIKQDGLKGLY 171
           S L+G  +G     +I P + +KI  Q  N   SK+ G +    E  KHI   DG++G +
Sbjct: 21  SGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFF 80

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G   T+ R   + A  F    Q+R +L  ++  +   R  L +G + G   V    P D
Sbjct: 81  QGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRR-LASGSLAGLCSVFITYPLD 139

Query: 232 VVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHE---EGFRA-------------LYKGFV 275
           + + R+          +R        V  IYHE   EG  +              Y+G+V
Sbjct: 140 LTRVRLAYVTEHKRVKLRDI------VKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYV 193

Query: 276 PKVLRLGPGGAV 287
           P VL + P   V
Sbjct: 194 PTVLGMIPYAGV 205

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 77/197 (39%), Gaps = 37/197 (18%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQL-----QVSTGAAGASATHYKGVIDCLSQIVKK 70
           +  +G++AG+  + + YPLD+ + R+       +V       +  H        S ++  
Sbjct: 120 RLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVP 179

Query: 71  EGPMH---MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSV----FGTKQLTQQ------ 117
           +   H    Y+G    +L   P   V F ++D    + KS     +  KQL+ Q      
Sbjct: 180 KWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERK 239

Query: 118 -----------ISVLSGASAGITEALVIVPFELVKIRLQ--------DVNSKFKGPVEVL 158
                        +++G  +GI       P E+++ RLQ          + KF+    + 
Sbjct: 240 KLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIA 299

Query: 159 KHIIKQDGLKGLYSGVE 175
           + I ++ G +G + G+ 
Sbjct: 300 RIIYQEKGWRGFFVGLS 316

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 8   QAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQI 67
           + PL    + +AG ++GI      YPL++++ R  LQVST +      H    I  +++I
Sbjct: 244 KTPLRTWAELVAGGLSGILSQTAAYPLEIIRRR--LQVSTLSPRKMYDHKFQSISSIARI 301

Query: 68  VKKE-GPMHMYKGISSPMLMEAPKRAVKF 95
           + +E G    + G+S   +   P  A  F
Sbjct: 302 IYQEKGWRGFFVGLSIGYIKVTPMVACSF 330

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 36/91 (39%), Gaps = 3/91 (3%)

Query: 215 AGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGF 274
           AG V G+       P D +K   Q+               + +   I+  +G R  ++G 
Sbjct: 24  AGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGH 83

Query: 275 VPKVLRLGPGGAVLLVVFTNVMNVF---REF 302
              +LR+ P  AV  V +  + ++    RE+
Sbjct: 84  SVTLLRIFPYAAVKFVAYEQIRSILIPSREY 114

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 77/186 (41%), Gaps = 18/186 (9%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNSKFK-------GPVEVLKHIIKQDGLKGLY 171
           S L+G  +G     +I P + +KI  Q  N  +        G VE  KHI   DG++G +
Sbjct: 36  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFF 95

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G  +T+ R   + A  F    Q+R  L  +K  +   R  L +G + G   V    P D
Sbjct: 96  QGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRR-LVSGSLAGLCSVFITYPLD 154

Query: 232 VVKSRIQSDGNE-------IINGVRKYNWTWPSVMKIYHEEGFRA---LYKGFVPKVLRL 281
           +V+ R+  +          II  + K   +   +   Y    F      Y+G+VP VL +
Sbjct: 155 LVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGM 214

Query: 282 GPGGAV 287
            P   V
Sbjct: 215 IPYAGV 220

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 83/200 (41%), Gaps = 45/200 (22%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAG------------ASAT-------- 55
           + ++G++AG+  + + YPLD+V+ R+  +                   ASAT        
Sbjct: 135 RLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIP 194

Query: 56  --------HYKGVIDCLSQIVKKEGPMH-----MYKGISSPMLMEAPKRAVKFASNDEFI 102
                    Y+G +  +  ++   G        ++  + SP    AP   ++ + +DE  
Sbjct: 195 NWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFF--APYSVLELSEDDELE 252

Query: 103 KLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQ--------DVNSKFKGP 154
           ++ K     + L     ++SG  AG+       PFE+++ RLQ          + KF+  
Sbjct: 253 RVQKK--QRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSI 310

Query: 155 VEVLKHIIKQDGLKGLYSGV 174
            E+   I K+ G++G + G+
Sbjct: 311 SEIAHIIFKERGVRGFFVGL 330

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 3/89 (3%)

Query: 8   QAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-YKGVIDCLSQ 66
           + PL    + ++G +AG++     YP ++++ R  LQVS  +      H ++ + +    
Sbjct: 259 RRPLRTWAELISGGLAGMASQTAAYPFEIIRRR--LQVSALSPKTMYDHKFQSISEIAHI 316

Query: 67  IVKKEGPMHMYKGISSPMLMEAPKRAVKF 95
           I K+ G    + G+S   +   P  A  F
Sbjct: 317 IFKERGVRGFFVGLSIGYIKVTPMVACSF 345

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/345 (20%), Positives = 132/345 (38%), Gaps = 89/345 (25%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
            +AG+ A + +  + +P + +KT  QL  S   A A    +          VK       
Sbjct: 12  LLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAFNMFHH---------VKS-----Y 57

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS-GASAGITEALVIV 135
           + G S+  +    K A +FA+ D+  +L K     +     + +++ G+  G  E+++I+
Sbjct: 58  FAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGFMESMLII 117

Query: 136 PFELVKIRL----------------------------------------------QDVNS 149
           PFE +K R+                                              +++N 
Sbjct: 118 PFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQVKKEINP 177

Query: 150 KFKGPVEVLKH-----------IIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVREL 198
           +++  +   KH           +++  G    + G   T++R    +A  F     ++++
Sbjct: 178 RYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQM 237

Query: 199 LPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTW--- 255
           +   K   E     +  G       V    P DVVK+R+QS          KY W+    
Sbjct: 238 ISPNKPLSEYYAFGI--GVFSSCAVVALTQPIDVVKTRMQS----------KYTWSLYRN 285

Query: 256 --PSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
               V + + EEG  +L+KG+VP++ ++G  G V   V+  V N+
Sbjct: 286 SLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNL 330

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           PL   Y F  G  +  + + +  P+DVVKTRMQ       +  + + Y+  ++C+ +   
Sbjct: 243 PLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQ-------SKYTWSLYRNSLNCVYRTFI 295

Query: 70  KEGPMHMYKG 79
           +EG   ++KG
Sbjct: 296 EEGLTSLWKG 305

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 48/245 (19%), Positives = 88/245 (35%), Gaps = 53/245 (21%)

Query: 5   HNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRM-----------QLQVSTGAAGAS 53
            N +AP+       AG+I G  E M++ P + +KTRM           Q +V TG     
Sbjct: 90  ENPEAPVSGLRLIAAGSITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKP 149

