Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_640.2030230214080.0
CAGL0J04004g2882604714e-57
YOR228C3023154342e-51
Kwal_26.86942882634035e-47
KLLA0D07238g2832233252e-35
ACR114C2342072881e-30
Sklu_2427.946194672.0
CAGL0J10736g38678662.2
YAL062W (GDH3)45765653.2
YOR375C (GDH1)45491643.8
Scas_702.40131967645.0
Kwal_27.12200444113627.9
CAGL0L07216g85843629.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_640.20
         (302 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_640.20                                                           546   0.0  
CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces c...   186   4e-57
YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protei...   171   2e-51
Kwal_26.8694                                                          159   5e-47
KLLA0D07238g complement(618435..619286) weakly similar to sgd|S0...   129   2e-35
ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [...   115   1e-30
Sklu_2427.9 YOR375C, Contig c2427 21295-22680 reverse complement       30   2.0  
CAGL0J10736g 1046008..1047168 similar to sp|P38796 Saccharomyces...    30   2.2  
YAL062W (GDH3) [8] chr1 (31568..32941) Glutamate dehydrogenase (...    30   3.2  
YOR375C (GDH1) [5150] chr15 complement(1041674..1043038) Glutama...    29   3.8  
Scas_702.40                                                            29   5.0  
Kwal_27.12200                                                          28   7.9  
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...    28   9.5  

>Scas_640.20
          Length = 302

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/302 (91%), Positives = 277/302 (91%)

Query: 1   MQIKEVAPEPILPESVELTXXXXXXXXXXXKNVFSNRNLIKALKGFQKYSVWPMLLYFPV 60
           MQIKEVAPEPILPESVELT           KNVFSNRNLIKALKGFQKYSVWPMLLYFPV
Sbjct: 1   MQIKEVAPEPILPESVELTPESSSPFFPESKNVFSNRNLIKALKGFQKYSVWPMLLYFPV 60

Query: 61  HSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQ 120
           HSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQ
Sbjct: 61  HSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQ 120

Query: 121 RRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLIVSGY 180
           RRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLIVSGY
Sbjct: 121 RRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLIVSGY 180

Query: 181 LLTPFLLYHVIIMRWGLVNPESKGFTFVDWLLTNSDWWIRVVGGIIPLSVLIVSGTYHIG 240
           LLTPFLLYHVIIMRWGLVNPESKGFTFVDWLLTNSDWWIRVVGGIIPLSVLIVSGTYHIG
Sbjct: 181 LLTPFLLYHVIIMRWGLVNPESKGFTFVDWLLTNSDWWIRVVGGIIPLSVLIVSGTYHIG 240

Query: 241 AGICKYLKIKDVNKRKKWAXXXXXXXXXXXXXXFRLSMIEHSGIPLKLEEHFTKIFKILN 300
           AGICKYLKIKDVNKRKKWA              FRLSMIEHSGIPLKLEEHFTKIFKILN
Sbjct: 241 AGICKYLKIKDVNKRKKWAGGITLLSITGLISIFRLSMIEHSGIPLKLEEHFTKIFKILN 300

Query: 301 LK 302
           LK
Sbjct: 301 LK 302

>CAGL0J04004g 375642..376508 similar to tr|Q12106 Saccharomyces
           cerevisiae YOR228c, hypothetical start
          Length = 288

 Score =  186 bits (471), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/260 (42%), Positives = 145/260 (55%), Gaps = 25/260 (9%)

Query: 2   QIKEVAPEPILPESVELTXXXXXXXXXXXKNVFSNRNLIKALKGFQKYSVWPMLLYFPVH 61
            +KEV+P P+ P+   ++               S   ++ AL   Q+ S+ PM LYFPVH
Sbjct: 4   NLKEVSPTPLKPDERPISYNPRKILGIE----VSTTTVVHALFKLQRLSIVPMALYFPVH 59

Query: 62  SINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQR 121
           ++NT   PL+ P   P   LT + +  P   S+ILI SL+ HIASGVLLR   W  +   
Sbjct: 60  AVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIASGVLLR--GWKLYKSH 117

Query: 122 RMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLIVSGYL 181
            + E       +HL+H           SQ  IGLTGGI GY  G  K+F  SPL +SGY+
Sbjct: 118 VLKE------KYHLHHQHKH-----TTSQDDIGLTGGISGYLFGIYKQFTLSPLSMSGYV 166

