Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_638.81881889931e-139
YGL018C (JAC1)1841875991e-79
CAGL0A00297g1981865367e-70
Sklu_1768.31851874973e-64
KLLA0A04840g1981714542e-57
AGR164C2001664352e-54
Kwal_47.174511861884305e-54
CAGL0J02750g38270850.004
Scas_715.2938770840.005
CAGL0L12276g45261800.017
Scas_564.1*45753790.023
AGL339C43075780.032
CAGL0I09526g29646770.035
CAGL0J10296g47949780.039
AFR659W27368750.063
KLLA0C07260g36858740.098
Sklu_2257.642970740.10
Kwal_26.949542889740.12
YNL227C59071740.13
Sklu_2174.639370730.13
KLLA0F19184g51274710.27
KLLA0E24552g79332710.31
KLLA0E04345g428103700.32
YER048C (CAJ1)39170700.33
CAGL0J07370g62371700.36
CAGL0J01936g42570700.38
Sklu_2109.465859700.40
Scas_709.341470690.43
YMR214W (SCJ1)37758690.47
Sklu_2292.443289690.49
ADL111W578104690.51
CAGL0F03729g36152680.52
ADL327W30558670.83
YNL064C (YDJ1)40970670.83
Kwal_26.887965654670.87
YLR090W (XDJ1)45956670.91
Sklu_1262.128342660.97
KLLA0B08459g295129661.0
Kwal_23.442059289661.0
YNL077W (APJ1)52848661.2
Kwal_47.1813339346661.2
Kwal_23.306145846651.4
Kwal_55.2096542170651.5
Sklu_2422.1067847651.6
Scas_532.261649641.9
AAL103W66954642.0
Sklu_2442.134852632.7
CAGL0D01584g30070623.0
Scas_692.3437548623.1
ADR015W43670623.1
YIR004W (DJP1)43270615.0
YGL128C (CWC23)28383605.3
AGR084C42755606.6
Kwal_56.2378241452606.9
KLLA0C09823g66953606.9
Scas_695.1432752597.2
Kwal_14.113628651597.5
YOR254C (SEC63)66359607.8
AAR027W31633598.0
YDL231C (BRE4)1125103598.3
AGL252W79542598.5
Scas_542.228046598.7
Sklu_1617.316557588.8
YMR161W (HLJ1)22458589.0
AER346W36770589.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_638.8
         (188 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_638.8                                                            387   e-139
YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type cha...   235   1e-79
CAGL0A00297g complement(30179..30775) similar to sp|P53193 Sacch...   211   7e-70
Sklu_1768.3 YGL018C, Contig c1768 3648-4205                           196   3e-64
KLLA0A04840g complement(430541..431137) similar to sp|P53193 Sac...   179   2e-57
AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH] (1053441..1...   172   2e-54
Kwal_47.17451                                                         170   5e-54
CAGL0J02750g complement(270406..271554) highly similar to sp|P39...    37   0.004
Scas_715.29                                                            37   0.005
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    35   0.017
Scas_564.1*                                                            35   0.023
AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..786...    35   0.032
CAGL0I09526g 911127..912017 weakly similar to sp|P52868 Saccharo...    34   0.035
CAGL0J10296g complement(1004500..1005939) similar to sp|P53940 S...    35   0.039
AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH] complemen...    33   0.063
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    33   0.098
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        33   0.10 
Kwal_26.9495                                                           33   0.12 
YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member...    33   0.13 
Sklu_2174.6 YER048C, Contig c2174 7478-8659                            33   0.13 
KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102 Saccha...    32   0.27 
KLLA0E24552g 2178343..2180724 gi|28565054|gb|AAO32610.1 Kluyvero...    32   0.31 
KLLA0E04345g complement(400495..401781) similar to sp|P39101 Sac...    32   0.32 
YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of...    32   0.33 
CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces c...    32   0.36 
CAGL0J01936g complement(190181..191458) highly similar to sp|P40...    32   0.38 
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            32   0.40 
Scas_709.3                                                             31   0.43 
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    31   0.47 
Sklu_2292.4 YGR285C, Contig c2292 5220-6518                            31   0.49 
ADL111W [1630] [Homologous to ScYER048C (CAJ1) - SH] complement(...    31   0.51 
CAGL0F03729g complement(362972..364057) similar to sp|P25303 Sac...    31   0.52 
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....    30   0.83 
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    30   0.83 
Kwal_26.8879                                                           30   0.87 
YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli ...    30   0.91 
Sklu_1262.1 YPR061C, Contig c1262 1479-2330                            30   0.97 
KLLA0B08459g 751178..752065 weakly similar to sgd|S0006265 Sacch...    30   1.0  
Kwal_23.4420                                                           30   1.0  
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    30   1.2  
Kwal_47.18133                                                          30   1.2  
Kwal_23.3061                                                           30   1.4  
Kwal_55.20965                                                          30   1.5  
Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement      30   1.6  
Scas_532.2                                                             29   1.9  
AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH] complement(1...    29   2.0  
Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement         29   2.7  
CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces c...    28   3.0  
Scas_692.34                                                            28   3.1  
ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH] complement(...    28   3.1  
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    28   5.0  
YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein p...    28   5.3  
AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH] (885026..88...    28   6.6  
Kwal_56.23782                                                          28   6.9  
KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces c...    28   6.9  
Scas_695.14                                                            27   7.2  
Kwal_14.1136                                                           27   7.5  
YOR254C (SEC63) [5042] chr15 complement(805031..807022) Componen...    28   7.8  
AAR027W [213] [Homologous to ScYBR251W (MRPS5) - SH] complement(...    27   8.0  
YDL231C (BRE4) [645] chr4 complement(38868..42245) Protein of un...    27   8.3  
AGL252W [4060] [Homologous to ScYPL045W (VPS16) - SH] complement...    27   8.5  
Scas_542.2                                                             27   8.7  
Sklu_1617.3 YJR097W, Contig c1617 3142-3639                            27   8.8  
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    27   9.0  
AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH] complement(...    27   9.7  

