Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_640.211199119953100.0
YOR227W124696923900.0
Scas_700.381239112222640.0
YPL137C1276100922070.0
CAGL0M02607g1204110020960.0
CAGL0J04026g1198100320700.0
ACR113W1102109119710.0
KLLA0D07216g1278108519800.0
Kwal_26.86871088108219360.0
KLLA0E11847g12646676325e-67
Kwal_23.548811126676252e-66
YJL042W (MHP1)13986486166e-65
Scas_690.3314236666079e-64
CAGL0J00803g13144505731e-59
ACR059W12164425239e-54
YLR032W (RAD5)116952760.97
Kwal_56.2415148077704.4
ADL186C136185704.8
Scas_530.630372695.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_640.21
         (1199 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_640.21                                                          2050   0.0  
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...   925   0.0  
Scas_700.38                                                           876   0.0  
YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protei...   854   0.0  
CAGL0M02607g complement(298560..302174) similar to tr|Q03016 Sac...   811   0.0  
CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...   801   0.0  
ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH] co...   763   0.0  
KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058 Sacch...   767   0.0  
Kwal_26.8687                                                          750   0.0  
KLLA0E11847g complement(1044591..1048385) some similarities with...   248   5e-67
Kwal_23.5488                                                          245   2e-66
YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interac...   241   6e-65
Scas_690.33                                                           238   9e-64
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...   225   1e-59
ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH] complement(...   206   9e-54
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    34   0.97 
Kwal_56.24151                                                          32   4.4  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    32   4.8  
Scas_530.6                                                             31   5.0  

>Scas_640.21
          Length = 1199

 Score = 2050 bits (5310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1034/1199 (86%), Positives = 1034/1199 (86%)

Query: 1    MSETNSPKVVTPQXXXXXXXXXXXXXXXXXXXXXWLYKGKRKSRTKXXXXXXXXXXXXXX 60
            MSETNSPKVVTPQ                     WLYKGKRKSRTK              
Sbjct: 1    MSETNSPKVVTPQSPTKKYKPSSIISSDIDVPLDWLYKGKRKSRTKAASLSKTSSHGSST 60

Query: 61   XXIRXXXXXXXXXXXXXXXXXXXXXXXXXDLLPAPTQRRTRSQSITNGMIAQPLPNIKQQ 120
              IR                         DLLPAPTQRRTRSQSITNGMIAQPLPNIKQQ
Sbjct: 61   AKIRSNSSGQSSSSLSPYSSNNKSKSTSNDLLPAPTQRRTRSQSITNGMIAQPLPNIKQQ 120

Query: 121  LEKGPIASLKNDHLXXXXXXXXXXXXXXXXXXXXXPLKRSVSLSEKPKKSLLGSIFGRRL 180
            LEKGPIASLKNDHL                     PLKRSVSLSEKPKKSLLGSIFGRRL
Sbjct: 121  LEKGPIASLKNDHLRSRSSSISGTSSSQISTDDSSPLKRSVSLSEKPKKSLLGSIFGRRL 180

Query: 181  SXXXXXXXXXXXXXXIQTTNINTRHPKSSSSNVNSPLVKKLALTPEESPITIFNKSSKED 240
            S              IQTTNINTRHPKSSSSNVNSPLVKKLALTPEESPITIFNKSSKED
Sbjct: 181  SNQSHNKQKQQQPSPIQTTNINTRHPKSSSSNVNSPLVKKLALTPEESPITIFNKSSKED 240

Query: 241  VDDALLNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGIT 300
            VDDALLNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGIT
Sbjct: 241  VDDALLNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGIT 300

Query: 301  TTDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSS 360
            TTDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSS
Sbjct: 301  TTDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSS 360

Query: 361  SRHRAXXXXXXXXXXXXXXXXXXXXKQNSNELDTKVDVKAKTLSIDKPIHMHQNNFGDDF 420
            SRHRA                    KQNSNELDTKVDVKAKTLSIDKPIHMHQNNFGDDF
Sbjct: 361  SRHRANSLTSSLTKTTSNTSSNPLSKQNSNELDTKVDVKAKTLSIDKPIHMHQNNFGDDF 420

Query: 421  STHNTNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCD 480
            STHNTNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCD
Sbjct: 421  STHNTNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCD 480

Query: 481  FISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDN 540
            FISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDN
Sbjct: 481  FISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDN 540

Query: 541  KSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGI 600
            KSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGI
Sbjct: 541  KSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGI 600

Query: 601  FQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPI 660
            FQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPI
Sbjct: 601  FQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPI 660

Query: 661  IESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDL 720
            IESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDL
Sbjct: 661  IESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDL 720

Query: 721  HKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDT 780
            HKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDT
Sbjct: 721  HKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDT 780

Query: 781  ELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRT 840
            ELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRT
Sbjct: 781  ELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRT 840

Query: 841  MDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRXXXXXXXXXXXXNL 900
            MDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTR            NL
Sbjct: 841  MDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRKYLLKKYLEKLENL 900

Query: 901  HNSVQQTIDSMFEKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSKIPFLSDVFNSTLA 960
            HNSVQQTIDSMFEKRKSGELP                      IFSKIPFLSDVFNSTLA
Sbjct: 901  HNSVQQTIDSMFEKRKSGELPLEEKENLVRLLLLEKNLSNILEIFSKIPFLSDVFNSTLA 960

Query: 961  SSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIMATEAGSVIDT 1020
            SSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIMATEAGSVIDT
Sbjct: 961  SSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIMATEAGSVIDT 1020

Query: 1021 YTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENAVPGXXXXXXXXXXXXX 1080
            YTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENAVPG             
Sbjct: 1021 YTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENAVPGSESSSNLSKESIS 1080

Query: 1081 XQASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRV 1140
             QASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRV
Sbjct: 1081 SQASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRV 1140

Query: 1141 EVESINGDFVPIDCNKKNDTNISRQPTNTSSANEDETVTEKYDEILNNLSNDRSTINKS 1199
            EVESINGDFVPIDCNKKNDTNISRQPTNTSSANEDETVTEKYDEILNNLSNDRSTINKS
Sbjct: 1141 EVESINGDFVPIDCNKKNDTNISRQPTNTSSANEDETVTEKYDEILNNLSNDRSTINKS 1199

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
            function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score =  925 bits (2390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/969 (50%), Positives = 659/969 (68%), Gaps = 45/969 (4%)

Query: 246  LNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNN 305
            L  +S ++L+RV  +V +F  DPPQQLPSRKPK G+VLIP DMIS  P IS+GIT + + 
Sbjct: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNSSDQ 357

Query: 306  SGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRA 365
            S  +  +N  P Y+KDSKEYK+ALE +KK+ KE E+HQ++A   AER+A+EV   + ++A
Sbjct: 358  S--SFQSNISPSYSKDSKEYKLALENFKKAAKEAEKHQKDAYYVAERMAQEV---ANYKA 412

Query: 366  XXXXXXXXXXXXXXXXXXXXKQNSNELDTKVDVKAKTLSIDKPIHMHQNNF---GDD--- 419
                                 Q S+ LD     +A  L IDKPI++  + F    DD   
Sbjct: 413  RQLKTSPLTGATNSAADSATDQESSSLD----ARASKLHIDKPINVGAHPFETHQDDNIK 468

Query: 420  FSTHNTNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFC 479
            +S+H   E TLDV YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP+PTL+DILSFC
Sbjct: 469  YSSHL--EQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFC 526

Query: 480  DFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLID 539
            DFI+I PIH I+FDNV+LT +MF+IV+ S+V S V+EKLGLRNV I+E+ WK+ CKFL+ 
Sbjct: 527  DFIAITPIHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQ 586

Query: 540  NKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLG 599
            NK+LIKLDISQTK R + + S YR+ MDW LFC+VL+ R+G+PLEELLLNG++F+++   
Sbjct: 587  NKTLIKLDISQTKARTDLNDSNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFS 646

Query: 600  IFQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKP 659
             F+++L  FA+MNPK  +RLG+A  + S  C   LF WMS+Y+V+GVDLA+NNL  L K 
Sbjct: 647  HFKNILLTFAQMNPKNPIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKR 706

Query: 660  IIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPD 719
            +I+ L+ L +KHL+YFTLNSTNI+SVDDM+ ++KYLS+LP+++FLDLSNLPQLFP I+  
Sbjct: 707  MIKKLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTS 766

Query: 720  LHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHID 779
             +KY PQFP LKRI+F+ +DL+ +E +M+ +IL KC+ +SHVSL+ Q P   + + + I 
Sbjct: 767  GYKYFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIGQSP---MPDASKIS 823

Query: 780  TELGKDDSNKD------LFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCL 833
                + D +KD      +F R+TLWA+LY+  R S NLVSLD+DYD++ +E++SRIALCL
Sbjct: 824  DSTDEPDKSKDEKKEQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCL 883

Query: 834  MRNMQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRXXXXXXX 893
            M NM+R MDSSF+LDE  +QD+L+FDGSLI+ETA+ VL +LND+S    D  +       
Sbjct: 884  MHNMKRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLNDKSLLQNDVGKKYLLKKY 943

Query: 894  XXXXXNLHNSVQQTIDSMFEKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSKIPFLSD 953
                  +H++VQ TIDSMFEKRKSGELP                      IF+ +P ++D
Sbjct: 944  FEKMEKVHHNVQNTIDSMFEKRKSGELPLQEKENLLRLLLLEKNLSNILDIFASMPNIAD 1003

Query: 954  V--FNSTLASSP-IQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIM 1010
            V  F+    S P I  +  +A  +D +   RP LKHLDS RL++   +P ++++  PH+M
Sbjct: 1004 VVPFSKADNSFPNIGDSTVSANYNDGI---RPSLKHLDSDRLINDVSIPENDSSIRPHLM 1060