Query: 54  ATHYKGVIDCLSQI-------VKKE------------------------------GPMHM 76
            +     ++   QI       VKKE                              G    
Sbjct: 150 RSKSVNNMETKEQIRPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTF 209

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVP 136
           ++G    +  +    AV+F +   +  L + +   K L++  +   G  +      +  P
Sbjct: 210 FQGSMPTIFRQVGNSAVRFTT---YTTLKQMISPNKPLSEYYAFGIGVFSSCAVVALTQP 266

Query: 137 FELVKIRLQD--VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            ++VK R+Q     S ++  +  +     ++GL  L+ G    +++  +     FGV   
Sbjct: 267 IDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQY 326

Query: 195 VRELL 199
           V  L+
Sbjct: 327 VDNLM 331

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 135/321 (42%), Gaps = 42/321 (13%)

Query: 1   MSSNHNTQA-------PLPFRYQFMAGAIAGISELMVM-YPLDVVKTRMQLQVSTGAAGA 52
           M S  NT A       P+ F    + GA   +SE+  +  PL+VVKT M           
Sbjct: 1   MPSTTNTAAANVIEKKPVSFS-NILLGACLNLSEVTTLGQPLEVVKTTM----------- 48

Query: 53  SATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAP-KRAVKFASNDEFIKLWKSVFGT 111
           +A      ++ +  +  + G +  Y+G+     +EA  K AV    + E    +KS+ G 
Sbjct: 49  AANRNFTFLESVKHVWSRGGILGYYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSL-GL 107

Query: 112 KQLTQQISVLSGASAGITEALVIVPF-------ELVKIRLQDVNSKFKGPVEVLKHIIKQ 164
                 I  L G + G+T+A + + F       E+ + +        +    V K+I K+
Sbjct: 108 NNFASGI--LGGVTGGVTQAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKK 165

Query: 165 DGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLP--VAKSKQEKTRN---DLCAGFVG 219
           +G++G+  GV +   R        FG+   V + +     K+ ++   N    + A  +G
Sbjct: 166 EGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALG 225

Query: 220 GTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKV 278
           G     +N P +V++  +QS   E  N  R  N T     K IY   G + LY+G  P++
Sbjct: 226 GGLSA-WNQPIEVIRVEMQSK-KEDPN--RPKNLTVGKTFKYIYQSNGLKGLYRGVTPRI 281

Query: 279 LRLGPGGAVLLVVFTNVMNVF 299
             LG    V +V F ++   F
Sbjct: 282 -GLGIWQTVFMVGFGDMAKEF 301

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 121/290 (41%), Gaps = 40/290 (13%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV--IDCLSQIVKKEGP 73
             + G   G++  + + PLD++KTR+Q           AT +K +  ID   Q+ +   P
Sbjct: 13  HLIGGFFGGLTSAVALQPLDLLKTRIQ-------QDKKATLWKNLKEIDSPLQLWRGTLP 65

Query: 74  MHMYKGISSPMLME---------APKR-AVKFASNDEFIKLWKSVFGTKQLTQQISVLSG 123
             +   I S + +          A +R AV   +ND  I   KS     +LT   ++L+G
Sbjct: 66  SALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSS-SLPRLTMYENLLTG 124

Query: 124 ASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAV 183
           A A      + +P  ++K+R +     +    E + HI  ++GL G + G  +T  R+A 
Sbjct: 125 AFARGLVGYITMPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAP 184

Query: 184 WNAGYFGVIFQVRELLPVAKSKQEKTRND-------------LCAGFVGGTFGVMFNTPF 230
           +   Y  +  + ++LLP+    +    N                +  +  +       PF
Sbjct: 185 YAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPF 244

Query: 231 DVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
           D +K+R+Q + ++  N       T+ S++K    E    L+ G   ++ R
Sbjct: 245 DTIKTRMQLEPSKFTNSFN----TFTSIVK---NENVLKLFSGLSMRLAR 287

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 16/99 (16%)

Query: 203 KSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIY 262
           ++ + +  + L  GF GG    +   P D++K+RIQ D    +         W ++ +I 
Sbjct: 4   QATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATL---------WKNLKEI- 53

Query: 263 HEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
             +    L++G +P  LR   G A+ L    + +N+ R 
Sbjct: 54  --DSPLQLWRGTLPSALRTSIGSALYL----SCLNLMRS 86

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 75/193 (38%), Gaps = 33/193 (17%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVW 179
           ++ G   G+T A+ + P +L+K R+Q           + K++ + D    L+ G   +  
Sbjct: 14  LIGGFFGGLTSAVALQPLDLLKTRIQQ-----DKKATLWKNLKEIDSPLQLWRGTLPSAL 68

Query: 180 RNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND--------------------LCAGFVG 219
           R ++ +A Y   +  +R  L   ++      ND                    L   F  
Sbjct: 69  RTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFAR 128

Query: 220 GTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVL 279
           G  G +   P  V+K R +S        +  Y+    ++  IY +EG    ++GF    L
Sbjct: 129 GLVGYI-TMPITVIKVRYEST-------LYNYSSLKEAITHIYTKEGLFGFFRGFGATCL 180

Query: 280 RLGPGGAVLLVVF 292
           R  P   + ++++
Sbjct: 181 RDAPYAGLYVLLY 193

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 128/327 (39%), Gaps = 57/327 (17%)

Query: 14  RYQFMAGAIAGISELMVMYPLDVVKTRMQLQVS-TGAAGASATH-----YKGVIDCLSQI 67
           R   +AGA A + +  + +P + +KT  QL  +  GAA  +  H     + G        
Sbjct: 21  RSSVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAAFNMLHPFKYYFSGCAALNVGT 80

Query: 68  VKKEG---------------PMHMYKGISSPMLMEA-------------PKRAVKFASND 99
           + K G               P H  + I+ P L+ A             P  ++K  + +
Sbjct: 81  LLKTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVVPFESIKTTAVE 140

Query: 100 EFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRL-----QDVNSKFKGP 154
             ++L + V G  + T+  +V  G +   T      P +    R      +  +S F G 
Sbjct: 141 NALELSRRVQGEPE-TRAAAVSKGPAPKATFH-AARPVQTAHERWLLHYERQPSSHFAGT 198

Query: 155 VEVLKHIIKQDGLKGLYSGVESTVWR---NAVWNAGYFGVIFQVRELLPVAKSKQEKTRN 211
           V     I +  G++G   G   T++R   N+V     +  I Q      ++  K      
Sbjct: 199 V---LEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQ-----SLSPHKALDEYQ 250