>Scas_638.8
          Length = 188

 Score =  387 bits (993), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 188/188 (100%), Positives = 188/188 (100%)

Query: 1   MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT 60
           MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT
Sbjct: 1   MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT 60

Query: 61  HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD 120
           HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD
Sbjct: 61  HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD 120

Query: 121 IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180
           IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG
Sbjct: 121 IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180

Query: 181 KEIQINNH 188
           KEIQINNH
Sbjct: 181 KEIQINNH 188

>YGL018C (JAC1) [1955] chr7 complement(459113..459667) J-type
           chaperone protein, may be involved in assembly of
           mitochondrial iron-sulfur proteins [555 bp, 184 aa]
          Length = 184

 Score =  235 bits (599), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 144/187 (77%), Gaps = 3/187 (1%)

Query: 1   MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT 60
           M ++L Q+R+ +TFYELFP+TFP K PIW++DQS+LRKEYR LQAQHHPDMAQ   E   
Sbjct: 1   MLKYLVQRRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSE--- 57

Query: 61  HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD 120
            SS LN+AYH LK+PL RSQY++KLL N+DLTQ+    ++T SDP++L+KV++IH++L  
Sbjct: 58  QSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQ 117

Query: 121 IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180
           +D E  VK + ++N ER+  IE QL   +  KD+  A+KLTVELKYW N+A A K+WAPG
Sbjct: 118 MDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPG 177

Query: 181 KEIQINN 187
           K++++N+
Sbjct: 178 KQLEMNH 184

>CAGL0A00297g complement(30179..30775) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone, hypothetical start
          Length = 198

 Score =  211 bits (536), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 98/186 (52%), Positives = 137/186 (73%), Gaps = 1/186 (0%)

Query: 3   RFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT-H 61
           R + Q+R++ ++YELFP TFP   P W VD  KLRKEYR LQA+ HPD  Q  +E D+  
Sbjct: 13  RQVLQRRWIVSYYELFPGTFPDSQPRWDVDLGKLRKEYRKLQAEVHPDKIQKEQEADSEQ 72