Query: 1011 ATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQEN-AVPGXX 1069
            AT++G +ID  TGK +L KSSSNTSL  K+QEEEEGELHKWGVFVQ +  + N  +P   
Sbjct: 1061 ATDSGRIIDVTTGKALLFKSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSA 1120

Query: 1070 XXXXXXXXXXXXQASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKGIASID 1129
                         +    +   +S         PKILPKIP+G +LR+AII AKGI S+D
Sbjct: 1121 NSSRISGSLTPDSSVAGGKKGESS---RTSGTRPKILPKIPTGAELRDAIIKAKGIDSVD 1177

Query: 1130 DLIQNVNEKRVEVESINGDFVPIDCNKKNDTNISRQPTNTSSA-----NEDETVTEKYDE 1184
            DLI+NV  ++V +ES+ GD    + N ++ +N S Q +   +       EDETVT+KYD+
Sbjct: 1178 DLIKNVTSEKVGLESLYGD----ELNSRSPSNDSLQESQQKAPLQRPLVEDETVTKKYDK 1233

Query: 1185 ILNNLSNDR 1193
            +LN+LSN R
Sbjct: 1234 LLNDLSNVR 1242

>Scas_700.38
          Length = 1239

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1122 (46%), Positives = 698/1122 (62%), Gaps = 118/1122 (10%)

Query: 157  LKRSVSLSEKPKKSLLGSIFGRRLSXXXXXXXXXX--XXXXIQTTNI--------NTRHP 206
            +KRS SL+EKPKKSLLGS+FGR+LS                I+TT+           + P
Sbjct: 147  VKRSSSLNEKPKKSLLGSLFGRKLSSSSKTKPTIIPPKLKPIKTTSTVASKLISETLKEP 206

Query: 207  KSSSSNVNS-------PLVKKLALTPEESPITIF-----NKSSKEDVDDALLNTISNISL 254
             S   N+NS       PL    A +P+    +       N+      +   +  +S+I L
Sbjct: 207  NSPDVNMNSQSTIISTPLGDSTASSPQVFQSSSSSSTSSNEKLLHSEEKLAIQKLSSIKL 266

Query: 255  RRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGSTLITNQ 314
            +RV F+VDKF  DP QQLPSR PK G+VL+P+DMISEVP IS+GI      S +T  + +
Sbjct: 267  KRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGI------SANTPQSTK 320

Query: 315  HPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVY----SSSRHRAXXXXX 370
             P ++K+SKEY++ALE  + ++KE E+HQ+EA  AA+RIA EV     +SS  ++     
Sbjct: 321  TPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQKSSIPVT 380

Query: 371  XXXXXXXXXXXXXXXKQNSNELDTKVDVKAKTLSIDKPIHMHQNNFGDDFSTHNTNEVTL 430
                               +EL+ K++      +IDKPIH+H+++F  + ST    EVTL
Sbjct: 381  LLPSTTAA----------DSELNEKIN------NIDKPIHVHEHHFEQEIST---GEVTL 421

Query: 431  DVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHTI 490
            D++YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP+PTLIDILSFCDFISI+PI+TI
Sbjct: 422  DIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINTI 481

Query: 491  VFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDISQ 550
            +FDNV+LTSEMF+I++SS+V S VLEKLGLRNV ID+E+WK+ CKF+++NKS++KLDISQ
Sbjct: 482  IFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDISQ 541

Query: 551  TKIRPESS--ISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHVF 608
            TKIR ES+   + YR NMDW LF  VL+ R GKPLEE+LLNG+KFN IP+ IF+DLLH  
Sbjct: 542  TKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLHSI 601

Query: 609  AKMNPKTNV--RLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESLST 666
            +     T+V  R+GLA SDISL CLK +  W+S  +V+GVDL+FN+LA  +KP++  LS+
Sbjct: 602  SSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLSS 661

Query: 667  LDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYLPQ 726
            L F +L+YFTLN+TNISS  D+AL++KYL KLPNL+FLDLSNLPQ++P+++P ++KYLP+
Sbjct: 662  LTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLPR 721

Query: 727  FPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGKDD 786
            FP LKRI+F+NN+L+++E++++CNIL KC  ++HVS+LSQ    T    +     +G + 
Sbjct: 722  FPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPES 781

Query: 787  SNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRTMDSSFE 846
             ++  F R+ LWATLY+LA+ SPNLV LDIDYD + EE++ RIALCLMRNM R MDS+F+
Sbjct: 782  QSQ--FARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQ 839

Query: 847  LDEALLQDNLLFDGSLISETADTVLNKLN------DESKDDIDPTRXXXXXXXXXXXXNL 900
            LDE   QD+LLFDG+LI+ETA+ VL KLN        S D  D T+             +
Sbjct: 840  LDELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTKRYLLKKYLEKLHRV 899

Query: 901  HNSVQQTIDSMFEKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSKIPFLSDVFNSTLA 960
            H + Q  ID MFEKR SGEL                       I   +P +S V  S   
Sbjct: 900  HFNTQHKIDCMFEKRNSGELTLQEKENLLRLLLLEKNLSNLMEILGALPQVSSVLGSNKE 959

Query: 961  SS--PI--QTNQTTAITDD--EVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIMATEA 1014
             S  P+  Q+ + + +T       V    LKH++S   +   +VP       PH+MAT++
Sbjct: 960  DSMQPVYQQSQEGSTVTSGTSSESVSSVVLKHVESVEPI---VVPPETR---PHLMATDS 1013

Query: 1015 GSVIDTYTGKPVL-HKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQ--QENAVPGXXXX 1071
            G  +D  TGKPVL  + SS+TS+  KKQ EEEGELHKWG FVQQ+     EN V      
Sbjct: 1014 GRTVDVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKET 1073

Query: 1072 XXXXXXXXXXQASPTHRSSPTSLQLEDKTATPKIL-PKIPSGPQLREAIINAKGIASIDD 1130
                       AS +  S+ T       + TP I+ PKIPSG +LR+AII AKGI SIDD
Sbjct: 1074 VNPPTPTTPTTASTSTTSTATHTPTPTTSKTPIIIVPKIPSGTELRKAIIKAKGIDSIDD 1133

Query: 1131 LIQNVNEKRVEVESINGDFVPIDCN-------KKNDTNISR--QPTNTSSAN-------- 1173
            LIQNVN+   E+ +I G  V    N       + + ++I+R    TNT +AN        
Sbjct: 1134 LIQNVNQDEDELINIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHIT 1193

Query: 1174 ----------------ED------ETVTEKYDEILNNLSNDR 1193
                            ED      E +TE YD++LNNLS  R
Sbjct: 1194 LGAKNVSVTTQEIDTSEDNCEKNCEQITEAYDKLLNNLSIKR 1235

>YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protein of
            unknown function, has low similarity to a region of S.
            cerevisiae Mhp1p, which is a microtubule-interacting
            protein that functions in stabilization of microtubules
            [3831 bp, 1276 aa]
          Length = 1276

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1009 (48%), Positives = 653/1009 (64%), Gaps = 75/1009 (7%)

Query: 249  ISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGS 308
            +S +SL+RV F+VDKF  DPPQQLPSR PK G++LIP+DMISEVP ISVGI++++ ++ S
Sbjct: 277  LSTVSLKRVSFAVDKFESDPPQQLPSRTPKKGNILIPDDMISEVPSISVGISSSNQSAKS 336

Query: 309  TLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVY-----SSSRH 363
            T    + P+YTK SKEY +ALE  K +L+E  +HQ+EA  AA RIA EV      S +  
Sbjct: 337  TNSNIKGPLYTKKSKEYILALENQKLALREAAKHQQEAHFAANRIAFEVANFKTASDAGG 396

Query: 364  RAXXXXXXXXXXXXXXXXXXXXKQNSNELDT-KVDVKAKTLSIDKPIHMH--------QN 414
            +                      +   EL+  K+        IDKPIHMH        Q+
Sbjct: 397  KLTEKSSEGTITKQREEVSPPNVEADRELENNKLAENLSKAGIDKPIHMHEHYFKEPDQD 456

Query: 415  NFGDDFSTHNTNEVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLID 474
             + D  S  N NEVTLDVIYTRCCHLREILPIPSTLRQVK KTAPLQ LKFLNP+PTLID
Sbjct: 457  KYQDGHSIEN-NEVTLDVIYTRCCHLREILPIPSTLRQVKDKTAPLQILKFLNPKPTLID 515

Query: 475  ILSFCDFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFC 534
            ILSFCDFI+I PIHTIVFDNVAL  +MFRI++S++VNS VL+KL LRNV ID++ WK+ C
Sbjct: 516  ILSFCDFITIAPIHTIVFDNVALNQDMFRIIISALVNSTVLDKLSLRNVRIDQDGWKLLC 575

Query: 535  KFLIDNKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFN 594
            KFL+ NKSL KLDISQTKI+ + + S YR NMDW+LF  VL +R  KP+EELL NG++F+
Sbjct: 576  KFLLLNKSLNKLDISQTKIKSDLAESLYRHNMDWNLFTDVLSQRSHKPIEELLFNGIQFS 635

Query: 595  RIPLGIFQDLLHVFA--KMNPKTNVRLGLA---VSDISLGCLKILFPWMSKYSVEGVDLA 649
            +IP   F  LL  FA  K  P++ +RLGLA    S+IS  CLK +F WMS+Y+V+GVDLA
Sbjct: 636  KIPYSCFARLLTSFATQKNFPESGIRLGLAGATTSNISQDCLKFIFNWMSQYNVQGVDLA 695