Query: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALY 271
              AG +     V    P DV+K+R+QS           Y  +     +I+ EEGFR ++
Sbjct: 251 AFAAGALSSAAVVALTQPIDVIKTRMQSK-----TAWFTYKSSLNCAYRIFVEEGFRYMW 305

Query: 272 KGFVPKVLRLGPGGAVLLVVFTNVMNV 298
           KG+VP++ ++   G +   V+  V N+
Sbjct: 306 KGWVPRLFKVSLSGGISFGVYQYVENL 332

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 78/206 (37%), Gaps = 39/206 (18%)

Query: 120 VLSGASAGITEALVIVPFELVKIRLQD---------------VNSKF--------KGPVE 156
           +++G   GI E+L I+PFE +K  L                 VN+K           PV 
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 157 -------VLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKT 209
                   +KH+ +  G      G  +T++R     +  F      + LL     K    
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARNDKASSV 198

Query: 210 RNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRA 269
              L   F      V    P DVVK+R+ S      N   +Y  T   + +I+ +EG   
Sbjct: 199 ITGLATSFTL----VAMTQPIDVVKTRMMSQ-----NAKTEYKNTLNCMYRIFVQEGMAT 249

Query: 270 LYKGFVPKVLRLGPGGAVLLVVFTNV 295
            +KG + + +++G  G +   V+  V
Sbjct: 250 FWKGSIFRFMKVGISGGLTFTVYEQV 275

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/180 (18%), Positives = 79/180 (43%), Gaps = 28/180 (15%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRM---------QLQVSTGAAGASATHYK--------- 58
            +AG + GI E + + P + +KT +         +L+ +     A AT +K         
Sbjct: 79  LIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVA 138

Query: 59  ---GVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLT 115
               ++  +  + +  GP    +G ++ +  +    +++F +   F +L ++     +  
Sbjct: 139 RIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQA-----RND 193

Query: 116 QQISVLSGASAGITEALVIVPFELVKIRL--QDVNSKFKGPVEVLKHIIKQDGLKGLYSG 173
           +  SV++G +   T   +  P ++VK R+  Q+  +++K  +  +  I  Q+G+   + G
Sbjct: 194 KASSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKG 253

>Scas_578.3*
          Length = 524

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 125/306 (40%), Gaps = 43/306 (14%)

Query: 17  FMAGAIAGISELMVMYPLDVVKT---------------RMQLQVSTGAAGASATHYKG-V 60
           F+AG ++G+       PLD +K                +M L++     G +    +  +
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQ----GLNLAKIRSPI 267

Query: 61  IDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTK---QLTQQ 117
           I  +  + ++ G    Y G    +    P+ ++KF + +   +L  ++ G K    L++ 
Sbjct: 268 IKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSKL 327

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQ--DVNSKFKGP---VEVLKHIIKQDGLKGLYS 172
            + ++G  AG+   + I P + +K R+Q   +    KG    +   K + K+ G++  Y 
Sbjct: 328 QTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYR 387

Query: 173 GV---ESTVWRNAVWNAGYFGVI------FQVRELLPVAKSKQEKTRNDLCAGFVGGTFG 223
           GV      ++  A  + G F  +       Q ++L    K         L  G   GT G
Sbjct: 388 GVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVG 447

Query: 224 VMFNTPFDVVKSRIQSDGNEIINGVRKYNWT--WPSVMKIYHEEGFRALYKGFVPKVLRL 281
                P +++++R+Q+ G         Y +T      M+    EG    YKG VP ++++
Sbjct: 448 ATAVYPINLLRTRLQAQGTY----AHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVKV 503

Query: 282 GPGGAV 287
            P  ++
Sbjct: 504 CPAVSI 509

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (45%), Gaps = 14/161 (8%)

Query: 142 IRLQDVN-SKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL 199
           +R+Q +N +K + P+ + ++ + +Q GL+  Y G   +V++    ++  FG     + L+
Sbjct: 253 LRIQGLNLAKIRSPIIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLM 312

Query: 200 PVAKSKQEKTRNDLC------AGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNW 253
             A    +K  NDL       AG + G    +   P D +K RIQ      + G  K N 
Sbjct: 313 --ANLSGDKLVNDLSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQC---APLEGNLKGNA 367

Query: 254 TWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFT 293
              S  K +Y E G R  Y+G +   L + P  A+ L  F+
Sbjct: 368 LLISTAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFS 408

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKG 79
           GA +G      +YP+++++TR+Q Q       A    Y G  D   Q +K+EG    YKG
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQ----GTYAHPYTYTGFRDVFMQTLKREGVPGFYKG 495

Query: 80  ISSPMLMEAPKRAVKFASNDEF 101
           +   ++   P  ++ +   ++F
Sbjct: 496 LVPTLVKVCPAVSIGYLCYEKF 517

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 109/248 (43%), Gaps = 18/248 (7%)

Query: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92
           PL  + TRMQ+       G   T  K  ++ + +I +KEG +  Y G+ S M   A    
Sbjct: 36  PLVTLATRMQVSEQDKEPG---TRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSL 92

Query: 93  VKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFK 152
             +   +   +    V G+++L    ++LS A AG   A+   P  +V  R+    S+ +
Sbjct: 93  NYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE-Q 151

Query: 153 GPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND 212
             + VL  I+++DG+  L++G+     R A+       + + V E L     K   +   
Sbjct: 152 STLAVLLDIVRKDGVTALFNGL-----RPALMLVSNPIIQYTVFEQLKNVVLKWSGSDVL 206

Query: 213 LCA-GFVGGTFGVMFNT----PFDVVKSRIQ-SDGNEIINGVRKYNWTWPSVMKIYHEEG 266
           L +  F+ G  G +  T    P+  +K+R+  + G E  +  +     W  ++ I  +EG
Sbjct: 207 LPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQS---MWSLMVDIVKKEG 263

Query: 267 FRALYKGF 274
            + LY G 
Sbjct: 264 IQGLYHGI 271

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 75/173 (43%), Gaps = 16/173 (9%)

Query: 133 VIVPFELVKIRLQ------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNA 186
           + +P   +  R+Q      +  ++ K  +E ++ I +++G+ G Y G+ES ++  A  + 
Sbjct: 33  LTMPLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSL 92

Query: 187 GYFGVI-FQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEII 245
            Y+       R  + V  S++  T   + +  V G+   + + P  VV +R+    +E  
Sbjct: 93  NYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE-- 150

Query: 246 NGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298
                   T   ++ I  ++G  AL+ G  P  L L     +   VF  + NV
Sbjct: 151 ------QSTLAVLLDIVRKDGVTALFNGLRP-ALMLVSNPIIQYTVFEQLKNV 196

 Score = 35.8 bits (81), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           + F+ GA+  ++     YP   +KTRM L      A    + +  ++D    IVKKEG  
Sbjct: 210 WAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVD----IVKKEGIQ 265