Query: 62  SSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMDI 121
           SSLLNKAYH LK+PLTRSQ++I++L +VDLT DSV  + TQ DPE+LM V+++HEQL+D 
Sbjct: 73  SSLLNKAYHALKDPLTRSQHMIQILKDVDLTVDSVAREYTQMDPELLMDVMDVHEQLLDA 132

Query: 122 DTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPGK 181
           ++ ++V++I + N +R+  IE +L+  +  K++E AI LT  LKYW NVA A+K+WAPGK
Sbjct: 133 NSRDEVREIEKVNKQRIEKIEAELKECYDNKEYERAINLTARLKYWKNVASAVKDWAPGK 192

Query: 182 EIQINN 187
            I + +
Sbjct: 193 PIDLKH 198

>Sklu_1768.3 YGL018C, Contig c1768 3648-4205
          Length = 185

 Score =  196 bits (497), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 131/187 (70%), Gaps = 2/187 (1%)

Query: 1   MKRFLTQKRYLTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDT 60
           M+R  T+      FY+LFP+TFP   P W+VD  +LR+EYR LQA  HPD AQ S   D 
Sbjct: 1   MQRLYTRFYSTKNFYQLFPKTFPKGKPQWTVDLRQLRQEYRKLQAISHPD-AQGSTTNDD 59

Query: 61  HSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMD 120
            SS LNKAYH L++PLTRSQYL++   ++DL++D V  +ITQ DPE+LM V++IHEQL  
Sbjct: 60  -SSTLNKAYHTLRQPLTRSQYLLQTQAHIDLSKDQVASEITQQDPELLMTVLDIHEQLES 118

Query: 121 IDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180
           I TEED+ +I +EN +RM  ++  L++ +   DFETA +LT+ELKYW N+  AIKEW PG
Sbjct: 119 ITTEEDLHQISKENKQRMERVQELLDDCYANHDFETAARLTIELKYWVNLDNAIKEWEPG 178

Query: 181 KEIQINN 187
           K + + +
Sbjct: 179 KPVHLTH 185

>KLLA0A04840g complement(430541..431137) similar to sp|P53193
           Saccharomyces cerevisiae YGL018c JAC1 molecular
           chaperone singleton, start by similarity
          Length = 198

 Score =  179 bits (454), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 87/171 (50%), Positives = 123/171 (71%), Gaps = 3/171 (1%)

Query: 13  TFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVL 72
           T ++ FP+TF +  P W VD  KLRKEYR LQ++HHPD+  ++  +D  SS LN+AY  L
Sbjct: 27  TLFQWFPKTFTSGKPQWEVDLKKLRKEYRQLQSEHHPDVITST--VDNVSSELNRAYKTL 84

Query: 73  KEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMDIDTEEDVKKIRR 132
            +PL RSQY++ L   +DLTQD   +K+   DP++LM V+++HEQL DI++EED+K+I +
Sbjct: 85  SKPLPRSQYILSL-HGIDLTQDGEAQKVMSKDPQLLMLVLDVHEQLEDINSEEDLKQIEQ 143

Query: 133 ENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPGKEI 183
           EN +R+   E +L+ A + +D+ETA  LTVEL+YWSN+  AIKEW PGK I
Sbjct: 144 ENKQRLNECEQKLKKAHESQDWETAAMLTVELRYWSNLDNAIKEWEPGKPI 194

>AGR164C [4475] [Homologous to ScYGL018C (JAC1) - SH]
           (1053441..1054043) [603 bp, 200 aa]
          Length = 200

 Score =  172 bits (435), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 112/166 (67%), Gaps = 4/166 (2%)

Query: 15  YELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKE 74
           +  FP TFP+  P W VD  +LR+EYR LQ QHHPD+A  ++E    +  LN+AY  L  
Sbjct: 32  FRAFPATFPSGEPQWDVDVRRLRREYRQLQGQHHPDVAGGTDEA---AQRLNRAYGTLVR 88

Query: 75  PLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMDIDTEEDVKKIRREN 134
           PL R+Q+L+     VD+T D+  ++I Q DP +LM+V+++HEQL ++++E DV+++R EN
Sbjct: 89  PLARAQFLLAR-QGVDVTADATAQEIMQRDPGLLMRVLDVHEQLEELESEADVRRLREEN 147