Query: 650  FNNLADLLKPIIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNL 709
            FN+L+ ++KP++  LS L + +L+YF LNSTNIS+  D+ALL+KYLSKLPNL FLDLSNL
Sbjct: 696  FNDLSTMIKPMVGKLSALSYDNLRYFILNSTNISTSYDLALLLKYLSKLPNLIFLDLSNL 755

Query: 710  PQLFPNIIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPP 769
             Q FP+I+P ++KYLP+FP+LKRI+ ++N+LT +E++++CNIL KCK +SHVS+ +Q+  
Sbjct: 756  SQCFPDILPYMYKYLPRFPNLKRIHLDSNNLTLKELAVVCNILIKCKSLSHVSMTNQN-- 813

Query: 770  STLEN---ENHIDTELGKDDSNKDL-----------FNRHTLWATLYSLARSSPNLVSLD 815
              +EN    N  D+ + + +++ DL           F +++  +TLY+ AR SPNL+ LD
Sbjct: 814  --VENFYLMNGTDSPVQQTNTDGDLDSSSTLDVKGQFAKNSFSSTLYAFARDSPNLIGLD 871

Query: 816  IDYDELSEEMRSRIALCLMRNMQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLN 875
             DYD +SEE++SRIALCLMRNM+RTMDS+F+LDE   QD+LLFDGSL++ TA++VL KLN
Sbjct: 872  FDYDLISEEIQSRIALCLMRNMKRTMDSTFQLDELDSQDDLLFDGSLVTMTAESVLEKLN 931

Query: 876  ----DESKDDIDPTRXXXXXXXXXXXXNLHNSVQQTIDSMFEKRKSGELPXXXXXXXXXX 931
                  +K   D T+             LH++VQ TID+MFEKRKSGELP          
Sbjct: 932  LLSDKSTKVKKDTTKRYLLKKYIEKFHILHHNVQHTIDTMFEKRKSGELPLQEKENLVRL 991

Query: 932  XXXXXXXXXXXXIFSKIPFLSDVFNSTLASSPIQTNQTTAITDDEVPVRRPQLKHLDSA- 990
                        +FS  P L+DV    L SS   + ++   ++D    + P LKH++S  
Sbjct: 992  LLLEQNLCNILELFSHNPNLNDV----LGSSRDDSKESVDSSEDS---KLPALKHVESGY 1044

Query: 991  RLLHQAIVPSSEN-TGDPHIMATEAGSVIDTYTGKPVLHK-SSSNTSLFSKKQEEEEGEL 1048
             +  + I P ++  T  PH+MAT++G  ID +TGKP++ K +SS+TS+  KKQEEEEGEL
Sbjct: 1045 HVPEEKIQPENDVITARPHLMATDSGKTIDVFTGKPLVFKHTSSSTSVGCKKQEEEEGEL 1104

Query: 1049 HKWGVFVQQKQ---------QQENAVPGXXXXXXXXXXXXXXQASPTHRSSPTSLQLEDK 1099
            HKWG FVQQ++         +Q     G                S +  ++ T+      
Sbjct: 1105 HKWGFFVQQQRSLYPENESTRQTPFASGDTPINTETAGKSTSSPSVSTSNNETATTSLFS 1164

Query: 1100 TATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVEVESINGD--------FVP 1151
             A PKILPKIPSG  LR AI+ AKGI SIDDLIQNVN   +E+E+I G+        F P
Sbjct: 1165 PANPKILPKIPSGAVLRSAIMKAKGIDSIDDLIQNVNSNNIELENIYGESIQNSASTFTP 1224

Query: 1152 -----IDCNKKNDTNISRQPT-NTSSANEDETVTEKYDEILNNLSNDRS 1194
                 +     +  ++   P  +T   N +  VT  YD++LNNLS +RS
Sbjct: 1225 GVDSDVSAPNTDKGSVETLPAVSTDDPNCEVKVTATYDKLLNNLSMERS 1273

>CAGL0M02607g complement(298560..302174) similar to tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1204

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1100 (44%), Positives = 666/1100 (60%), Gaps = 109/1100 (9%)

Query: 157  LKRSVSLSEKPKK-SLLGSIFGRRLSXXXXXXXX----XXXXXXIQTTNINTRHPK---- 207
            +KRS S S KPKK SL GS+FGR  S                  I T +    +P+    
Sbjct: 144  VKRSASTSSKPKKTSLFGSLFGRSRSSSQSNDTEKKLDTAKRLAISTASEKKTYPQELLT 203

Query: 208  -SSSSNVNSPLVKKLALTPEESPITIFNKSSKEDVDDALLNT------------------ 248
             +S  + NSP       +P+    T   KS+KE       NT                  
Sbjct: 204  PASPVSANSP-------SPDIRRSTSITKSAKEHRARNSDNTTTDKNTHQETQKESGSRE 256

Query: 249  ----ISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTD- 303
                ++ ISL+RVKF+VDKF  DPPQQLPSR PK G+++IP+DMISE+P ISVGIT+   
Sbjct: 257  RPTDLTKISLKRVKFAVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQ 316

Query: 304  -NNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSSR 362
             NN G        P +TKDS EYK ALE ++ +LKE E+HQ+EA  AA RIA EV + S 
Sbjct: 317  KNNLG--------PQFTKDSIEYKRALEIHQIALKEAEKHQQEAHHAARRIAHEVSNFSN 368

Query: 363  HRAXXXXXXXXXXXXXXXXXXXXKQNSNELDTKVDV----KAKTLSIDKPIHMHQNNFGD 418
             +                      QNS   DT +++    K     ID PIHMH+++F D
Sbjct: 369  GK-QASAPGFMLNLVAQSDQSKRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFDD 427

Query: 419  DFSTHNTN-EVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILS 477
              ST   N E+TLDV+YTRCCHLREILPIPSTL+QV  KTAPLQTLKFLNP+PTLIDILS
Sbjct: 428  PGSTLEGNQEITLDVVYTRCCHLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILS 487

Query: 478  FCDFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFL 537
            FCDFI+I+PI TIVFDNV L++EMF+IV+SS+  S+VLEK+ LRNVT+++E W++ CKFL
Sbjct: 488  FCDFIAIVPIQTIVFDNVNLSTEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFL 547

Query: 538  IDNKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKG--KPLEELLLNGVKFNR 595
            + ++SL K+DISQT+I+PE+     R +MDW LF + L +R    +PLEE+L+NGV F+ 
Sbjct: 548  LTSQSLNKIDISQTRIKPETGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDN 607

Query: 596  IPLGIFQDLLHVFAKMNPKTN-VRLGLAVSDISLGCL---KILFPWMSKYSVEGVDLAFN 651
            IPL  FQ+ L  FA     TN +RLGLA +  S+  +   K L  WMS Y+V+GVDL FN
Sbjct: 608  IPLEDFQNFLITFATQKHLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFN 667

Query: 652  NLADLLKPIIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQ 711
            +L++L+KP +  LS+L + +L YFTLNSTNI S +DMALL+K LSKLPNL+FLDLSNLPQ
Sbjct: 668  DLSNLIKPTLGKLSSLTYPNLHYFTLNSTNIQSTNDMALLLKALSKLPNLEFLDLSNLPQ 727

Query: 712  LFPNIIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPST 771
            +FP+I+P ++KYLP+FP LKR++ +N ++TY+E++++CN+L KC  + HVS+LSQ PP +
Sbjct: 728  VFPDILPYMYKYLPRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMS 787

Query: 772  LENENHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIAL 831
             E E+  +     D ++  +F ++   ATLY+  R SPNLV LDIDY  +S+E+ SR+AL
Sbjct: 788  -ETESAENLSTNGDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLAL 846

Query: 832  CLMRNMQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDI----DPTRX 887
            CLMRNM+RTMDSSF+LDE   QD LLFDGSL++ TA  VL +L   +   I    D T+ 
Sbjct: 847  CLMRNMRRTMDSSFQLDELDSQDELLFDGSLVTMTAKDVLERLTQLNTKQIIEKKDATKR 906

Query: 888  XXXXXXXXXXXNLHNSVQQTIDSMFEKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSK 947
                        +HN+VQQTID++FEKRKSG+LP                      IF  
Sbjct: 907  YLLKKYVQKLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDN 966

Query: 948  IPFLSDVFNSTLASSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAI------VPSS 1001
            +P LS+V                 I   +  V  P L+H+     L++        V  +
Sbjct: 967  MPNLSEVLGE------------NKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNEN 1014

Query: 1002 ENTGD-PHIMATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQ 1060
            +N    PH+MATE+G  IDT TG+PV  + SS TSL SKKQEEEEG+ HKWG ++   QQ
Sbjct: 1015 DNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYI---QQ 1071

Query: 1061 QENAVPGXXXXXXXXXXXXXXQASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAII 1120
            Q+   P                ++ T +++  S+  ++K    KI  K+PSGP+LR AII
Sbjct: 1072 QKALYPDGESQYGESSAV----SASTSQTTLPSIDSKEK----KIFTKLPSGPELRTAII 1123

Query: 1121 NAKGIASIDDLIQNVNEKR-VEVESINGDFVPIDCNKKNDTNISRQPTNTSSANEDE--- 1176
             AKG++SI++LIQ +N+    ++ES+       +  K+N+   +   T+ S   ++E   
Sbjct: 1124 KAKGVSSIEELIQKINDYHCCDIESL------YNILKQNELEGNGIVTSESDLTDNEREH 1177

Query: 1177 ---TVTEKYDEILNNLSNDR 1193
                V   Y+++LNN S +R
Sbjct: 1178 LEGAVKNIYEQLLNNASMNR 1197

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
            Saccharomyces cerevisiae YOR227w or tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1003 (44%), Positives = 608/1003 (60%), Gaps = 76/1003 (7%)