Query: 75  HMYKGISSPMLMEAPKRAVKFASNDEFIKLW 105
            +Y GI   +       A  F   + FI LW
Sbjct: 266 GLYHGIGVKLTQSILTAAFLFYFKEGFI-LW 295

>Kwal_55.21338
          Length = 323

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 110/265 (41%), Gaps = 30/265 (11%)

Query: 27  ELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLM 86
            + + YPL VV T++Q Q + G   + A       D +  I +K+G M  + G+ S +  
Sbjct: 36  SMTLTYPLIVVTTKLQTQDAKGEKLSLA-------DTIKDIYRKDGAMGFFAGLESALFG 88

Query: 87  EAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQD 146
                 V +   +   +       T++LT   S+L G+ AG   A    P  +   R+  
Sbjct: 89  TTLSNFVYYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMT- 147

Query: 147 VNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVI-----FQVRELLP- 200
           V    +G +  +  I+K +G+ GL+ G+          N     VI     + V E L  
Sbjct: 148 VQKSDRGTLSTIFDIVKDEGISGLFKGL----------NPALILVINPIIQYTVYEQLKN 197

Query: 201 -VAKSKQEKTRNDLCAGFVGGTFGVMFNT----PFDVVKSRIQSDGNEIINGVRKYNWTW 255
            +  S+Q +T +   A F+ G  G +  T    P+  +K+R+   G    +         
Sbjct: 198 WILSSRQTRTLSPSWA-FILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPPRSLL 256

Query: 256 PSVMKIYHEEGFRALYKGFVPKVLR 280
             + +I  ++G   LY+G   K+++
Sbjct: 257 SLMAEIIKKDGILGLYRGIGIKLVQ 281

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 3   SNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVID 62
           S+  T+   P  + F+ GA+  ++     YP   +K RM L     ++ A+    + ++ 
Sbjct: 201 SSRQTRTLSP-SWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPP--RSLLS 257

Query: 63  CLSQIVKKEGPMHMYKGI 80
            +++I+KK+G + +Y+GI
Sbjct: 258 LMAEIIKKDGILGLYRGI 275

>Scas_717.20
          Length = 356

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVN---SKFKGPV----EVLKHIIKQDGLKGLY 171
           S L+G  +G     +I P + +KI  Q  N   +K+ G +    E  KHI   DG++G +
Sbjct: 35  SGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFF 94

Query: 172 SGVESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFD 231
            G   T+ R   + A  F    Q+R  L  +K  +   R  L +G + G   V    P D
Sbjct: 95  QGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRR-LMSGSLAGLCSVFTTYPLD 153

Query: 232 VVKSRI 237
           +++ R+
Sbjct: 154 LIRVRL 159

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 82/199 (41%), Gaps = 43/199 (21%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQL---QVSTGAAGASATHYKGVIDCLSQIVKKEG 72
           + M+G++AG+  +   YPLD+++ R+            G   T YK   +  S  ++ +G
Sbjct: 134 RLMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYK---EPASTTLEAKG 190

Query: 73  PM--------HMYKGISSPMLMEAPKRAVKFASNDEFIKLWK-------SVFGTKQLTQQ 117
            +        + Y+G +  +L   P   V F ++D    + K       SV    +  Q+
Sbjct: 191 YIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQE 250

Query: 118 --------------ISVLSGASAGITEALVIVPFELVKIRL--------QDVNSKFKGPV 155
                           +LSG  AG+       PFE+++ RL        Q  + +F+   
Sbjct: 251 ERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSIS 310

Query: 156 EVLKHIIKQDGLKGLYSGV 174
           E+ K I K+ G +G + G+
Sbjct: 311 EIAKIIYKERGWRGFFVGL 329

 Score = 34.7 bits (78), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 4   NHNTQAPLPFRY--QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVI 61
            H     LP R   + ++G +AG++     YP ++++ R  LQVST +      H    I
Sbjct: 252 RHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRR--LQVSTLSVSQMYDHRFQSI 309

Query: 62  DCLSQIVKKE-GPMHMYKGISSPMLMEAPKRAVKF 95
             +++I+ KE G    + G+S   +   P  A  F
Sbjct: 310 SEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSF 344

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 38/104 (36%)

Query: 196 RELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTW 255
           R  +P+ K+  E       AG + G+       P D +K   Q+                
Sbjct: 19  RNQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLK 78

Query: 256 PSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
            +   I+  +G R  ++G    ++R+ P  AV  V +  + N  
Sbjct: 79  EAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYEQIRNTL 122

>Scas_328.1
          Length = 227

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
           F+ G    IS     YPLD V+ RM +          A  YKG IDC  QIV +EG   +
Sbjct: 140 FLLGWAVTISASTTSYPLDTVRRRMMM------TSGQAVKYKGAIDCFQQIVSQEGVYSL 193

Query: 77  YKGISS 82
           +KG  +
Sbjct: 194 FKGCGA 199

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 85/206 (41%), Gaps = 23/206 (11%)

Query: 89  PKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGI------TEALVIVPFELVKI 142
           P +A+ FA  D+     K++FG +Q  +++  +     GI      +  +V +   L K 
Sbjct: 7   PTQALNFAFKDKI----KAMFGFQQGKRRLYQMVYGECGIRWMCRCSFPIVCLFLRLCKN 62

Query: 143 RL-QDVNS-------KFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQ 194
            +  D  S       KF G ++V K  +  DG+ GLY G   +V    V+   YFG+   
Sbjct: 63  EIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDS 122

Query: 195 VRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWT 254
           ++ +L +  S +         G+         + P D V+ R+     + +    KY   
Sbjct: 123 LKPVL-LTGSFENAFLPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAV----KYKGA 177

Query: 255 WPSVMKIYHEEGFRALYKGFVPKVLR 280
                +I  +EG  +L+KG    + R
Sbjct: 178 IDCFQQIVSQEGVYSLFKGCGANIFR 203

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 15 YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
          Y+   GAI+G     ++YP D+++ R Q+    G        YK V D L  I K EGP 
Sbjct: 12 YKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGG--NELGFRYKSVSDALITIGKTEGPK 69

Query: 75 HMYKGISSPMLMEAPKRAVKF 95
            YKG+++ +    P  AV +
Sbjct: 70 GYYKGLTANLFKVIPSTAVSW 90

 Score = 29.6 bits (65), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 125 SAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST 177
           S G+ + LV  PF+L++ R Q       ++  ++K   + L  I K +G KG Y G+ + 
Sbjct: 20  SGGVAQTLV-YPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLTAN 78