Query: 135 TERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPG 180
             RMA +E +L  AF  + ++ A +L VEL+YW NV  A++EW PG
Sbjct: 148 RARMAGVEAELGRAFAARAWDRAAQLAVELRYWDNVESAVREWEPG 193

>Kwal_47.17451
          Length = 186

 Score =  170 bits (430), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 126/188 (67%), Gaps = 3/188 (1%)

Query: 1   MKRFLTQKRY-LTTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELD 59
           M R + ++ Y + + Y+LFP+TF +    W VD  +LR EYR LQA  HPD   N +   
Sbjct: 1   MFRLVPRRLYSVRSAYQLFPKTFASGNMRWDVDLRRLRMEYRELQAAEHPDTNSNGDA-- 58

Query: 60  THSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLM 119
           + SS LN AY  L++PL R++Y++K    +DL  +   + I Q +PE+LM+V+++HEQL 
Sbjct: 59  SRSSELNHAYQTLRQPLLRAEYILKNQAGIDLRNEQTAQGIAQQNPELLMQVLDVHEQLE 118

Query: 120 DIDTEEDVKKIRRENTERMATIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAP 179
            + TEEDV  + REN ERM  IE +L  AF+K+D++ A +LTVEL+YW+++  A+KEW P
Sbjct: 119 SMTTEEDVAAVARENQERMREIEQRLGAAFEKQDWDAATQLTVELRYWTSLDRAVKEWEP 178

Query: 180 GKEIQINN 187
           G+ +++++
Sbjct: 179 GQRLEMSH 186

>CAGL0J02750g complement(270406..271554) highly similar to
          sp|P39101 Saccharomyces cerevisiae YER048c CAJ1, start
          by similarity
          Length = 382

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T FY++   + P  TP      S+++K YR +    HPD   +  E       + +AY V
Sbjct: 5  TEFYDVLGIS-PEATP------SEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQV 57

Query: 72 LKEPLTRSQY 81
          L +P  R QY
Sbjct: 58 LNDPALRKQY 67

>Scas_715.29
          Length = 387

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T +Y++     PT TP      ++++K YR    Q HPD   +  E       + +AY V
Sbjct: 5  TGYYDVLG-VQPTATP------AEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQV 57

Query: 72 LKEPLTRSQY 81
          L +P  RS+Y
Sbjct: 58 LSDPGLRSRY 67

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
          cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 35.4 bits (80), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 33 QSKLRKEYRALQAQHHPDMAQNSEELDTHSSLL--------NKAYHVLKEPLTRSQYLIK 84
          Q ++++ YR L  +HHPD A+ +E  +  S  L          AY VL +   R++Y  K
Sbjct: 15 QDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLSDASLRAEYDQK 74

Query: 85 L 85
          L
Sbjct: 75 L 75

>Scas_564.1*
          Length = 457

 Score = 35.0 bits (79), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 34  SKLRKEYRALQAQHHPDMAQNSEELDTHSS-----LLNKAYHVLKEPLTRSQY 81
           S ++K YR L  QHHPD   NS   D  +S      ++ AY +L +   R+ Y
Sbjct: 357 SDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDEDKRAHY 409

>AGL339C [3973] [Homologous to ScYGR285C (ZUO1) - SH] (77330..78622)
           [1293 bp, 430 aa]
          Length = 430

 Score = 34.7 bits (78), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 21/75 (28%)

Query: 34  SKLRKEYRALQAQ-----------HHPD---MAQNSEELDTHSSLLNKAYHVLKEPLTRS 79
           SKLR  Y+A QAQ           HHPD    A  S E D    ++ KA+  L +P+ R+
Sbjct: 105 SKLR--YKATQAQIIKAHRKQVLKHHPDKKSAAGASLEEDNFFKIIQKAFETLTDPVKRA 162

Query: 80  QYLIKLLDNVDLTQD 94
           Q+     D+ D   D
Sbjct: 163 QF-----DSCDFNAD 172

>CAGL0I09526g 911127..912017 weakly similar to sp|P52868
          Saccharomyces cerevisiae YGL128c, hypothetical start
          Length = 296