Query: 242  DDALLNTISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITT 301
            D   +  ++ I L+RV F++DKF  +P QQLPSRKPK+GD+++P DMISE P ISVGITT
Sbjct: 221  DKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITT 280

Query: 302  TDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSS 361
            T +N  S+    +   Y+KDS+EYK+ LE YK+  KE ER Q EA + AERIA EV +  
Sbjct: 281  TSDNKASSAPKRK---YSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEV-TGY 336

Query: 362  RHRAXXXXXXXXXXXXXXXXXXXXKQNSNELDT----KVDVKAKTLSIDKPIHMHQNNF- 416
            R R+                       ++ +D+     +D +   L+IDKPIH H+  F 
Sbjct: 337  RIRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFE 396

Query: 417  --GDDFSTHNTN----------EVTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 464
              G D ST   N          E+ LDV+YTRCCHLREILPIPSTLRQVKGKTAPLQTLK
Sbjct: 397  TEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLK 456

Query: 465  FLNPRPTLIDILSFCDFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVT 524
            FLNP+PTLIDILSFCDFISI PI  +VFDNVAL S+M +IVLSS++NS  +EKLG+RNV 
Sbjct: 457  FLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVV 516

Query: 525  IDEEDWKIFCKFLIDNKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLE 584
            +  +DW++ CKFL+ NKS+I+LD+SQTKI+P+    CYR NM+W LFC VL+ R G+PLE
Sbjct: 517  LSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE 576

Query: 585  ELLLNGVKFNRIPLGIFQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVE 644
            ELLLNGV F+ +    +QDLL  FA  N   N RLG+A +  S  C+  LF  +S++SV+
Sbjct: 577  ELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSVQ 636

Query: 645  GVDLAFNNLADLLKPIIESLSTLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFL 704
            GVDL FN L   +  II+ LSTL + +L+YFTLNS++ S   ++  L+KYLS+LPNL+FL
Sbjct: 637  GVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLRFL 696

Query: 705  DLSNLPQLFPNIIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLL 764
            D+SN+P++FP++   L+KYLP FPSL+RI+F++N LTY++  M+C ILQKC  ++HVS+ 
Sbjct: 697  DMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHVSMK 756

Query: 765  SQ--HPPSTLENENHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELS 822
            ++  +P +  + E     E G DD +   F   TL ATLY   R    L+ LD+DY ++S
Sbjct: 757  NELTYPEAIKDQEK----EDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDIS 812

Query: 823  EEMRSRIALCLMRNMQRTMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDI 882
            +E++SRIA+ LM NM++T+DS+F  DE   QD+LLFDG +ISE A+ +L++L     D  
Sbjct: 813  DEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTSNLGDQS 872

Query: 883  DPTRXXXXXXXXXXXXNLHNSVQQTIDSMFEKRKSGELPXXXXXXXXXXXXXXXXXXXXX 942
            DPT+            +LH  VQ+ ID MFEKR++G LP                     
Sbjct: 873  DPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKEKENLLRLVLLEKNLSNIM 932

Query: 943  XIFS--------KIPFLSDVFNSTLA----SSPIQTNQTTAITDDEVPVRRPQLKHLDSA 990
             +F+        + P    +  +  A     S  + N +T  +       RP LKHLDS 
Sbjct: 933  QLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNSTNTSH-----IRPFLKHLDSD 987

Query: 991  RLL-----HQAIVPSSENTGDPHIMATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEE 1045
            R+      H    P  + +  PH MATE+G V+D  TGK +L+K+SS+TSL  KKQE EE
Sbjct: 988  RIFGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGKALLYKTSSSTSLLVKKQEHEE 1047

Query: 1046 GELHKWGVFVQQKQQQENAVPGXXXXXXXXXXXXXXQASPTHRSSPTSLQLEDKTATPKI 1105
            GE HKWG FV QK                         +P            ++   PKI
Sbjct: 1048 GEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAP------------ERVTVPKI 1095

Query: 1106 LPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVEVESINGDFVP---------IDCNK 1156
               +PSG +LREAII AKGI SI+DLI+ V++    ++ I G+ +          +D   
Sbjct: 1096 -QTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTS 1154

Query: 1157 KN----DTNISRQPTNTSSANEDETVTEKYDEILNNLSNDRST 1195
            +N    +T  S + T+T S   DE VTEKYDE+LN++S  R++
Sbjct: 1155 RNASEGNTEASGRSTSTDSKT-DELVTEKYDELLNSISQKRTS 1196

>ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH]
            complement(550378..553686) [3309 bp, 1102 aa]
          Length = 1102

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1091 (41%), Positives = 622/1091 (57%), Gaps = 144/1091 (13%)

Query: 157  LKRSVSLSEKPKKSLLGSIFGRRLSXXXXXXXXXXXXXXIQTTNINTRHPKSSSSNVNSP 216
            LKRS S+ E+PKKSL GS+F RRL+                +   + R  +S      + 
Sbjct: 101  LKRSNSVGERPKKSLFGSLFSRRLASSSGVPLSGPPHGARASQRGDARGAESGRQCAPAG 160

Query: 217  LVKKLALTPEESPITIFNKSSKEDVDDAL------------------LNTISNISLRRVK 258
            +    A    +      N+ S  +V DA                   L  +S + LRRV 
Sbjct: 161  IPIGRA---TDGMARYLNEPSSPEVRDAAPINDRPRRMEPGALPVPSLQLLSGVQLRRVA 217

Query: 259  FSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGSTLITNQHPMY 318
            F+VDKF+ DPPQQ+PSR+P+ G+VLIP++++ EVP IS GI+  +   G      +    
Sbjct: 218  FAVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGISNPEGICG-----QKESQL 272

Query: 319  TKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRAXXXXXXXXXXXXX 378
            TKDSKEYKIALE Y+K+LKE ++HQ+EA  AA R A EV +    ++             
Sbjct: 273  TKDSKEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFKYKQS------------- 319

Query: 379  XXXXXXXKQNSNEL--DTKVDVKAKTLSIDKPIHMHQNNF-GDD--FSTHNTNEVTLDVI 433
                     +  EL  +  VD +AK L IDKP   ++ +F G+D      +  E+TLD I
Sbjct: 320  --------HSQRELVPEAAVDDRAKHLEIDKPTQANETSFDGEDTECGDESGKELTLDQI 371

Query: 434  YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHTIVFD 493
            YTRCCHLREILPIPSTL+QVK KTAPL TLKFLNP+PTLID+LSFCDFI+++PIH +VFD
Sbjct: 372  YTRCCHLREILPIPSTLKQVKNKTAPLHTLKFLNPKPTLIDLLSFCDFIAVVPIHNVVFD 431

Query: 494  NVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDISQTKI 553
            NV LT EMF+I+++S+VNS  LE+L +RNV  D + W   CKF++ N+SLIKLDISQTK+
Sbjct: 432  NVNLTPEMFKIMITSLVNSTALERLSIRNVVTDADCWAALCKFILSNRSLIKLDISQTKV 491

Query: 554  RPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHVFAKMNP 613
            R + + + YR NM+W LF +VL+RR+  PLEELLLNG++F    L IF  LLH F  + P
Sbjct: 492  RQDLARTLYRSNMNWPLFIEVLQRRQHAPLEELLLNGIQF--FDLSIFNGLLHAFT-LRP 548

Query: 614  KTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESLSTLDFKHLK 673
             +  RLG+A S +    LK+LF W S Y+V+G+DLAFNNL DL+KP++  L+T++F HL 
Sbjct: 549  ASKKRLGVAHSFLKEEHLKLLFDWASTYNVQGIDLAFNNLTDLVKPMVSKLTTMNFDHLH 608

Query: 674  YFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYLPQFPSLKRI 733
            YFTLNST +   D  AL ++ LSKLPNL FLDLS+LP +FP I P L+KYLP+FP LKR+
Sbjct: 609  YFTLNSTALGFCD-AALCLRALSKLPNLYFLDLSSLPAIFPEIFPFLNKYLPRFPFLKRL 667

Query: 734  YFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGKDDSNKDLFN 793
            + ++ND     IS++  ILQKCK + H+S+L Q P S+                      
Sbjct: 668  HLDSNDFMMDHISLLSQILQKCKELLHLSMLYQ-PESSYG-------------------- 706

Query: 794  RHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRTMDSSFELDEALLQ 853
              +  A LY    +SP L +LD+DY+ + EE+ SRIA+CL+RN Q++++  FELDE   Q
Sbjct: 707  -MSACAALYDFVANSPKLKNLDVDYEYIPEEISSRIAVCLIRNAQKSLNEDFELDELTSQ 765

Query: 854  DNLLFDGSLISETADTVLNKLNDES-KDDIDPTRXXXXXXXXXXXXNLHNSVQQTIDSMF 912
            D+LLFDG LI++TA  +L+KL   S K + D +R             +H +VQ TID +F
Sbjct: 766  DDLLFDGELITKTAGGILSKLGTSSEKSNDDSSRRYLLKKYWQKINRVHTNVQSTIDDLF 825

Query: 913  EKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSKIPFLSDVFNSTLASSPIQTNQTTAI 972
            EKR   EL                          ++ F+ +  +  L          + +
Sbjct: 826  EKRSKDELTLQGKEN-----------------LLRLLFVENTLSKILEILADSQEVASLL 868

Query: 973  TDDEVPVRRPQLKHLDSARLLHQAI-----------VPSSENTGDPHIMATEAGSVIDTY 1021
             D+   +  P L+ +DS+ LL  A            + +S     PH MAT++G  ID  
Sbjct: 869  DDNPEGISAPNLEAVDSSTLLMPATRLEDGYLDTQGISASTQVDRPHFMATDSGRTIDVT 928