Query: 178 VWR 180
           +++
Sbjct: 79  LFK 81

>Kwal_55.21106
          Length = 328

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 120/295 (40%), Gaps = 45/295 (15%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASA-------------THYKGVIDCL 64
           + GA+A     +V+YPLD+VKT +Q Q      G+ A               YK  +D L
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 65  SQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQI------ 118
            +I K +G + +Y+G+ + ++    +    F+    +  + KS F  K L  ++      
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQ---SFSYFFWYSIVRKSFFRYKLLRGRLGKFSTP 124

Query: 119 -SVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPV-EVLKHII-KQDGLKGLYSGVE 175
             +L G  A     +   P  ++  R Q   S  KG   EVL  I  +Q+ + G + G +
Sbjct: 125 EELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFK 184

Query: 176 STVWRNAVWNAGYFGVIFQVRELLPVAK------------SKQEKTRNDLCAGFVGGTFG 223
            ++    V  +  F    +++++   +K            S Q   R +   G       
Sbjct: 185 VSLILT-VNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSKVIS 243

Query: 224 VMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
            +   P  V K+ +Q  G+        +      ++ +Y +EG  +L+KG  P++
Sbjct: 244 TLITQPLIVSKAYLQRTGSN-------FQSFQQVLLYLYKQEGLISLWKGLAPQL 291

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 86/210 (40%), Gaps = 37/210 (17%)

Query: 119 SVLSGASAGITEALVIVPFELVKIRLQDVNS----------------------KFKGPVE 156
           S ++GA A     +V+ P +LVK  +Q  N                       ++K  ++
Sbjct: 6   SAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLD 65

Query: 157 VLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVREL-----LPVAKSKQEKTRN 211
            L  I K  G+ GLY G+ +++    + +  YF     VR+      L   +  +  T  
Sbjct: 66  ALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPE 125

Query: 212 DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEE-GFRAL 270
           +L  G V      +F +P  V+ +R Q+  +    G R+       + +IY E+      
Sbjct: 126 ELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREV------LHQIYSEQNNITGF 179

Query: 271 YKGF-VPKVLRLGPGGAVLLVVFTNVMNVF 299
           ++GF V  +L + P  ++    +  + ++F
Sbjct: 180 WRGFKVSLILTVNP--SITFASYEKLQDIF 207

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 128/316 (40%), Gaps = 49/316 (15%)

Query: 8   QAPLPFRYQFMAGAIAGISELMVM-YPLDVVKTRMQLQVSTGAAGASATHYK-GVIDCLS 65
           + P+ F    + GA   +SE+  +  PL+VVKT M            A H +   +    
Sbjct: 7   KKPVSFS-NILLGAGLNLSEVTTLGQPLEVVKTTM------------AAHREFNFLQATK 53

Query: 66  QIVKKEGPMHMYKGISSPMLMEAPKRA-----VKFASNDEFIKLWKSVFGTKQLTQQISV 120
            +  + G    Y+G+     +EA  +      V   +   F  L  + FG         +
Sbjct: 54  HVWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGA-------GI 106

Query: 121 LSGASAGITEALVIVPF-------ELVKIRLQDVNSKF-KGPVEVLKHIIKQDGLKGLYS 172
           + G + G+T+A + + F       E+ + +  +V     +   +V K I K++G++G+  
Sbjct: 107 MGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRGINK 166

Query: 173 GVESTVWRNAVWNAGYFGVIFQVRELL-----PVAKSKQEKTRNDLCAGFVGGTFGVMFN 227
           GV +   R        FG+   V + +        K  +      + A  +GG     +N
Sbjct: 167 GVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSA-WN 225

Query: 228 TPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGA 286
            P +V++  +QS   E  N  R  N T     K IY   G + LY+G  P+V  LG    
Sbjct: 226 QPIEVIRVEMQSK-KEDPN--RPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV-GLGIWQT 281

Query: 287 VLLVVFTNVMNVFREF 302
           V +V F ++    REF
Sbjct: 282 VFMVGFGDMA---REF 294

>Scas_613.24
          Length = 177

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 71/163 (43%), Gaps = 5/163 (3%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             ++G I G+S  + + PLD++KTR+Q     GA   SA   K + D + Q  +   P  
Sbjct: 11  HLVSGFIGGLSSAVTLQPLDLLKTRIQQH--KGATLWSAI--KDIKDPI-QFWRGTLPSA 65

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135
           +   I S + +           + +            QLT   ++L+GA A      + +
Sbjct: 66  LRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVGYITM 125

Query: 136 PFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTV 178
           P  ++K+R +     +K   E +K I K +G+ G + G   TV
Sbjct: 126 PITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 37.4 bits (85), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 16/96 (16%)

Query: 205 KQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHE 264
           K  KT   L +GF+GG    +   P D++K+RIQ      +         W ++  I   
Sbjct: 4   KSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATL---------WSAIKDIKDP 54

Query: 265 EGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300
             F   ++G +P  LR   G A+ L    + +N+ R
Sbjct: 55  IQF---WRGTLPSALRTSIGSALYL----SCLNIMR 83

 Score = 30.8 bits (68), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 68/178 (38%), Gaps = 36/178 (20%)

Query: 118 ISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPV--EVLKHIIKQDGLKGLYSGVE 175
           + ++SG   G++ A+ + P +L+K R+Q    + KG      +K I  +D ++  + G  
Sbjct: 10  VHLVSGFIGGLSSAVTLQPLDLLKTRIQ----QHKGATLWSAIKDI--KDPIQ-FWRGTL 62

Query: 176 STVWRNAVWNAGYFGVIFQVRE---------------LLPVAKSKQEKTRNDLCAGFVGG 220
            +  R ++ +A Y   +  +R                 LP     +      +  G VG 
Sbjct: 63  PSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVG- 121

Query: 221 TFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKV 278
                   P  ++K R +S           Y     ++  IY  EG    +KGF P V
Sbjct: 122 ----YITMPITILKVRYEST-------YYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>Scas_705.9
          Length = 323

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 84/185 (45%), Gaps = 27/185 (14%)

Query: 5   HNTQA----PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGV 60
            NTQA     +    + + G  A     +V  P++V+ T+ Q            T  K  
Sbjct: 108 RNTQARPINSISTVEELIVGVGAAALTQVVNNPIEVILTKQQ-----------TTDDKDN 156

Query: 61  ID---CLSQI-VKKEGPMHMY-KGISSPMLMEAPKRAVKFASNDEFIK-LWKSVFGTK-- 112
           +D    L QI V+  G +  Y KG    +++     ++ FA+   F   L K V  ++  
Sbjct: 157 VDFYSVLKQIYVESNGKLSSYWKGFKVSLILTVNP-SITFAAYQRFKDILLKQVSNSEKS 215