Query: 182 LTPFLLYHVIIMRWGLVNPES-----KGFTFVDWLLTNSDWWIRVVGGIIPLSVLIVSGT 236
           LTP +LYH++IM+W    PES      GF FV  LL  S+WWIR   GIIPLS LI + +
Sbjct: 167 LTPLVLYHLLIMKW---VPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAAS 223

Query: 237 YHIGAGICKYLKIKDVNKRK 256
           YHI AG C+ L +KD+ KRK
Sbjct: 224 YHIVAGACRLLDVKDMKKRK 243

>YOR228C (YOR228C) [5019] chr15 complement(766869..767777) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.5264p [909 bp, 302 aa]
          Length = 302

 Score =  171 bits (434), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 167/315 (53%), Gaps = 27/315 (8%)

Query: 1   MQIKEVAPEPI----LPESVELTXXXXXXXXXXXKNVF------SNRNLIKALKGFQKYS 50
           +++ EV PEP+    LP  V              K +F      S  +  + L   QK S
Sbjct: 2   IKLHEVPPEPVDPASLPHDVNAHSPEGDGNPDKRKKIFGIPYPFSRSSCRRFLWNCQKIS 61

Query: 51  VWPMLLYFPVHSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLL 110
           V PM LYFP+H+ NT   P + P+  P  VL ++RE  P   +++L+  + +H+++GVLL
Sbjct: 62  VLPMALYFPLHAANTLITPAVSPDSAPDDVLMMVREILPSITTKLLVAGITLHVSAGVLL 121

Query: 111 R-VSHWLYHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKK 169
           R V++W    + R           HL   A Q     D+SQ SIGLTGGI GY  G  K 
Sbjct: 122 RIVNNWNKPRRNR---------HRHLKISAEQ-----DLSQDSIGLTGGISGYLFGLYKT 167

Query: 170 FKHSPLIVSGYLLTPFLLYHVIIMRWGLVNPESK-GFTFVDWLLTNSDWWIRVVGGIIPL 228
           F+  P ++SGY+L P L+YH++IM+W   +  ++  F  +  LL++ + W + +GG++PL
Sbjct: 168 FRIPPQVISGYILVPVLIYHLLIMKWVPNSISTEVDFASIKQLLSSKNRWWKWLGGLVPL 227

Query: 229 SVLIVSGTYHIGAGICKYLKIKDVNKRKKWAXXXXXXXXXXXXXXFRLSMIEHSGI-PLK 287
           ++L+ SG YHIG+G+C+Y  ++ +  RKKW+               RL   + + + P +
Sbjct: 228 AILLESGVYHIGSGLCRYFGVRKMTSRKKWSTAINLLTLVGFVSLIRLMKEDSTKLGPNQ 287

Query: 288 LEEHFTKIFKILNLK 302
            E  F KI  +L++ 
Sbjct: 288 FESIFKKIRLLLHVN 302

>Kwal_26.8694
          Length = 288

 Score =  159 bits (403), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 139/263 (52%), Gaps = 28/263 (10%)

Query: 1   MQIKEVAPEPILP----ESVELTXXXXXXXXXXXKNVFSNRNLIK-ALKGFQKYSVWPML 55
           +++KEV PEPI      E +E                F N   ++ +L+  QK++VWP+ 
Sbjct: 5   IELKEVTPEPIRNYRPLEGIEKPSGVLS---------FLNARFVRLSLRRIQKHAVWPLA 55

Query: 56  LYFPVHSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHW 115
           +YFP+H++NT  +P I     P  +L +IRE  P F SR+L  S+  H+ASG  LR+   
Sbjct: 56  VYFPLHALNTLVVPAISTESAPNDILMMIREVLPGFTSRLLTWSITAHVASGFALRIWSL 115

Query: 116 LYHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPL 175
              + +    G     D             E  SQ  IGL GG+ GYF+G  K+  ++P 
Sbjct: 116 ASRWTKLKKRGRSIPQDQK-----------ERESQRQIGLIGGLSGYFIGVSKQLAYNPQ 164

Query: 176 IVSGYLLTPFLLYHVIIMRWGLVNPE--SKGFTFVDWLLTNSDWWIRVVGGIIPLSVLIV 233
           +VSGY+L P + YH  +M+  +   E     F FV W+L N   WI+  GGIIPLS+LI 
Sbjct: 165 VVSGYILLPIIWYHARLMK-KIPTAEDIDIDFDFVKWVLQNDSVWIKWFGGIIPLSILIW 223