 Score = 34.3 bits (77), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          L+K+YR L  ++HPD     E +D    LLN A  VL +P  +++Y
Sbjct: 38 LKKQYRKLSLRYHPDKNPGPEYIDRF-HLLNLAITVLADPAKKAEY 82

>CAGL0J10296g complement(1004500..1005939) similar to sp|P53940
          Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 479

 Score = 34.7 bits (78), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 33 QSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          Q  ++K + A   + HPD   +SEE       ++KAY VL +P +R  Y
Sbjct: 19 QVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSDPKSREMY 67

>AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH]
          complement(1640183..1641004) [822 bp, 273 aa]
          Length = 273

 Score = 33.5 bits (75), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%)

Query: 14 FYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLK 73
           Y L   +  +   + +VD ++LR ++R L  ++HPD  ++  + +     + KAY +L 
Sbjct: 16 LYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILS 75

Query: 74 EPLTRSQY 81
              R+ Y
Sbjct: 76 NSSLRATY 83

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
          Saccharomyces cerevisiae YMR214w SCJ1 homolog of E.
          coli DnaJ, functions in the endoplasmic reticulum by
          interaction with KAR2P, start by similarity
          Length = 368

 Score = 33.1 bits (74), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 4/58 (6%)

Query: 28 IWSVDQSKLRKE----YRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          I  VD+    KE    YR L  ++HPD    ++E   H   + +AY VL +P  R  Y
Sbjct: 24 ILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 33.1 bits (74), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          TT+Y+L   + P   PI      +++K YR    Q HPD   N          +++AY V
Sbjct: 5  TTYYDLLGVS-PNARPI------EIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQV 57

Query: 72 LKEPLTRSQY 81
          L     R++Y
Sbjct: 58 LSNEELRTKY 67

>Kwal_26.9495
          Length = 428

 Score = 33.1 bits (74), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 38/89 (42%), Gaps = 20/89 (22%)

Query: 19  PRTFPTKTPIWSVDQSKLRKEYRALQAQ-----------HHPD--MAQNSEELDTHSSLL 65
           PR + T     ++  SKLR  YRA +AQ           HHPD   A    E D    ++
Sbjct: 89  PRDWKTADLYAAMGLSKLR--YRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGFFKII 146

Query: 66  NKAYHVLKEPLTRSQYLIKLLDNVDLTQD 94
            KAY  L +   R+QY     D+ D   D
Sbjct: 147 QKAYETLTDSNKRAQY-----DSCDSNAD 170

>YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member of
           the DnaJ family of protein chaperones, contains two
           C2H2-type zinc finger domains [1773 bp, 590 aa]
          Length = 590

 Score = 33.1 bits (74), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 13/71 (18%)

Query: 36  LRKEYRALQAQHHPDM-AQNSEELDTHSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQD 94
           L+K YR    Q+HPD    N EE     +++  AY VL +P  R+ Y            D
Sbjct: 20  LKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQERAWY------------D 67

Query: 95  SVKEKITQSDP 105
           S KE+I    P
Sbjct: 68  SHKEQILNDTP 78

>Sklu_2174.6 YER048C, Contig c2174 7478-8659
          Length = 393

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T +Y+    + P  TP      ++++K YR      HPD   N  +       + +AY V
Sbjct: 5  TEYYDALGIS-PDATP------TEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQV 57

Query: 72 LKEPLTRSQY 81
          L +P  RS+Y
Sbjct: 58 LSDPGLRSRY 67

>KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102
           Saccharomyces cerevisiae YLR090w XDJ1, start by
           similarity
          Length = 512

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 11/74 (14%)

Query: 36  LRKEYRALQAQHHPDMAQNSEELDTHSSLLNK---AYHVLKEPLTRSQYLIKLLDNVDLT 92
           +RK YR L  ++HPD   +  E +T  ++  +   AY +L +P  +S+Y        D+ 
Sbjct: 88  IRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELKSRY--------DMY 139

Query: 93  QDSVKEKITQSDPE 106
            DS         PE
Sbjct: 140 GDSAFGSGGNGFPE 153

>KLLA0E24552g 2178343..2180724 gi|28565054|gb|AAO32610.1
           Kluyveromyces lactis SMY2, start by similarity
          Length = 793