Query: 113 ---QLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKG 169
              QLT   + + GA A I   ++  P  + K+ LQ  NSKFK   EVL+++ K++G+  
Sbjct: 216 YSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLA 275

Query: 170 LYSGV 174
           L+ GV
Sbjct: 276 LWKGV 280

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 110/298 (36%), Gaps = 54/298 (18%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYK------GVIDCLSQIVKKE 71
           + GAIA     +++YPLDV KT +Q +         +   K       VI CL +I +K 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 72  GPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEA 131
           G   +Y+G+S+ +  +  +    F         W S    K  +  + +L    A    +
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYF--------FWYSFLRRKYFS--LKLLRNTQARPINS 117

Query: 132 LVIVPFELVKIRLQDVNSKFKGPVEVL--KHIIKQDG--------LKGLYSGVESTVWRN 181
           +  V   +V +    +      P+EV+  K     D         LK +Y  VES    +
Sbjct: 118 ISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIY--VESNGKLS 175

Query: 182 AVWNAGYFGVIFQV------------RELLPVAKSKQEKT-------RNDLCAGFVGGTF 222
           + W      +I  V            +++L    S  EK+         +   G +    
Sbjct: 176 SYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKII 235

Query: 223 GVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
             +   P  V K  +Q   +       K+      +  +Y EEG  AL+KG  P++ +
Sbjct: 236 STIITQPLIVAKVSLQRSNS-------KFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 9/108 (8%)

Query: 2   SSNHNTQAPLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVI 61
           +S  +    L     F+ GA+A I   ++  PL V K  +Q          S + +K   
Sbjct: 211 NSEKSYSGQLTVNQNFILGALAKIISTIITQPLIVAKVSLQ---------RSNSKFKHFE 261

Query: 62  DCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF 109
           + L  + K+EG + ++KG+   +      + + FA   E  K WK + 
Sbjct: 262 EVLRYLYKEEGVLALWKGVGPQLTKGVLVQGLVFAFKGELTKSWKRLL 309

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 127/317 (40%), Gaps = 53/317 (16%)

Query: 8   QAPLPFRYQFMAGAIAGISELMVM-YPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQ 66
           + P+ F    + GA   + E+  +  PL+VVKT M       AA    T ++ +    + 
Sbjct: 10  KKPISFS-NILLGAGLNMCEVTTLGQPLEVVKTTM-------AANRQFTFFQAI----NH 57

Query: 67  IVKKEGPMHMYKGISSPMLMEAPKRA-----VKFASNDEFIKLWKSVFGTKQLTQQISVL 121
           I  + G    Y+G+     +EA  +      V   +   F KL  + FG         ++
Sbjct: 58  IWSRGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGLNNFGA-------GIM 110

Query: 122 SGASAGITEALVIVPF-------ELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174
            G S G+ +A + + F       E+ K +     +K +      K I  ++G++G+  GV
Sbjct: 111 GGVSGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAK-QSSWAAFKEIYNKEGIRGINKGV 169

Query: 175 ESTVWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND--------LCAGFVGGTFGVMF 226
            +   R        FG    V E L   +    KT  D        + A  +GG     +
Sbjct: 170 NAVAIRQMTNWGSRFGFSRLVEEGL---RKFTGKTNPDDKLTALEKIFASAIGGGLSA-W 225

Query: 227 NTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGG 285
           N P +V++  +QS  N+     R  + T     + IY   G + LY+G  P++  LG   
Sbjct: 226 NQPIEVIRVEMQSKTNDP---NRPKDLTVGKAFRYIYQSNGVKGLYRGVTPRI-GLGIWQ 281

Query: 286 AVLLVVFTNVMNVFREF 302
            V +V      ++ REF
Sbjct: 282 TVFMV---GCGDIAREF 295

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 66/154 (42%), Gaps = 10/154 (6%)

Query: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193
           + P +LVK RLQ     ++  ++  K I++ +GL  +++GV +T    ++  A  +G   
Sbjct: 33  VTPLDLVKCRLQVNPQLYRSNLDGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYE 92

Query: 194 QVRE----LLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249
             ++    LL    + + +T   LCA         +   P++ +K + Q+          
Sbjct: 93  YFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFL 152

Query: 250 KYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283
           +  W+     KI   EG   LYKG  P   R  P
Sbjct: 153 E-GWS-----KITAAEGLSGLYKGITPLWCRQIP 180

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 74/164 (45%), Gaps = 14/164 (8%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76
             A A A     +++ P + +K + Q  +            K  ++  S+I   EG   +
Sbjct: 116 LCASASAEFLADILLCPWEAIKVKQQTTI--------PPFCKNFLEGWSKITAAEGLSGL 167

Query: 77  YKGISSPMLMEAPKRAVKFASNDEFIKL-WKSVFGTKQ---LTQQISV--LSGASAGITE 130
           YKGI+     + P    KF S +  +++ +  +  +KQ    +QQI V  + G  AGI  
Sbjct: 168 YKGITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILC 227

Query: 131 ALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174
           A+V  P +++  ++     + +  VE  K I  + G  GL++G+
Sbjct: 228 AVVSHPADVMVSKVNADRKQGESMVEASKRIYSRIGFGGLWNGL 271

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 73/162 (45%), Gaps = 14/162 (8%)

Query: 16  QFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75
             +A  IAG    +   P+ V  TRM +      A ++ +  + VID    IVK +GP+ 
Sbjct: 108 SILASTIAGSMTAVASNPIWVANTRMTV------AKSNHSTLRTVID----IVKTDGPLT 157

Query: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIV 135
           +  G+  P L+      +++   ++   L   +   K L+   + L GA   +       
Sbjct: 158 LLNGLK-PALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLSPSWAFLLGAIGKLAATGTTY 216

Query: 136 PFELVKIRL---QDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174
           P+  +K R+   Q+     K    ++  I+K+DG+ GLY+GV
Sbjct: 217 PYITLKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGV 258

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 15  YQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPM 74
           + F+ GAI  ++     YP   +KTRM L  +         H K +   + +IVKK+G  
Sbjct: 199 WAFLLGAIGKLAATGTTYPYITLKTRMHLMQN------DPKHQKSMWSLIVEIVKKDGVS 252

Query: 75  HMYKGISSPMLMEAPKRAVKFASND-------EFIKLWKSV 108
            +Y G++  ++      A  F   +       +FIKL +SV
Sbjct: 253 GLYNGVAVKLVQSIMTAAFLFFFKEGFIQWSLKFIKLLRSV 293

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 116/269 (43%), Gaps = 26/269 (9%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMY 77
           +AG++ G + + V YPL  + T +Q + +           +  ++ + +I  K G +  +
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEA---------RPKLETIKEIYNKNGIIGYF 66