Query: 1022 TGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENAVPGXXXXXXXXXXXXXX 1081
            TG+PV+ + SS TS+  KKQEEEEGELHKWG FV QK+   + +P               
Sbjct: 929  TGRPVVLRQSSQTSIVCKKQEEEEGELHKWGYFVAQKR---SGLP-------------LP 972

Query: 1082 QASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVE 1141
            Q    H +     Q ++ T    I+ KIPSG +L+ AII AKGIAS++DLI NVN  RV 
Sbjct: 973  QYVSEHPAQSQPSQADNATDMRVIISKIPSGAELKAAIIKAKGIASMEDLIDNVNHNRVH 1032

Query: 1142 VESING---DFVPIDCNKKNDTNISRQPTNTSSANE---------------DETVTEKYD 1183
            +++I G      P+  ++    ++S Q  +  + NE               DE V E YD
Sbjct: 1033 LDNIYGIPYSTRPVSADR---ASVSSQSRSVCTPNEEPVSAPLPPDGHEELDEHVGETYD 1089

Query: 1184 EILNNLSNDRS 1194
            ++LNNLS  RS
Sbjct: 1090 KLLNNLSRVRS 1100

>KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058
            Saccharomyces cerevisiae YPL137c, start by similarity
          Length = 1278

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1085 (44%), Positives = 630/1085 (58%), Gaps = 146/1085 (13%)

Query: 214  NSPLVKKLALTPEESPITIFNKSSKEDVDDALLNTISNISLRRVKFSVDKFTDDPPQQLP 273
            NSP VK +A  P +    + NK+  +      +  ++ I+L+RV F+VD+F  DPPQQ+P
Sbjct: 233  NSPEVKDMA--PIQHDRVVLNKNPNKSKHPLPIKELTEINLKRVTFAVDEFGMDPPQQIP 290

Query: 274  SRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGSTLITNQH-----PMYTKDSKEYKIA 328
            SRKPKLG+VL+PNDMIS++P IS GITTT   S      +QH       YTKDSKEY++A
Sbjct: 291  SRKPKLGNVLVPNDMISDIPSISQGITTTAQPSSHG--NDQHGALPASAYTKDSKEYQLA 348

Query: 329  LERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRAXXXXXXXXXXXXXXXXXXXXKQN 388
            LE +KK LKE E+HQ+EA  AA+RIA EV       +                       
Sbjct: 349  LENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLKPSTSTDLKPSANGTVPKSGAATDDE 408

Query: 389  SN-ELDTKVDVKAKTLSIDKPIHMHQNNF--------------GDDFST------HNTNE 427
            +N E     D K K+L IDKPIHMH+++F              G + S+       N NE
Sbjct: 409  ANAEAGVVADEKIKSLEIDKPIHMHEHHFKESSGSSNGTGSEHGANPSSTSGTQDENGNE 468

Query: 428  VTLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISIIPI 487
            + LDV+YTRCCHLREILPIPSTLRQ+K K APLQTLKFLNPRPTLIDILSF DFI+I+PI
Sbjct: 469  LMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQTLKFLNPRPTLIDILSFSDFIAIVPI 528

Query: 488  HTIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLD 547
            H +VFDNV L+ EMF+IV+SS+V S  LE+L +RNV  DE  WK+ CKFL+ NKSL KLD
Sbjct: 529  HNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRNVVFDERGWKLLCKFLMRNKSLTKLD 588

Query: 548  ISQTKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHV 607
            ISQTKIR +  +  +R  MDWSLF  VL +R+GKPLEELLLNGV F    L  F+++++ 
Sbjct: 589  ISQTKIRHDLDLKLHRSQMDWSLFIDVLHKRQGKPLEELLLNGVSFAN-NLHTFENMINA 647

Query: 608  FA--KMNPKTNVRLGLAVSDI-SLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESL 664
            F+  K       +LGLA S I S   L+ILF WMS+  + GVDLAFN+  +L KPII+ L
Sbjct: 648  FSSTKNEFSRKRKLGLAQSQIASSEQLEILFRWMSENDIIGVDLAFNDFENLTKPIIKEL 707

Query: 665  STLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYL 724
            S   F  L+YFTLNSTNI SV + AL+I+ LSKLP L FLDLS LP LFP I P L+KYL
Sbjct: 708  SQRSFDSLQYFTLNSTNIQSVQEAALIIRELSKLPKLYFLDLSGLPSLFPAIFPYLNKYL 767

Query: 725  PQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGK 784
            P+FPSLKR++F++N+ TY++IS++  IL KCK + HVS+++Q   S              
Sbjct: 768  PRFPSLKRLHFDSNEWTYKDISLVTQILPKCKELLHVSMMNQPQES-------------- 813

Query: 785  DDSNKDLFNRHTLWAT-----LYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQR 839
                         WA      LY   ++S  L++LD +Y+ + EE+ SRIA+ L+RN Q+
Sbjct: 814  -------------WAMSAAVFLYDCIKNSDKLINLDFNYENIPEEINSRIAIALVRNAQK 860

Query: 840  TMDSSFELDEALLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRXXXXXXXXXXXXN 899
            ++DS+++LDE   QD+LLFDG LISETA  +L+KLND +K   D T+             
Sbjct: 861  SIDSNWQLDELSSQDDLLFDGELISETAGNILDKLNDSAKLQEDSTKRYLLKRYWEKIHT 920

Query: 900  LHNSVQQTIDSMFEKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSKIPFLSDVFNSTL 959
            +H +VQ+TIDSMFE+R S EL                         S  P++ ++     
Sbjct: 921  IHANVQKTIDSMFEQRISKELSLQSKENLLRLIFMENTLGNILEYLSTNPYIQEL---NY 977

Query: 960  ASSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLH---------QAIVPSSE-----NTG 1005
            A +    N +++   DE    RP LKH+DS R+++         Q I    E     N+ 
Sbjct: 978  AKNKDDDNYSSS---DE----RPVLKHVDSERIMYAKPLVDPIDQDIDQELEHEQDSNSA 1030

Query: 1006 DPHIMATEAGSVIDTYTGKPVLHKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQ------ 1059
             PH+MAT++G  ID  TG+P+L K+SS  S+F KKQEEEEGELHKWG FVQQ++      
Sbjct: 1031 KPHLMATDSGRTIDVTTGRPILTKTSSQRSIFGKKQEEEEGELHKWGFFVQQQRSIYPEN 1090

Query: 1060 --------------------QQENAVPGXXXXXXXXXXXXXXQASPTHRSSPTSLQ---- 1095
                                Q    V                 A+PT  + PTS      
Sbjct: 1091 TPMSKYQQQQQHKHAQRKEPQLSQIVEKPREQVQTSQKTGQPAATPTASTPPTSSNSIPA 1150

Query: 1096 LEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVEVESINGDFV--PID 1153
            L    A+ K++ KIPSG +LREAII AKGI SI+DLI NVN ++V++++I G  V  P D
Sbjct: 1151 LSKSAASAKLIGKIPSGTELREAIIKAKGINSIEDLIDNVNCQQVKLDNIYGIQVEPPAD 1210

Query: 1154 C-------NKKNDTNISRQPTNTSSAN-----------EDETVTEK------YDEILNNL 1189
                      + D N+S    +++  N           EDET TE+      YD++LNNL
Sbjct: 1211 AKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQLNVDETYDKLLNNL 1270

Query: 1190 SNDRS 1194
            S  RS
Sbjct: 1271 SRVRS 1275

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%)

Query: 157 LKRSVSLSEKPKKSLLGSIFGRR 179
           L+RS SL EKPKKSL GS+F R+
Sbjct: 123 LRRSSSLGEKPKKSLFGSLFNRK 145

>Kwal_26.8687
          Length = 1088

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1082 (42%), Positives = 631/1082 (58%), Gaps = 113/1082 (10%)

Query: 158  KRSVSLSEKPKKSLLGSIF-------GRRLSXXXXXXXXXXXXXXIQTTNINTRHPK--S 208
            KRS S++EKPKKS+ G++F       G R S                T   +T  P   S
Sbjct: 73   KRSSSVTEKPKKSIFGTLFRRNSHGSGDRPSIPIPLPRARSTTNPSATHAPSTGAPAAHS 132

Query: 209  SSSNVNSPLVKKLA--LTPE---ESPI----TIFNKSSKEDVDDALLNTISNISLRRVKF 259
            ++S +N+ + + L    +PE    +PI     I N++         + +++  SLRRV F
Sbjct: 133  TASGLNATVSQYLKEPSSPEVKDPAPIHDERQILNRNPHRQ--SLPIQSLAKTSLRRVTF 190

Query: 260  SVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGSTLITNQHPMYT 319
            +VDKF+ DPPQQ+PSRKPK G+VL+P DM+   P ISVGIT T  N     I      + 
Sbjct: 191  AVDKFSTDPPQQIPSRKPKRGNVLVPQDMMCPTPSISVGITNTQGN-----IEQSASPFD 245

Query: 320  KDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVY-------SSSRHRAXXXXXXX 372
            ++SKEYK+ALE ++K+L+E E+HQ+EA  AA+RIA EV        S + H+        
Sbjct: 246  ENSKEYKLALEEHRKALRESEKHQQEAHYAAQRIAHEVLKFKTRPLSGAPHQLTASSSNT 305

Query: 373  XXXXXXXXXXXXXKQNSNELDTKVDVKAKTLSIDKPIHMHQNNFGDDFST--HNTNEVTL 430
                            S   +  +D +AK L IDKPIHMH+++F DD S+   N +++TL
Sbjct: 306  NVESSAP---------SGTTNAAIDERAKNLEIDKPIHMHEHHFQDDTSSSAENGDKLTL 356

