Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_640.231471477791e-108
YOR224C (RPB8)1461476501e-88
CAGL0J04070g1501506259e-85
Sklu_2012.31441495623e-75
KLLA0D07139g1451495293e-70
Kwal_26.86781441495293e-70
ACR111C1441495153e-68
YNL172W (APC1)174856780.020
Kwal_23.598668235613.3
Sklu_2359.258157587.6
KLLA0B06303g1203107588.4
CAGL0A01606g24043578.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_640.23
         (147 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_640.23                                                           304   e-108
YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared su...   254   1e-88
CAGL0J04070g 382116..382568 highly similar to sp|P20436 Saccharo...   245   9e-85
Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement        221   3e-75
KLLA0D07139g complement(611102..611539) similar to sp|P20436 Sac...   208   3e-70
Kwal_26.8678                                                          208   3e-70
ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH] (548897..54...   202   3e-68
YNL172W (APC1) [4426] chr14 (310636..315882) Component of the an...    35   0.020
Kwal_23.5986                                                           28   3.3  
Sklu_2359.2 YER124C, Contig c2359 3062-4807                            27   7.6  
KLLA0B06303g complement(555780..559391) highly similar to sp|P22...    27   8.4  
CAGL0A01606g complement(154500..155222) similar to sp|P53187 Sac...    27   8.6  

>Scas_640.23
          Length = 147

 Score =  304 bits (779), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA
Sbjct: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60

Query: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAVYYSFG 120
           SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAVYYSFG
Sbjct: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAVYYSFG 120

Query: 121 GLLMRLEGNYRNLNTLKQENAYLLIRR 147
           GLLMRLEGNYRNLNTLKQENAYLLIRR
Sbjct: 121 GLLMRLEGNYRNLNTLKQENAYLLIRR 147

>YOR224C (RPB8) [5016] chr15 complement(760825..761265) Shared
           subunit of RNA polymerases I, II, and III (ABC14.5) [441
           bp, 146 aa]
          Length = 146

 Score =  254 bits (650), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 122/147 (82%), Positives = 133/147 (90%), Gaps = 1/147 (0%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MSNTLFDDIF VSEVDPGRYNKVCRIEA STTQ+QCKLTLDIN ELFPV+  D LT+TIA
Sbjct: 1   MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA 60

Query: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAVYYSFG 120
           SSL++E D+ AN  +A RSWRPPQ  +RS+ADDYDYVMYGTAYKFEEV+KD+IAVYYSFG
Sbjct: 61  SSLNLE-DTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFG 119

Query: 121 GLLMRLEGNYRNLNTLKQENAYLLIRR 147
           GLLMRLEGNYRNLN LKQENAYLLIRR
Sbjct: 120 GLLMRLEGNYRNLNNLKQENAYLLIRR 146

>CAGL0J04070g 382116..382568 highly similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8, start by
           similarity
          Length = 150

 Score =  245 bits (625), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 118/150 (78%), Positives = 130/150 (86%), Gaps = 3/150 (2%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MS TLFDDIFT+SEVDPGRYN VCRIEA STTQEQCKLTLDINT LFPV  N+QLT+T+A
Sbjct: 1   MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTNLFPVQVNEQLTVTVA 60

Query: 61  SSLSIESDSNA---NQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAVYY 117
           SSL ++ D  A   +   A RSWRPPQP +RS+ADDYDYVM+GTAYKFEEV+KD+IAVYY
Sbjct: 61  SSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGTAYKFEEVSKDVIAVYY 120

Query: 118 SFGGLLMRLEGNYRNLNTLKQENAYLLIRR 147
           SFGGLLMRLEGNYRNLN LKQE AYLLIRR
Sbjct: 121 SFGGLLMRLEGNYRNLNNLKQETAYLLIRR 150

>Sklu_2012.3 YOR224C, Contig c2012 3508-3942 reverse complement
          Length = 144

 Score =  221 bits (562), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 7/149 (4%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MS TLFDDIF V EVD GRYNKV RIEATST+ EQCKLTLDINT+LFPV  ND LT+ ++
Sbjct: 1   MSTTLFDDIFQVQEVDQGRYNKVSRIEATSTSTEQCKLTLDINTDLFPVHVNDNLTVMLS 60

Query: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118
           S+L+++       + +  SWR PQP +RS+ADDYDYVMYGTAY+FE+V  NKD+IAVYYS
Sbjct: 61  STLNLDG-----HEESSVSWRAPQPGQRSLADDYDYVMYGTAYRFEDVNNNKDVIAVYYS 115

Query: 119 FGGLLMRLEGNYRNLNTLKQENAYLLIRR 147
           FGGLLMRLEGNYRNL+ LKQENAYLL+RR
Sbjct: 116 FGGLLMRLEGNYRNLSNLKQENAYLLVRR 144

>KLLA0D07139g complement(611102..611539) similar to sp|P20436
           Saccharomyces cerevisiae YOR224c RPB8 DNA-directed RNA
           polymerase I, II, III 16 KD subunit singleton, start by
           similarity
          Length = 145

 Score =  208 bits (529), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 101/149 (67%), Positives = 117/149 (78%), Gaps = 6/149 (4%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MS+ LFDD+FTV EVD GRYNKV RIEA ST+QE CKLTLDIN+ELFP+   DQL + I 
Sbjct: 1   MSSALFDDVFTVQEVDTGRYNKVSRIEAQSTSQESCKLTLDINSELFPIKTQDQLAVMIT 60

Query: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118
           +SL +    + +++    SWR P    RS+ADDYDYVMYGTAYKFEEV  NKD++AVYYS
Sbjct: 61  TSLQL----DGSEEPQGTSWRAPPAGTRSLADDYDYVMYGTAYKFEEVKGNKDLLAVYYS 116