 Score = 32.0 bits (71), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 15  YELFPRTFPTKTPIWSVDQSKLRKEYRALQAQ 46
           Y+L P+T+ T  PI SVD + ++ +Y+   AQ
Sbjct: 367 YQLAPQTYQTTQPIRSVDATSIKDQYQPTNAQ 398

>KLLA0E04345g complement(400495..401781) similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1 dnaJ homolog,
           start by similarity
          Length = 428

 Score = 31.6 bits (70), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 46/103 (44%), Gaps = 16/103 (15%)

Query: 12  TTFYELFPRTFPTKTPIWSVDQS--KLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAY 69
           TT+Y++            SVD S  +++K YR L  + HPD   +  +  T    L KAY
Sbjct: 5   TTYYDILQ---------VSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAY 55

Query: 70  HVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVI 112
            VL +   R +Y     D   L + + +  + Q   E+LM V 
Sbjct: 56  QVLIDDDLRKKY-----DQFGLDETNGEIPMDQDPYEMLMTVF 93

>YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of
          E. coli DnaJ, has a leucine zipper [1176 bp, 391 aa]
          Length = 391

 Score = 31.6 bits (70), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T +Y++     P  TP      ++++K YR    + HPD   +  +       + +AY V
Sbjct: 5  TEYYDILG-IKPEATP------TEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQV 57

Query: 72 LKEPLTRSQY 81
          L +P  RS+Y
Sbjct: 58 LSDPGLRSKY 67

>CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 623

 Score = 31.6 bits (70), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 32/71 (45%), Gaps = 13/71 (18%)

Query: 36  LRKEYRALQAQHHPDMA-QNSEELDTHSSLLNKAYHVLKEPLTRSQYLIKLLDNVDLTQD 94
           L+K YR    Q+HPD    N EE  T  + +  AY VL +P  R+ Y            D
Sbjct: 20  LKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQERAWY------------D 67

Query: 95  SVKEKITQSDP 105
           S KE+I    P
Sbjct: 68  SHKEQILSDTP 78

>CAGL0J01936g complement(190181..191458) highly similar to
          sp|P40564 Saccharomyces cerevisiae YIR004w DJP1, start
          by similarity
          Length = 425

 Score = 31.6 bits (70), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          +T+Y+L     PT T +      +++K YR    Q HPD   N          +++AY V
Sbjct: 5  STYYDLLG-IGPTATAV------EIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQV 57

Query: 72 LKEPLTRSQY 81
          L     R++Y
Sbjct: 58 LSSEELRAKY 67

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 31.6 bits (70), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 6/59 (10%)

Query: 30  SVDQSKLRKEYRALQAQHHPD------MAQNSEELDTHSSLLNKAYHVLKEPLTRSQYL 82
           S    ++R  YR L  + HPD        +   EL+    L+ KAY  L + +T+  YL
Sbjct: 126 SATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDEITKENYL 184

>Scas_709.3
          Length = 414

 Score = 31.2 bits (69), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T +YEL   + P+ T I      +++K YR    Q HPD   N          +++AY V
Sbjct: 5  TAYYELLGIS-PSATAI------EIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQV 57

Query: 72 LKEPLTRSQY 81
          L +   R +Y
Sbjct: 58 LSDDTLRLKY 67

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
          DnaJ, functions in the endoplasmic reticulum by
          interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 31.2 bits (69), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 28 IWSVDQSKLRKE----YRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          I  +D+    KE    YR L  ++HPD    SEE       + +AY VL +P  +  Y
Sbjct: 27 ILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

>Sklu_2292.4 YGR285C, Contig c2292 5220-6518
          Length = 432

 Score = 31.2 bits (69), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 37/89 (41%), Gaps = 20/89 (22%)

Query: 19  PRTFPTKTPIWSVDQSKLRKEYRALQAQ-----------HHPD--MAQNSEELDTHSSLL 65
           PR + T     ++  SKLR  Y+A  AQ           HHPD   A    E D    ++
Sbjct: 90  PRDWKTADLYAAMGISKLR--YKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGFFKII 147