Query: 431  DVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHTI 490
            D IYTRCCHLREILPIPSTL+QVKGK+APLQTLKFLNPRPTLID+LSFCDFI+I+PIH +
Sbjct: 357  DKIYTRCCHLREILPIPSTLKQVKGKSAPLQTLKFLNPRPTLIDVLSFCDFIAIVPIHNV 416

Query: 491  VFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDISQ 550
            VFDNV+LTSEM + V+SS+V S V+EK+G RNV  + + W + CKFL+   SL+KLDISQ
Sbjct: 417  VFDNVSLTSEMLKNVISSLVTSKVIEKVGFRNVVFNSDTWILLCKFLMRTSSLLKLDISQ 476

Query: 551  TKIRPESSISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHVFAK 610
            TKI+P+   + YR NMDW LF  VL+RR G+PLEELL+NGVK        F  LL+ FA 
Sbjct: 477  TKIKPDLEKNLYRANMDWDLFIDVLQRRSGRPLEELLINGVKIES--FDSFVSLLNTFAA 534

Query: 611  MNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESLSTLDFK 670
             + +   RLG+A S++S   LK L  WMS + ++GVD+AFN+ ++L++P++  LS+L F+
Sbjct: 535  GSTQNGKRLGIAQSELSADHLKFLMSWMSDFKIQGVDMAFNDFSELVRPLVGKLSSLPFQ 594

Query: 671  HLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYLPQFPSL 730
            HL+YFTLN+TNI +  D ALL++ LS+LPNL FLDLSNLPQ+FP I P L+KYLP+  +L
Sbjct: 595  HLQYFTLNNTNIPTAYDAALLLRALSRLPNLYFLDLSNLPQVFPEIFPYLNKYLPRMANL 654

Query: 731  KRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGKDDSNKD 790
            KR++ ++N+ T RE+ MI ++L KC  + H+SL++      +  E+              
Sbjct: 655  KRLHLDSNEFTSREVVMITSVLSKCNELLHLSLMN------IPQESFTT----------- 697

Query: 791  LFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRTMDSSFELDEA 850
                  + A LY   R    L +LD+ Y  + EE+ SRIA+CLMR MQR     FELD+ 
Sbjct: 698  -----GMCANLYDCVRQCSKLTNLDVTYAYIPEEISSRIAICLMRRMQR----DFELDDL 748

Query: 851  LLQDNLLFDGSLISETADTVLNKLNDESKDDIDPTRXXXXXXXXXXXXNLHNSVQQTIDS 910
              QD+LLFDG+L+SETA+ VL KLN+    + D TR             +H++VQ TID 
Sbjct: 749  TNQDDLLFDGTLLSETAENVLEKLNNFEDLETDVTRRYLLKKYWEKFNRVHDNVQSTIDQ 808

Query: 911  MFEKRKSGELPXXXXXXXXXXXXXXXXXXXXXXIFSKIPFLSDVFNSTLASSPIQTNQTT 970
            MFEKR +GEL                       +    P ++DV       + I+ N  +
Sbjct: 809  MFEKRSAGELNLQSKENLLRLLFLENNLSHILDVLKSYPQVADV-------AGIEPNARS 861

Query: 971  AITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGD--PHIMATEAGSVIDTYTGKPVLH 1028
            A +D                  L + I   +EN     PH+MAT++G  ID  TG PVL 
Sbjct: 862  AGSDH-----------------LLKGITSEAENNSHVRPHLMATDSGRTIDVTTGTPVLV 904

Query: 1029 KSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQQENAVPGXXXXXXXXXXXXXXQASPTH- 1087
            K+ S+ SL  K+QEEEEGE HKWG FVQQ+                        AS T  
Sbjct: 905  KTPSHVSLVGKRQEEEEGEFHKWGFFVQQQNSIYPDHHSRNTNDEPPEKRPGSAASSTES 964

Query: 1088 --RSSPTSL-QLEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQNVNEKRVEVES 1144
               S P+++ Q   + A   ++ KIPSG +LREA++ AKGI SI++LI+NVN  RV +++
Sbjct: 965  PKSSQPSAISQTASQAAAHALISKIPSGAELREAVMRAKGIDSIEELIENVNGNRVTLDN 1024

Query: 1145 ING-DFVPIDCNKKNDTN----ISRQPTNTSSANEDETVTEK-------YDEILNNLSND 1192
            I G    P+  +  N +N    IS+    T SA+E  +  E        YD++L++LS  
Sbjct: 1025 IYGVPLHPMPPSTNNSSNKATPISQVLQQTGSASEVSSEDEDEDKVDETYDKLLSSLSKV 1084

Query: 1193 RS 1194
            RS
Sbjct: 1085 RS 1086

>KLLA0E11847g complement(1044591..1048385) some similarities with
            sp|P43638 Saccharomyces cerevisiae YJL042w MHP1
            microtubule-associated protein, hypothetical start
          Length = 1264

 Score =  248 bits (632), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 191/667 (28%), Positives = 323/667 (48%), Gaps = 115/667 (17%)

Query: 236  SSKEDVDDALLNTISNIS-LRRVKFSVDKFTDDPPQQLPSRKPKLGDV------------ 282
            SS+  ++ +++  + N+  L+RV F+ + + +DPPQQ+ SR P+ G+V            
Sbjct: 416  SSEGTINTSVVPGLENLKPLKRVAFAANTYFNDPPQQICSRNPRKGEVEVKADGSVVIHR 475

Query: 283  LIPNDMISEVPPISVGITTTDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERH 342
            L P +    +   S GI      +G   + NQ    T   +    AL+ +          
Sbjct: 476  LTPEEKREILEKSSCGIVV--GGTGQLKLINQDAPATSPDQNEGAALKLHA--------- 524

Query: 343  QEEAQKAAERIAREVYSSSRHRAXXXXXXXXXXXXXXXXXXXXKQNSNELDTKVDVKAKT 402
              E   A++R   E+ ++                            +NE +  V+   + 
Sbjct: 525  --EDDHASQRRHIELAAAEAAAEARAKDAPLDLQRTVT--------NNEEEVGVNNTLEK 574

Query: 403  LSIDKPIHMHQNNFGDDFSTHNTNEVTL-------------------DVIYTRCCHLREI 443
            ++IDKP+   +       ++  +++  L                   DV+YTRCCHLREI
Sbjct: 575  VTIDKPMTSRRKGSSTSLASMISSDSALVPSEDENELLPPRNIKIPHDVVYTRCCHLREI 634

Query: 444  LPIPSTLRQVK-GKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHTIVFDNVALTSEMF 502
            LPIP+T++Q+K G T P+  L+  NP+P+ +++LSF DF+SI P+  +  D V+L+ EM 
Sbjct: 635  LPIPATMKQLKKGSTEPIPFLQLRNPKPSKVEVLSFSDFLSIAPVLCLSLDGVSLSVEML 694

Query: 503  RIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDISQTKI------RPE 556
            RI+LSSI   +  EKL LRN  +D + WK+   F+   KSL  LD++          +P 
Sbjct: 695  RIILSSITYKDKFEKLSLRNTPVDHDGWKVLSYFVSKCKSLNSLDVTMIPGLALNVQKPS 754

Query: 557  SS--------ISCYREN---MDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLL 605
             S        + C  EN   M+WSL    +  + G  LEE++++G   N++ L  F D+ 
Sbjct: 755  KSSNGSTVPRMVCNMENRSDMNWSLLSAAVAAKGG--LEEMIVSGAFMNQVQLQNFIDI- 811

Query: 606  HVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESL- 664
              + K      +RLGLA ++++L   + L  WM+   ++GVD+ +N+L   L P I ++ 
Sbjct: 812  -AWTK-----TLRLGLAYNNLTLEQCQCLATWMTNSKIQGVDVGYNDLNGKLGPFISAVI 865

Query: 665  -STLDFKHL-KYFTLNSTNIS------SVDDMAL-LIKYLSKLPNLQFLDLSNLPQLFPN 715
              T   K++ K+ +LNSTN+S      S D+  L L+  L    +L+FLDLSN P LFP 
Sbjct: 866  EKTKKGKNVFKFLSLNSTNLSVPKGAKSEDNEVLSLLNGLCYCDSLKFLDLSNNPGLFPY 925

Query: 716  IIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENE 775
             +  L   LP F SL R++ +NN+L+   +     +L  C+ I+++SLL           
Sbjct: 926  GMRTLTAILPVFVSLLRLHLDNNNLSTTAVMQFAEVLPMCQRINYISLLG---------- 975

Query: 776  NHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMR 835
                T L    +           + L +  ++S  ++++DIDY  + + ++ +I++  MR
Sbjct: 976  ----TNLNIISA-----------SALAAAVKNSKTIITMDIDYAHVPDRIKEKISVYSMR 1020

Query: 836  NMQRTMD 842
            N QR ++
Sbjct: 1021 NTQRELE 1027

>Kwal_23.5488
          Length = 1112

 Score =  245 bits (625), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 186/667 (27%), Positives = 307/667 (46%), Gaps = 128/667 (19%)

Query: 242 DDALLNTISNIS----LRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPND---MISEVPP 294
           +D +  TI  +      R+V F+ + + +DPPQQ+ S+ P+ G+V +  D   +I  + P
Sbjct: 373 EDGMPQTIPGLEDLKPFRKVSFATNTYFNDPPQQICSKNPRRGEVEVKPDGSVIIHRLTP 432

Query: 295 ---------ISVGITTTDNN-----SGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGE 340
                     S GI    +      S  TL   +     +              ++ +  
Sbjct: 433 EEKREILQKTSTGIVVGGSGHLKLLSDPTLSEEEVKRKEEKKPVNANKCAEQDGTMTDPS 492