Query: 234 SGTYHIGAGICKYLKIKDVNKRK 256
           + +YHI AG C Y KI+ ++ RK
Sbjct: 224 TASYHIVAGFCTYAKIRRLDVRK 246

>KLLA0D07238g complement(618435..619286) weakly similar to
           sgd|S0005754 Saccharomyces cerevisiae YOR228c, start by
           similarity
          Length = 283

 Score =  129 bits (325), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 127/223 (56%), Gaps = 18/223 (8%)

Query: 38  NLIKALKGFQKYSVWPMLLYFPVHSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILI 97
           N+ K L+  QK+S++P++ YFP+H IN   IP ++P+  P   L ++RE +    S+++ 
Sbjct: 35  NIKKWLRWTQKWSLFPLVTYFPLHGINALIIPALEPSSFPNDALMMVRELTSGLGSKLIW 94

Query: 98  GSLVIHIASGVLLRVSHWLYHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTG 157
             + IHI SG  LR+        R++    ++       H+A  LL ++ ++Q  IGL G
Sbjct: 95  TGISIHILSGFALRI-------MRKLPTSSKT-------HNAESLLDTQSLAQSRIGLVG 140

Query: 158 GIVGYFLGWRKKFKHSPLIVSGYLLTPFLLYHVIIMRWGLVNPE--SKGFTFVDWLLT-N 214
           G+ GYF+G ++  +++P  ++G+LLTP L +H  +M+W L N       F FV WLL  +
Sbjct: 141 GLSGYFIGIKRNLQYNPQELTGWLLTPVLFFHGALMKW-LPNTAKVDIDFDFVKWLLDKD 199

Query: 215 SDWWIRVVGGIIPLSVLIVSGTYHIGAGICKYLKIKDVNKRKK 257
               +R+  G  PL  LI  G+YHI AG  +Y+ ++ +  RK+
Sbjct: 200 RGALVRIGLGYGPLVALIGLGSYHIIAGTVQYMHVRSLKTRKR 242

>ACR114C [1161] [Homologous to ScYOR228C - SH] (553753..554457) [705
           bp, 234 aa]
          Length = 234

 Score =  115 bits (288), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 100/207 (48%), Gaps = 23/207 (11%)

Query: 57  YFPVHSINTFGIPLIQPNKLPGRVLTIIREKSPLFLSRILIGSLVIHIASGVLLRVSHWL 116
           Y P+H  NT  +PLI+P   P  VL ++RE  P    ++L+ ++ +H+A+GV LR     
Sbjct: 5   YMPLHLTNTLFVPLIEPTYAPNDVLRMVRELLPAATDQVLVWTVGVHVAAGVALR----- 59

Query: 117 YHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHSPLI 176
                                      V  D S   IGL GG+ GYFLG  K  +H+P  
Sbjct: 60  ---------AMSWYRRWTRRGRRYVTRVESDTSPRRIGLIGGLSGYFLGLNKTVRHNPHA 110

Query: 177 VSGYLLTPFLLYHVIIMRWGLVNPESKG----FTFVDWLL--TNSDWWIRVVGGIIPLSV 230
           VSGYLL P L YH  +M+W    P   G    F FV WLL       W R   GI+PL+ 
Sbjct: 111 VSGYLLVPLLAYHAALMKW---LPARAGVDVDFDFVQWLLYGGTGSAWTRWGLGIMPLAG 167

Query: 231 LIVSGTYHIGAGICKYLKIKDVNKRKK 257
           L+  G YH+  G+ + L+ + +  R+K
Sbjct: 168 LVSVGAYHMFTGLVQLLRWRSLALRRK 194

>Sklu_2427.9 YOR375C, Contig c2427 21295-22680 reverse complement
          Length = 461

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 21/94 (22%)

Query: 130 EADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHS-PLIVSGYLLTPFLLY 188
           E   H+  D        D+  G IG+ G  VGY  G  K +K+S   +++G  L      
Sbjct: 138 ELSRHIGQDT-------DVPAGDIGVGGREVGYLFGAYKTYKNSWEGVLTGKGLN----- 185

Query: 189 HVIIMRWG--LVNPESKGFTFVDWLLTNSDWWIR 220
                 WG  L+ PE+ G+  + +     D+  +
Sbjct: 186 ------WGGSLIRPEATGYGLIYYTQAMIDYATK 213

>CAGL0J10736g 1046008..1047168 similar to sp|P38796 Saccharomyces
           cerevisiae YHR075c PPE1, start by similarity
          Length = 386