Query: 119 FGGLLMRLEGNYRNLNTLKQENAYLLIRR 147
           FGGLLMRLEGNYR LN LKQENAYLL R+
Sbjct: 117 FGGLLMRLEGNYRLLNNLKQENAYLLCRK 145

>Kwal_26.8678
          Length = 144

 Score =  208 bits (529), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 104/149 (69%), Positives = 120/149 (80%), Gaps = 7/149 (4%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MS TLFDD+F V+EVD GRYNKV RIEA ST+QE  +LT+DINTELFPV  ND LT+ ++
Sbjct: 1   MSTTLFDDVFQVTEVDLGRYNKVSRIEAHSTSQE-FQLTVDINTELFPVRVNDNLTVMLS 59

Query: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118
           SSLS++      +     SWR PQP ERS+ADDYDYVMYGTAY+FEEV   KD+IAVYYS
Sbjct: 60  SSLSLDE----TETVQNGSWRAPQPGERSLADDYDYVMYGTAYRFEEVAGKKDLIAVYYS 115

Query: 119 FGGLLMRLEGNYRNLNTLKQENAYLLIRR 147
           FGGLLMRLEGNYR L+ LKQENAYLL+RR
Sbjct: 116 FGGLLMRLEGNYRGLSNLKQENAYLLVRR 144

>ACR111C [1158] [Homologous to ScYOR224C (RPB8) - SH]
           (548897..549331) [435 bp, 144 aa]
          Length = 144

 Score =  202 bits (515), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 118/149 (79%), Gaps = 7/149 (4%)

Query: 1   MSNTLFDDIFTVSEVDPGRYNKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIA 60
           MS+TLFDDIFT+ EVD GRYNKV RIEA ST+Q+ CKLTLD+NTELFP+    QLT+ +A
Sbjct: 1   MSSTLFDDIFTIQEVDQGRYNKVSRIEAISTSQDTCKLTLDVNTELFPLQPQQQLTVMLA 60

Query: 61  SSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEV--NKDIIAVYYS 118
           ++L+++   +++      SWRPP P  RS+ADD+DYV YGTAYKFEE   NKD++AVYYS
Sbjct: 61  TTLNLDGTEDSHG-----SWRPPAPGARSLADDFDYVTYGTAYKFEEANGNKDMLAVYYS 115

Query: 119 FGGLLMRLEGNYRNLNTLKQENAYLLIRR 147
           FGGLLMRLEGNYR L+  KQEN YLL RR
Sbjct: 116 FGGLLMRLEGNYRLLSNFKQENVYLLCRR 144

>YNL172W (APC1) [4426] chr14 (310636..315882) Component of the
            anaphase-promoting complex (APC), required for Clb2p
            degradation and for the metaphase-anaphase transition
            [5247 bp, 1748 aa]
          Length = 1748

 Score = 34.7 bits (78), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 90   IADDYDYVM--YGTAYKFEEVNKDIIAVYYSFGGLLMRLEGNYRNLNTLKQENAYL 143
            I DD  ++M       KF E+N D++ +YY+  G ++ +   + +   LK  N  L
Sbjct: 1301 IGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILL 1356

>Kwal_23.5986
          Length = 682

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 10/35 (28%), Positives = 19/35 (54%)

Query: 77  QRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKD 111
           Q +W PP   +  I ++ DY++   +    E++KD
Sbjct: 61  QGAWNPPTSPQEGIVENSDYMLLARSDGIIEIHKD 95

>Sklu_2359.2 YER124C, Contig c2359 3062-4807
          Length = 581

 Score = 26.9 bits (58), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 59  IASSLSIESDSNANQDAAQRSWRPPQPDERSIADDYDYVMYGTAYKFEEVNKDIIAV 115
           I+  + ++SD+   QD++  +W      + S  D  DY  +GT  K ++  ++++ +
Sbjct: 489 ISVPMDVDSDTTWRQDSSCSTW------DNSSEDTMDYEEFGTPTKLQQQAENVVTL 539

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
           Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
           polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 26.9 bits (58), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 40/107 (37%), Gaps = 24/107 (22%)

Query: 21  NKVCRIEATSTTQEQCKLTLDINTELFPVSNNDQLTITIASSLSIESDSNANQDAAQRSW 80
           NK+ R++   T   +  L  D   + FP   N  + +   +   ++     N+ A     
Sbjct: 738 NKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSA----- 792

Query: 81  RPPQPDERSIADDYDYVMYGTAYKFEEVN-------KDIIAVYYSFG 120
                DER          YGT YK E+VN        D I  ++ FG
Sbjct: 793 -----DERGFG-------YGTMYKVEKVNLSMNRSRGDPITQHFGFG 827

>CAGL0A01606g complement(154500..155222) similar to sp|P53187
           Saccharomyces cerevisiae YGL033w HOP2, hypothetical
           start
          Length = 240

 Score = 26.6 bits (57), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%)

Query: 40  LDINTELFPVSNNDQLTITIASSLSIESDSNANQDAAQRSWRP 82
           L+    LF    ND+L   +A+    E D +A  D  +R+W P
Sbjct: 115 LEKKNALFSEPENDKLLDVLATLRESERDIDAKLDDLERNWDP 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,964,404
Number of extensions: 203803
Number of successful extensions: 714
Number of sequences better than 10.0: 22
Number of HSP's gapped: 702
Number of HSP's successfully gapped: 22
Length of query: 147
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 55
Effective length of database: 13,411,253
Effective search space: 737618915
Effective search space used: 737618915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)