Query: 78  KGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALVIVPF 137
            G+ S +   A    V +   +   K  +++   + L+   S+L+   AG   A+   P 
Sbjct: 67  LGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPI 126

Query: 138 ELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST--VWRNAVWNAGYFGVIFQV 195
            +   R+    S     +  +  I+K DG   L +G++    +  N +     + V  Q+
Sbjct: 127 WVANTRMTVAKSN-HSTLRTVIDIVKTDGPLTLLNGLKPALVLVSNPIIQ---YTVYEQL 182

Query: 196 RELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT----PFDVVKSRIQSDGNEIINGVRKY 251
           + L  V + +++K  +   A F+ G  G +  T    P+  +K+R+    N+     +  
Sbjct: 183 KNL--VLRLQRKKVLSPSWA-FLLGAIGKLAATGTTYPYITLKTRMHLMQND----PKHQ 235

Query: 252 NWTWPSVMKIYHEEGFRALYKGFVPKVLR 280
              W  +++I  ++G   LY G   K+++
Sbjct: 236 KSMWSLIVEIVKKDGVSGLYNGVAVKLVQ 264

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/303 (20%), Positives = 118/303 (38%), Gaps = 51/303 (16%)

Query: 20  GAIAGISELMVMYPLDVVKTRMQLQVSTG--------------------------AAGAS 53
           GA A     + +YPLD+ KT +Q Q+                              +  +
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 54  ATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKF----ASNDEFIKLWKSVF 109
           A  YKG +D L +I   EG   +Y+G+ S  +    +    F         + +L ++  
Sbjct: 69  AEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARG 128

Query: 110 GTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVE---VLKHIIKQDG 166
           G  + +    ++ G  A  T  L + P  +V  R Q    +  G  +   V + +  ++G
Sbjct: 129 GDARFSTPEELVLGIVAAATSQLFVNPINVVATR-QQTRGQAAGAADMRTVAREVHAENG 187

Query: 167 LKGLYSGVESTVWRNAVWNAGYFGVIFQVRELL---PVAKSKQEKTRNDLCAG--FVGGT 221
            +G ++G++ ++      +  Y     ++RE L   P A S    +   L  G  FV G 
Sbjct: 188 WRGFWAGLKVSLVLTVNPSITY-ATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGV 246

Query: 222 FGVMFNT----PFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPK 277
              + +T    P  + K+ +Q  G+        +      +  +Y  EG  +L+KG  P+
Sbjct: 247 LSKIVSTVLTQPLIIAKASLQRSGS-------CFQDFHQVLHHLYSTEGPLSLWKGLGPQ 299

Query: 278 VLR 280
           + +
Sbjct: 300 ITK 302

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 64/150 (42%), Gaps = 11/150 (7%)

Query: 140 VKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVRE-- 197
           + +R      ++KG ++ L+ I   +G+ GLY G+ S+     + +  YF     VR+  
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY 120

Query: 198 -LLPVAKSKQEK--TRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWT 254
             L  A+    +  T  +L  G V      +F  P +VV +R Q+ G        +    
Sbjct: 121 FRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMR---- 176

Query: 255 WPSVMKIYHEEGFRALYKGF-VPKVLRLGP 283
                +++ E G+R  + G  V  VL + P
Sbjct: 177 -TVAREVHAENGWRGFWAGLKVSLVLTVNP 205

>Scas_696.9
          Length = 312

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 118/292 (40%), Gaps = 28/292 (9%)

Query: 20  GAIAGISELMVM-YPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYK 78
           GA   ++E+  +  PL+VVKT M           +A      ++ +  +  + G +  Y+
Sbjct: 24  GATINMAEVTSLGQPLEVVKTTM-----------AANRNLNFVNSMKYVWSRGGIVGFYQ 72

Query: 79  GISSPMLMEAPKRA-----VKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
           G+     +EA  +      V   S   F  L    F +  L   +  ++ +   +     
Sbjct: 73  GLIPWAWIEASTKGAVLLFVSAESEYRFKLLGMGNFTSGILGGVLGGVTQSYLTMGFCTC 132

Query: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193
           +   E+ +++     +  +    V + I  ++GL+G+Y GV +   R        FG   
Sbjct: 133 MKTVEITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRFGFSR 192

Query: 194 QVRELLPVA--KSKQEKTRN---DLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGV 248
            V + +  A  K+K E   N    + A  VGG     +N P +V++  +QS   E  N  
Sbjct: 193 LVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSA-WNQPIEVIRVEMQSK-KEDPN-- 248

Query: 249 RKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVF 299
           R  N T     K I    G + LY+G  P++  LG    V +V F ++   F
Sbjct: 249 RPKNLTVAKTFKYIMKTNGVKGLYRGVTPRI-GLGIWQTVFMVGFGDMAKDF 299

>Kwal_34.15907
          Length = 312

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/311 (21%), Positives = 117/311 (37%), Gaps = 47/311 (15%)

Query: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69
           P+ F    +   +       +  PL+V+KT M           +A         +  +  
Sbjct: 15  PVSFSNILLGAGLNLCEATTLGQPLEVIKTTM-----------AANRNLNFGQSVKHVWS 63

Query: 70  KEGPMHMYKGISSPMLMEAPKRA-----VKFASNDEFIKLWKSVFGTKQLTQQISVLSGA 124
           + G    Y+G+     +EA  +      V   +  +F +L    FG         ++ G 
Sbjct: 64  RGGVFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYQFKRLGLGNFGA-------GIMGGV 116

Query: 125 SAGITEALVIVPF-------ELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVEST 177
           S G+ +A + + F       E+ K +     +  +      K I  ++G+KG+  GV + 
Sbjct: 117 SGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAV 176

Query: 178 VWRNAVWNAGYFGVIFQVRELLPVAKSKQEKTRND--------LCAGFVGGTFGVMFNTP 229
             R        FG+   V + +   +    KT  D        + A  +GG     +N P
Sbjct: 177 AIRQMTNWGSRFGLSRLVEQGI---RDFTGKTNPDDKLTALEKIFASALGGGLSA-WNQP 232

Query: 230 FDVVKSRIQSDGNEIINGVRKYNWTWPSVMK-IYHEEGFRALYKGFVPKVLRLGPGGAVL 288
            +V++  +QS   E  N  R    T  S  K IY   G + LY+G  P++  LG    V 
Sbjct: 233 IEVIRVEMQSK-KEDPN--RPKKLTVGSAFKYIYQSSGIKGLYRGVAPRI-GLGVWQTVF 288

Query: 289 LVVFTNVMNVF 299
           +V F ++   F
Sbjct: 289 MVGFGDIAKEF 299

>AEL060C [2446] [Homologous to NOHBY] (525069..526358) [1290 bp, 429
           aa]
          Length = 429