Query: 341 RHQEEAQKAAERIAREVYSSSRHRAXXXXXXXXXXXXXXXXXXXXKQNSNELDTKVDVKA 400
             ++ AQKAAE  + +V   S                            NE +  +   A
Sbjct: 493 ASEKAAQKAAESTSEQVNQPS--------------------------GDNEEEVIISKSA 526

Query: 401 KTLSIDKPIHMHQNNFGDDFSTHNTN-----------------EVTLDVIYTRCCHLREI 443
             + IDKP  M         ST                     ++  D++YTRCCHLREI
Sbjct: 527 SEVKIDKP--MISRRSASSLSTMIPAADPEEDDDDNIFPPPGMKIPHDLVYTRCCHLREI 584

Query: 444 LPIPSTLRQVK-GKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHTIVFDNVALTSEMF 502
           LPIP+TL+Q+K G T P+  L+  NP+P+LI++LSF DF+ I P+  +  D V L++ M 
Sbjct: 585 LPIPATLKQLKKGSTDPIPLLQMRNPKPSLIEVLSFSDFLGITPVLCLSLDGVNLSAGML 644

Query: 503 RIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLD------ISQTKIRPE 556
           RI+L S++N    EKL LRN  +D E WKI C F+   KSL  +D      IS    +P 
Sbjct: 645 RIILCSLMNKKQFEKLSLRNTPLDHEGWKILCYFISQCKSLNSIDLTMVPGISINVQKPS 704

Query: 557 SS--------ISCY---RENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLL 605
            S        ++C    R+ M+W+L    L   +G  LEE++++G K +   L  F+D  
Sbjct: 705 KSSQRSRVVRMTCSMTDRKEMNWNLLVASLISVEG--LEEIIISGAKMS---LKEFKD-- 757

Query: 606 HVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESL- 664
             F ++     +RLGLA ++++     +L  W++  +V G+D+ FN+L   L      + 
Sbjct: 758 --FLQLGCTKTLRLGLAYNELTTEQCNVLAGWLAHSNVTGIDIGFNDLRGKLGAFASGII 815

Query: 665 --STLDFKHLKYFTLNSTNISSV-------DDMALLIKYLSKLPNLQFLDLSNLPQLFPN 715
             +       KYF+L+STN+          DD   LI  L    +L+ LD+SN P+LFP 
Sbjct: 816 DRTKSSRNVFKYFSLSSTNLEVSEDSTPENDDFLKLISVLCYCEDLKLLDISNNPKLFPY 875

Query: 716 IIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENE 775
           +   L  Y+P F +L R++ +NN++    +  +  +L  C+ +SHVS+            
Sbjct: 876 VTSHLTNYMPVFVNLLRLHMDNNNIPAPSVVALAEVLPMCQKLSHVSMRG---------- 925

Query: 776 NHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMR 835
             +D   G                 L +  R S +L+++D+D + L  +++ +++L  M+
Sbjct: 926 TKLDYATG---------------CALAAAMRQSSSLLTIDLDAENLPNKIKDKMSLYSMK 970

Query: 836 NMQRTMD 842
           NM++T++
Sbjct: 971 NMEKTLN 977

>YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interacting
            protein, functions in stabilization of microtubules [4197
            bp, 1398 aa]
          Length = 1398

 Score =  241 bits (616), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 189/648 (29%), Positives = 304/648 (46%), Gaps = 114/648 (17%)

Query: 254  LRRVKFSVDKFTDDPPQQLPSRKPKLGDV------------LIPNDMISEVPPISVGITT 301
            L+ V F+ + + +DPPQQ+ S+ P+ G+V            L P +    +   S+G+  
Sbjct: 446  LKHVSFATNTYFNDPPQQICSKNPRKGEVEVKPNGSVVIHRLTPQERKKIMESTSLGVVV 505

Query: 302  TDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSS 361
                +G   + N      +D    K   E   +   E E H EE             +S 
Sbjct: 506  --GGTGQLKLLNPE----EDDANAKSKEEMAPQKQNEVEAHDEEDN-----------NSQ 548

Query: 362  RHRAXXXXXXXXXXXXXXXXXXXXKQ--NSNELDTKVDVKAKTLSIDKPIHMHQNNFGDD 419
            R                       K+   +NE +  V   A  L+IDKP+   +      
Sbjct: 549  RRNIVMAAAEAAAEARAKEAPNELKRIVTNNEEEVTVSKTASHLTIDKPMISRRGASTSS 608

Query: 420  FS------THNTN-------------EVTLDVIYTRCCHLREILPIPSTLRQVK-GKTAP 459
             +      T+ TN             ++  D++YTRCCHLREILPIP+TL+Q+K G T P
Sbjct: 609  LASMVSSDTNGTNADDEGEILPPPSLKIPHDIVYTRCCHLREILPIPATLKQLKKGSTDP 668

Query: 460  LQTLKFLNPRPTLIDILSFCDFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNVLEKLG 519
            +  L+  NPRP++++I SF DF+SI P+  +  D V LT +M RI+LSS+V     +KL 
Sbjct: 669  IPILQLRNPRPSMVEIWSFSDFLSIAPVLCLSLDGVQLTVQMLRIILSSLVYKQHFQKLS 728

Query: 520  LRNVTIDEEDWKIFCKFLIDNKSLIKLDIS-----QTKIRPESS---------ISCYREN 565
            LRN  +DEE WK+ C F+   KSL  +D++     +T ++  S          + C  EN
Sbjct: 729  LRNTPLDEEGWKVLCYFVSKAKSLHSIDLTMVPSIKTNVQKPSKSSLKSKILRMQCNLEN 788

Query: 566  ---MDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHVFAKMNPKTNVRLGLA 622
               M+W L    +    G  LEE++++G K N      F++ + V          RLGLA
Sbjct: 789  RSDMNWDLLTASIALMGG--LEEIVISGAKMNS---AQFKNFILVAC----IATERLGLA 839

Query: 623  VSDISLGCLKILFPWMSKYSVEGVDLAFNN----LADLLKPIIESLSTLDFKHL-KYFTL 677
             + +S      L  WM +  V G+D+ FN+    L+     ++  +   + K++ K+ +L
Sbjct: 840  YNGLSKSQCDDLAKWMVQSKVTGLDVGFNDLNGKLSSFTDAVLGKIQKANEKNVFKFLSL 899

Query: 678  NSTNIS-------SVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYLPQFPSL 730
            N TN+          +++  LI  L  L NL+FLD+SN P +FP+ +P L  +LP F +L
Sbjct: 900  NGTNLRVNEHDTFENNEVLKLISVLCYLENLKFLDISNNPAIFPHCVPTLIDFLPVFVNL 959

Query: 731  KRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGKDDSNKD 790
             R++ + N+L+   + M+  IL  C  +++ S+L               TEL       D
Sbjct: 960  VRLHIDYNNLSSTSVVMLAEILPMCSRLNYFSMLG--------------TEL-------D 998

Query: 791  LFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQ 838
            L +   L   +    R S +L++LD+DY  + E ++ +I+L  +RN+Q
Sbjct: 999  LASSKALAEAV----RKSSSLMTLDVDYVYMPENIKEKISLYALRNIQ 1042

>Scas_690.33
          Length = 1423

 Score =  238 bits (607), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 196/666 (29%), Positives = 319/666 (47%), Gaps = 110/666 (16%)

Query: 254  LRRVKFSVDKFTDDPPQQLPSRKPKLGDV------------LIPNDMISEVPPISVGITT 301
            L+ V FS + + +DPPQQ+ S+ P+ G+V            L P +    +   S GI  
Sbjct: 455  LKHVSFSTNTYFNDPPQQICSKNPRKGEVEVKSNGSVIIHRLTPQERKKILESTSCGIVV 514

Query: 302  TDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQE------EAQKAAERIAR 355
              +     L T Q         E        +K L EG++  E      EA +  +  A 
Sbjct: 515  GGSGQLKLLSTLQEQSAATPGSE-----NINQKLLDEGKKPNETLIVDKEAAEMDDEQAE 569

Query: 356  E---VYSSSRHRAXXXXXXXXXXXXXXXXXXXXKQN--SNELDTKVDVKAKTLSIDKPIH 410
            E   V  S +                       K+   +NE +  V+  A  L+IDKP+ 
Sbjct: 570  EDGNVNDSKKRSLVLAAAEAAAEARAQDAPNELKRTMTNNEEEVTVNKLASHLTIDKPMI 629

Query: 411  MHQNNFG---DDFSTHNTNE------------VTLDVIYTRCCHLREILPIPSTLRQVK- 454
              ++      +  ++ ++ E            +  DV+YTRCCHLREILPIP+TL+Q+K 
Sbjct: 630  SRRSGTSLSLESMTSQDSVESDATVFPSPNLKIPYDVVYTRCCHLREILPIPATLKQLKP 689

Query: 455  GKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHTIVFDNVALTSEMFRIVLSSIVNSNV 514
            G T P+  L+  NPRP++++I SF DF+SI P+  +  D V+LT +M +++L+S+     
Sbjct: 690  GSTDPIPLLQLRNPRPSMVEIWSFSDFLSIAPVSCLSLDGVSLTVDMLKVLLASLSAKRN 749

Query: 515  LEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDIS-----QTKI-RPESS--------IS 560
            LEK+ LRN  +D+E WK+ C F+  ++SL+ +D++     +T + +P  S        + 
Sbjct: 750  LEKISLRNTPLDDEGWKLLCYFISKSRSLVSIDLTMVPHIKTNVQKPSKSSLKSNIIRME 809