Query: 66  NKAYHVLKEPLTRSQYLIKLLDNVDLTQD 94
            KAY  L +   R+QY     D+ D   D
Sbjct: 148 QKAYETLTDSNKRAQY-----DSCDFNAD 171

>ADL111W [1630] [Homologous to ScYER048C (CAJ1) - SH]
           complement(487951..489687) [1737 bp, 578 aa]
          Length = 578

 Score = 31.2 bits (69), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 47/104 (45%), Gaps = 18/104 (17%)

Query: 12  TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSL--LNKAY 69
           TT+Y++        TP    +Q+   K YR    Q HPDM  N      H+    ++KAY
Sbjct: 5   TTYYDIL-----GVTPSAFAEQNN--KAYRMKAIQTHPDM--NPTHPYAHAKFQEVSKAY 55

Query: 70  HVLKEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDP-EILMKVI 112
            VL +P  +++Y    L       D   E + + DP E+LM V 
Sbjct: 56  KVLSDPDLKNRYTEFGLS------DERGEMVMEEDPFEMLMAVF 93

>CAGL0F03729g complement(362972..364057) similar to sp|P25303
          Saccharomyces cerevisiae YMR214w SCJ1, hypothetical
          start
          Length = 361

 Score = 30.8 bits (68), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQYLIKLLD 87
          ++  YR L  ++HPD     EE       + +AY +L +P  R  Y +   D
Sbjct: 36 IKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTYDVHGAD 87

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score = 30.4 bits (67), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 30  SVDQSKLRKEYRALQAQHHPDMAQNSEE-LDTHS-----SLLNKAYHVLKEPLTRSQY 81
            VD  +L+K Y  L   +HPD A  +++ L  H       L+N+AY +L +   R  Y
Sbjct: 102 GVDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMY 159

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
          involved in protein import into mitochondria and ER,
          homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 30.4 bits (67), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 8/70 (11%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T FY++         P+ + D  +++K YR    ++HPD    SEE        + AY +
Sbjct: 5  TKFYDIL------GVPVTATD-VEIKKAYRKCALKYHPDK-NPSEEAAEKFKEASAAYEI 56

Query: 72 LKEPLTRSQY 81
          L +P  R  Y
Sbjct: 57 LSDPEKRDIY 66

>Kwal_26.8879
          Length = 656

 Score = 30.4 bits (67), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 6/54 (11%)

Query: 35  KLRKEYRALQAQHHPD------MAQNSEELDTHSSLLNKAYHVLKEPLTRSQYL 82
           ++R  YR L  + HPD       A     L+    ++ KAY  L + +TR  YL
Sbjct: 132 EIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDEVTRENYL 185

>YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli
          DnaJ [1380 bp, 459 aa]
          Length = 459

 Score = 30.4 bits (67), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 36 LRKEYRALQAQHHPD--MAQNSEELD-THSSLLNKAYHVLKEPLTRSQYLIKLLDN 88
          ++  YR L  +HHPD  + Q+S+E++      +  AY +L +P  +S Y +   DN
Sbjct: 25 IKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDLYGDDN 80

>Sklu_1262.1 YPR061C, Contig c1262 1479-2330
          Length = 283

 Score = 30.0 bits (66), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 13 TFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQN 54
          T YE+F        P  S++ + L+K+Y AL   +HPD++ N
Sbjct: 41 TPYEVF------GVPPGSINPNDLKKKYHALAKLYHPDISNN 76

>KLLA0B08459g 751178..752065 weakly similar to sgd|S0006265
           Saccharomyces cerevisiae YPR061c, hypothetical start
          Length = 295

 Score = 30.0 bits (66), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 31/129 (24%)

Query: 36  LRKEYRALQAQHHPDMA--------QNSEEL---DTHSSLLN------------KAYHVL 72
           L+K +  L   +HPD +         NS EL   + H ++L+            +AY +L
Sbjct: 80  LKKRFHELARLYHPDHSSNRTILKRNNSTELTSSNIHDNVLSTSDKSDRFKIIKEAYELL 139