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 76  LPGRVLTIIREKSPLFLSRILIG----SLVIHIASGVLLRVSHWLYHFQRRMGEGEESEA 131
           L G + T    K  + L + +IG     +V   A+  L +V+H+L      M  G E   
Sbjct: 195 LGGSICTFTYSKLSIELKKQVIGVAMFDIVEEAATLALEKVNHFL-QVTPNMFSGYEEAI 253

Query: 132 DHHLNHDASQLLVSEDIS 149
           D H++H+ S+L  S DI+
Sbjct: 254 DWHVSHELSRLRESADIA 271

>YAL062W (GDH3) [8] chr1 (31568..32941) Glutamate dehydrogenase
           (NADP+), combines ammonia and alpha-ketoglutarate to
           form glutamate [1374 bp, 457 aa]
          Length = 457

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 14/65 (21%)

Query: 147 DISQGSIGLTGGIVGYFLGWRKKFKHS-PLIVSGYLLTPFLLYHVIIMRWG--LVNPESK 203
           D+  G IG+ G  +GY  G  + +K+S   +++G  L            WG  L+ PE+ 
Sbjct: 146 DVPAGDIGVGGREIGYLFGAYRSYKNSWEGVLTGKGLN-----------WGGSLIRPEAT 194

Query: 204 GFTFV 208
           GF  V
Sbjct: 195 GFGLV 199

>YOR375C (GDH1) [5150] chr15 complement(1041674..1043038) Glutamate
           dehydrogenase (NADP+), combines ammonia and
           alpha-ketoglutarate to form glutamate, reaction is not
           ATP-driven [1365 bp, 454 aa]
          Length = 454

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 21/91 (23%)

Query: 130 EADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRKKFKHS-PLIVSGYLLTPFLLY 188
           E   H+  D        D+  G IG+ G  +GY  G  + +K+S   +++G  L      
Sbjct: 135 ELSRHIGQDT-------DVPAGDIGVGGREIGYLFGAYRSYKNSWEGVLTGKGLN----- 182

Query: 189 HVIIMRWG--LVNPESKGFTFVDWLLTNSDW 217
                 WG  L+ PE+ G+  V +     D+
Sbjct: 183 ------WGGSLIRPEATGYGLVYYTQAMIDY 207

>Scas_702.40
          Length = 1319

 Score = 29.3 bits (64), Expect = 5.0,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 14/67 (20%)

Query: 168 KKFKHSPLIVSGYLLTP--FLLYHVIIMRWGLVNPESKGFTFVDWLLTNSDWWIRVVGGI 225
           KKF H PL+++   L P  + +  +++ R GL + +SK F            WI ++  I
Sbjct: 751 KKFLHGPLLIALPHLLPWCYFIISILLKREGLTHEDSKIF------------WIGILKTI 798

Query: 226 IPLSVLI 232
            P + +I
Sbjct: 799 FPWNDII 805

>Kwal_27.12200
          Length = 444

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 47/113 (41%), Gaps = 17/113 (15%)

Query: 109 LLRVSHWLYHFQRRMGEGEESEADHHLNHDASQLLVSEDISQGSIGLTGGIVGYFLGWRK 168
           LL   HW YH         +      L ++   + +++ +S+   GL+          + 
Sbjct: 5   LLNPFHWGYHGTIEQVSNPQGTVQLKLKNNQDSVALNDFVSREVSGLSN---------KS 55

Query: 169 KFKHSPLIVSGYLLTPFL-------LYHVIIMRWGLVNPESKGFTFVDWLLTN 214
           KF+ +PL+ +GYL T +L        ++V   R   V    +G    DW++ N
Sbjct: 56  KFEVNPLLFTGYLQTLYLGGADFSKSFNVYYGR-ETVKFSDEGICTADWVMRN 107

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score = 28.5 bits (62), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 87  KSPLFLSRILIGSLVIHIASGVLLRVSHWLYHFQRRMGEGEES 129
           KSP  + +  IG LV+ +   +LL V+ +  HFQ  + +G  S
Sbjct: 272 KSPCTIVKAAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGS 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.143    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,297,240
Number of extensions: 380563
Number of successful extensions: 952
Number of sequences better than 10.0: 16
Number of HSP's gapped: 947
Number of HSP's successfully gapped: 16
Length of query: 302
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 201
Effective length of database: 13,099,691
Effective search space: 2633037891
Effective search space used: 2633037891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 61 (28.1 bits)