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 213 LCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYK 272
           +CAGF+ G    + + P D + +R  S  N++++  +KYN  W   +    E G    + 
Sbjct: 160 VCAGFMAGVAQAVASAPIDAIYTR--STANDLLSSAKKYNSLWLYGIDKLKEIGLVGCFG 217

Query: 273 GFVPKVLRLGPGGAVLLVVF 292
           GF   +++   G AV    F
Sbjct: 218 GFGLSLVKESVGFAVYFTTF 237

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/321 (19%), Positives = 121/321 (37%), Gaps = 78/321 (24%)

Query: 18  MAGAIAGISELMVMYPLDVVKTRMQLQVSTGAA--------------------------- 50
           ++GA+A      V+YPLD+VKT +Q Q+                                
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 51  -GASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF 109
              +   Y    D + +I K+EG   +Y+G+++ + M    +   +     F++  K  F
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSV-MAGFFQTFSYFFWYSFVR--KCYF 124

Query: 110 GTKQLTQQIS-------VLSGASAGITEALVIVPFELVKIRLQ-----DVNSKFKGPVEV 157
             K + ++ +       +L G  A  T  +   P  L+  R Q     D ++ F   + V
Sbjct: 125 RVKLINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDF---LTV 181

Query: 158 LKHIIK-QDGLKGLYSGVESTV---------------WRNAVWNAGYFGVIFQVRELLPV 201
            K I K Q  +KG + G++ ++                ++A++      +    +EL  V
Sbjct: 182 AKEIYKEQRSIKGFWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNL---KKEL--V 236

Query: 202 AKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEI--INGVRKYNWTWPSVM 259
             S Q     +   G +      +   P  + K+ +Q +G+       V  Y        
Sbjct: 237 DSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQVLYY-------- 288

Query: 260 KIYHEEGFRALYKGFVPKVLR 280
            +Y  EG R+ +KG  P++ +
Sbjct: 289 -LYKNEGLRSWWKGLSPQLAK 308

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 68/159 (42%), Gaps = 25/159 (15%)

Query: 140 VKIRLQDVNS-KFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF-------GV 191
           V I+L + N  ++    + +  I KQ+G++GLY G+ ++V         YF         
Sbjct: 63  VPIKLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKC 122

Query: 192 IFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQS----DGNEIING 247
            F+V+  L   K+ +  T  +L  G V      +F  P  ++ +R Q+    DG+     
Sbjct: 123 YFRVK--LINRKNTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLT 180

Query: 248 VRKYNWTWPSVMKIYHEE-GFRALYKGF-VPKVLRLGPG 284
           V K         +IY E+   +  +KG  V  +L + P 
Sbjct: 181 VAK---------EIYKEQRSIKGFWKGLKVSLMLTINPS 210

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/150 (20%), Positives = 63/150 (42%), Gaps = 19/150 (12%)

Query: 145 QDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQV-RELLPVAK 203
           + +  ++K  ++V+  + + +G  GLY G+ +++    + +  YF     + R    V K
Sbjct: 81  ESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKK 140

Query: 204 SKQEKTR----NDLCAGFVGGTFGVMFNTPFDVVKSRIQS----DGNEIINGVRKYNWTW 255
            K E  R     +L    +      +F  P ++V ++ Q+    +G+     + K     
Sbjct: 141 VKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAK----- 195

Query: 256 PSVMKIYHEEGFRALYKGF-VPKVLRLGPG 284
               ++Y E+G    +K   V  VL + P 
Sbjct: 196 ----EVYDEDGITGFWKSLKVSLVLTINPS 221

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 60/326 (18%), Positives = 118/326 (36%), Gaps = 78/326 (23%)

Query: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTG----------------AAGAS------- 53
           F+    +G + L V YPLD+ KT +Q Q+  G                + G+S       
Sbjct: 8   FVGAVSSGFANLAV-YPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSKPKKHGI 66

Query: 54  -----------------ATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRAVKFA 96
                               YK  +D + ++ + EG   +Y G+S+ +L    +    F+
Sbjct: 67  QQIKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQ---SFS 123

Query: 97  SNDEFIKLWKSVFGTKQLTQQISVLSGAS-------AGITEALVIVPFELVKIRLQ---- 145
               +  + +  F  K++  + +  S          A  T  L   P  +V  + Q    
Sbjct: 124 YFFWYTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRG 183

Query: 146 -DVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGY----------FGVIFQ 194
            + ++ FK    + K +  +DG+ G +  ++ ++      +  Y          + V + 
Sbjct: 184 LEGDNSFKA---IAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWN 240

Query: 195 VRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWT 254
            ++L     S Q K   +   G +          P  V K+ +Q   +       K+   
Sbjct: 241 AKDL--NDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRSSS-------KFTSF 291

Query: 255 WPSVMKIYHEEGFRALYKGFVPKVLR 280
              +  +Y  EG  AL+KG +P++ +
Sbjct: 292 QEVLTYLYRHEGAHALWKGLLPQLTK 317

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 37/89 (41%), Gaps = 2/89 (2%)

Query: 213 LCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYK 272
           L AGF+ G    + + P D + +R   D  E+++  +KY+  W        E G    + 
Sbjct: 164 LRAGFLAGAAQAIVSAPIDAIYTRANID--ELLSSAKKYDNLWLYSRDKIREIGLIGCFG 221

Query: 273 GFVPKVLRLGPGGAVLLVVFTNVMNVFRE 301
           GF    +R   G A+    F  +    R+
Sbjct: 222 GFGLSFIRESFGFALYFTTFEMIRGPIRQ 250

>Scas_671.1*
          Length = 123

 Score = 30.8 bits (68), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 109 FGTKQLTQQISVLSGASAGITEALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLK 168
           F T   T   SV + ASA +  A +  PF+ +K R+Q     F      L  I K + + 
Sbjct: 33  FSTSTSTVVNSVSAIASASLATA-ITAPFDTIKTRMQLKPKVFTNFFTTLVLITKNESIF 91

Query: 169 GLYSGVESTVWRNAV 183
            L+SG+   + R A+
Sbjct: 92  QLFSGLSMRLTRKAL 106

>Kwal_14.2574
          Length = 443

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 28/55 (50%)

Query: 79  GISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGITEALV 133
            +SSPM+ +      + +  +  +KL+  ++ T+     + V +GA+ GI   LV
Sbjct: 78  ALSSPMVNQYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGANEGILSCLV 132

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,342,599
Number of extensions: 376254
Number of successful extensions: 2843
Number of sequences better than 10.0: 211
Number of HSP's gapped: 1524
Number of HSP's successfully gapped: 578
Length of query: 306
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 205
Effective length of database: 13,099,691
Effective search space: 2685436655
Effective search space used: 2685436655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)