Query: 561  C---YRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHVFAKMNPKTNV 617
            C    R   +W+L    +  + G  LEEL+++GVK +   L  F++ + V       +  
Sbjct: 810  CDLDNRTKRNWNLLAGSIAMKGG--LEELVVSGVKMS---LNHFKNFIEVAC----ISTE 860

Query: 618  RLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLK----PIIESLSTLDFKHL- 672
            RLGLA +++S     IL  W+ K  V G+DL FN+L   L      + + + + + K++ 
Sbjct: 861  RLGLAYNNLSKEQCDILAKWLVKSKVTGLDLGFNDLRGKLTTFSDAVWQKIQSNEVKNVF 920

Query: 673  KYFTLNSTNI-------SSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYLP 725
            KY +LN T++       S  +++  L+  L    +L+FLDLSN P+ FP+ +  L K LP
Sbjct: 921  KYLSLNDTSLEVEEGATSETNEVLRLLSILCYSEDLKFLDLSNNPKCFPHCLDTLVKCLP 980

Query: 726  QFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGKD 785
             F +L RI+ +N  LT   I M+   L  C  + H S+L               T L   
Sbjct: 981  VFVNLVRIHLDNEQLTSTNIIMLAEALPLCSRLIHFSMLG--------------TPL--- 1023

Query: 786  DSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQ---RTMD 842
                DL +   L        R S +L++LD++Y  + + ++ +I +  MRNMQ   R ++
Sbjct: 1024 ----DLASCKALAEAF----RRSTSLLTLDVNYVYMPDNIKEKITMYSMRNMQNELRKVN 1075

Query: 843  SSFELD 848
            S  E D
Sbjct: 1076 SENEAD 1081

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
           Saccharomyces cerevisiae YJL042w MHP1, hypothetical
           start
          Length = 1314

 Score =  225 bits (573), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 147/450 (32%), Positives = 236/450 (52%), Gaps = 72/450 (16%)

Query: 431 DVIYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHT 489
           DV+YTRCCHLREILPIP+TL+Q+K G T P+  L+  NPRP+L++I SF DF+SI P+  
Sbjct: 510 DVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISPVLC 569

Query: 490 IVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLI-DNKSLIKLDI 548
           +  D V+LT EM RI+LSS+V++  LEKL +RN  ++E+ WKI   F+    K+ + LD+
Sbjct: 570 VSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFVALDL 629

Query: 549 S-----QTKI-RPESS--------------ISC---YRENMDWSLFCQVLKRRKGKPLEE 585
           +     +T + +P  S              + C    R +M+W L    +  ++G  +EE
Sbjct: 630 TMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATKEGG-IEE 688

Query: 586 LLLNGVKFNRIPLGIFQDLLHVFAKMNPKTNV-RLGLAVSDISLGCLKILFPWMSKYSVE 644
            +L G   +      F +L          TN  RLGLA + +++   K+L  W+   ++ 
Sbjct: 689 FVLAGACMSYTQFKNFIELAC--------TNTDRLGLAYNKLTMEQCKVLAEWIVTSNIR 740

Query: 645 GVDLAFNNLADLLKPIIESLS-----TLDFKHLKYFTLNSTNISSVDD-------MALLI 692
           G+DL FN+L        ++++       +   +KY +LNSTN+S   D       +  L+
Sbjct: 741 GLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVLRLL 800

Query: 693 KYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNIL 752
             L    NL+FLDLSN P++FP+ I  L   LP + +L R++ + NDL    I ++   L
Sbjct: 801 SVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVLAESL 860

Query: 753 QKCKLISHVSLLSQHPPSTLENENHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLV 812
             C  + H+SLL                            N  +  A   ++ +S+  L+
Sbjct: 861 PLCSKLHHLSLLGSK------------------------LNLASAKALTEAVNKSN-TLM 895

Query: 813 SLDIDYDELSEEMRSRIALCLMRNMQRTMD 842
           +LD++Y+ + E ++ R++L  MRN+Q  +D
Sbjct: 896 TLDLEYNTVPESIKERMSLYTMRNIQNELD 925

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 254 LRRVKFSVDKFTDDPPQQLPSRKPKLGDVLI-PNDMI 289
           L+ V F+   + +DPPQQ+ S+ P+ G+V + PN  +
Sbjct: 328 LKHVAFATTTYFNDPPQQICSKNPRKGEVEVKPNGSV 364

>ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH]
           complement(459751..463401) [3651 bp, 1216 aa]
          Length = 1216

 Score =  206 bits (523), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 137/442 (30%), Positives = 223/442 (50%), Gaps = 62/442 (14%)

Query: 431 DVIYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIHT 489
           D++YTRCC+LREILPIP+ L+Q+K G + P+  L+  NP+P++I+ILS  DF+SI P+  
Sbjct: 475 DMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLLQLRNPKPSMIEILSLGDFLSIAPVLC 534

Query: 490 IVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDIS 549
              D V+L+ +M  I+LSS+     LEKL +RN  +DEE WK    F+  +K+L  LD++
Sbjct: 535 FSMDGVSLSVQMLHIILSSLRCMGRLEKLSMRNTPLDEEGWKTLAYFISSSKTLRGLDLT 594

Query: 550 QTKIRP-------ESSISC----------YRENMDWSLFCQVLKRRKGKPLEELLLNGVK 592
                P       +SS  C           R   +W+LF   +       LEEL+++G K
Sbjct: 595 MIPGIPLNVQKPSKSSGQCSIPRMKCDLTSRAEQNWNLFTAAIAINGN--LEELIISGAK 652

Query: 593 FNRIPLGIFQDLLHVFAKMNPKTNVRLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNN 652
              I LG F+ LL +       +  RLGLA +D+S G  + L  W+    V G+D+ FN 
Sbjct: 653 ---ISLGQFKILLDIGC----HSLERLGLAFNDLSHGHCEALASWLPGCKVTGLDIGFNP 705

Query: 653 LADLLKPIIESL---STLDFKHLKYFTLNSTNIS-------SVDDMALLIKYLSKLPNLQ 702
           L   ++P+ E+L   S +    +   +LNST+++          D+  L+  L    NL+
Sbjct: 706 LNGKMRPLAEALMRKSKVGNNSIACISLNSTDLAIPPNATVETSDVVALLSALGYCENLK 765

Query: 703 FLDLSNLPQLFPNIIPDLHKYLPQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVS 762
           FL LSN P +F   +  L   LP      R+  + N+L+   I  +  +L  C  I ++S
Sbjct: 766 FLPLSNNPNMFIYGMKPLTDILPVLVGFARLQLDYNNLSSTSIITLAEVLPMCTTIGYLS 825

Query: 763 LLSQHPPSTLENENHIDTELGKDDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELS 822
           L+           + +DT  G               A L    + S +L ++D D+ E+ 
Sbjct: 826 LVG----------SKLDTSSG---------------AALVLALKKSGSLFTIDADFSEMP 860

Query: 823 EEMRSRIALCLMRNMQRTMDSS 844
           + +R  +++  ++N++  ++ S
Sbjct: 861 DAIRHDVSIYSLKNLENVLELS 882

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 254 LRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPND 287
           L+RV F+ + + + PPQQ+ SR P+ G+V +  D
Sbjct: 335 LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKAD 368

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
           DNA-dependent ATPase of the Snf2p family of DNA
           helicases, member of the RAD6 epistasis group, involved
           in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 575 LKRRKGKPLEELLLNGVKFNRIPLGIFQDLLHVFAKMNPKTNVRLGLAVSDI 626
           +K + GKPL EL    V   R+P    QDLL+ F     + +V+ G+A  D+
Sbjct: 773 MKDKDGKPLVELPPKEVVIKRLPFSKSQDLLYKFLLDKAEVSVKSGIARGDL 824

>Kwal_56.24151
          Length = 480

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 520 LRNVTIDEEDWKIFCKFLIDNKSLIKLDISQTKIRPESSISCYRENMDWSLFCQVLKRRK 579
           L+++ +  +D K+ CK+ +DN  + +L I+  ++  +    C   +  +S  C + K+  
Sbjct: 383 LQSLFLTRKDNKLCCKYHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLL 442

Query: 580 GKPLEELLLNGVKFNRI 596
            K LE   LN + F  +
Sbjct: 443 TK-LEIAFLNCINFEGL 458

>ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407)
           [4086 bp, 1361 aa]
          Length = 1361

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 621 LAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESLSTLDFKHLKYFT---- 676
           L +S    GC+K+       Y V   DL FN+ +D ++  ++ + T DF  L   T    
Sbjct: 246 LLISGGQDGCIKVWDLRSHSYKVNRSDLNFNSGSDSVRD-VKWMPTYDFASLGADTSLCS 304

Query: 677 -LNSTNISSVDDMALLIKYLSKLPN 700
              S   +SV D  LL+ +  + PN
Sbjct: 305 SGRSNKFASVHDSGLLLTFDMRQPN 329

>Scas_530.6
          Length = 303

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 3/72 (4%)

Query: 292 VPPISVGITTTDNNSGSTLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAE 351
           +P  +     T NN GS  + ++   Y   SKE    L   KK + E ER ++E  K AE
Sbjct: 81  IPTNTTKAQATPNNEGSAPLLSKWSSYALPSKE---VLAEQKKIVAEKERMEQERLKEAE 137

Query: 352 RIAREVYSSSRH 363
           R+  +  S ++ 
Sbjct: 138 RVVAQARSDTQE 149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,702,776
Number of extensions: 1592300
Number of successful extensions: 5261
Number of sequences better than 10.0: 39
Number of HSP's gapped: 5352
Number of HSP's successfully gapped: 51
Length of query: 1199
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1086
Effective length of database: 12,684,275
Effective search space: 13775122650
Effective search space used: 13775122650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)