Query: 73  KEPLTRSQYLIKLLDNVDLTQDSVKEKITQSDPEILMKVIEIHEQLMDIDTEEDVKKIRR 132
           K+P  + QY     D + L      + I  +     M   E HE+  +  T ED   IRR
Sbjct: 140 KDPGRKHQY-----DMLGLGWVYGPKPIPTASG---MPRYERHEKFYNAGTWEDYSNIRR 191

Query: 133 ENTERMATI 141
            + E +  +
Sbjct: 192 NDKEEVGPL 200

>Kwal_23.4420
          Length = 592

 Score = 30.0 bits (66), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 12/89 (13%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQ-NSEELDTHSSLLNKAYH 70
          T +YEL       +T     D   L+K YR     +HPD  + N EE     + +  AY 
Sbjct: 3  TCYYELLG----VETTASDAD---LKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYE 55

Query: 71 VLKEPLTRSQYLIK----LLDNVDLTQDS 95
          VL +P  R+ Y       L D++ +T D 
Sbjct: 56 VLADPQERAWYDSHKQQILSDDIGMTNDG 84

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
          cell stress, member of the DnaJ family of predicted
          protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 34 SKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          S+++K YR    ++HPD   ++EE       + +AY +LK+   R+ Y
Sbjct: 20 SEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALY 67

>Kwal_47.18133
          Length = 393

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          ++K YR      HPD   +  E       + +AY VL +P  RS+Y
Sbjct: 22 IKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSDPDLRSRY 67

>Kwal_23.3061
          Length = 458

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          ++K YR    +HHPD   +SE+       + KAY +L +   R  Y
Sbjct: 24 IKKAYRLKALKHHPDKNGHSEQSKLKFQQICKAYEILGDDKKREMY 69

>Kwal_55.20965
          Length = 421

 Score = 29.6 bits (65), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          TT+Y+L     P+   I       ++K YR    Q HPD   N          +++AY V
Sbjct: 6  TTYYDLLG-VDPSAKAI------DIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQV 58

Query: 72 LKEPLTRSQY 81
          L +   R++Y
Sbjct: 59 LSKEDLRAKY 68

>Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement
          Length = 678

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHS-SLLNKAYHVLKEPLTRSQY 81
          L+K YR    ++HPD   N+ E  T + + +  AY VL +P  R+ Y
Sbjct: 20 LKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQERAWY 66

>Scas_532.2
          Length = 616

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSL---LNKAYHVLKEPLTRSQY 81
          L+K YR    Q HPD  +N + +D  + +   +  AY VL +P  R+ Y
Sbjct: 20 LKKAYRKKALQFHPD--KNPDNVDEATEIFATIRSAYEVLSDPQERAWY 66

>AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH]
           complement(161385..163394) [2010 bp, 669 aa]
          Length = 669

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 35  KLRKEYRALQAQHHPD-MAQNSEE-----LDTHSSLLNKAYHVLKEPLTRSQYL 82
           ++R  YR L  + HPD +A++ ++     L+    L+ KAY  L +  TR  +L
Sbjct: 130 EIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDDATRDNFL 183

>Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement
          Length = 348

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 30 SVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          S D+ +L+K YR    ++HPD      E       +++A+ +L +P  R  Y
Sbjct: 16 SADEGELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPQKREIY 64

>CAGL0D01584g 167879..168781 similar to tr|Q12350 Saccharomyces
           cerevisiae YPR061c, hypothetical start
          Length = 300

 Score = 28.5 bits (62), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 9/70 (12%)

Query: 13  TFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVL 72
           T YE+F     T      VD  KL+ EY      +HPD+   S  +    S L K++H +
Sbjct: 56  TPYEIFGFGVGTH-----VDLKKLKMEYHKYVKMYHPDL---SSHIQIRKSSLVKSHHAM 107

Query: 73  KEPLTRSQYL 82
            E    +QYL
Sbjct: 108 -EIANTAQYL 116

>Scas_692.34
          Length = 375

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 4/48 (8%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSLL--NKAYHVLKEPLTRSQY 81
          ++  YR L  + HPD  +N    D H   +   +AY VL +P  R  +
Sbjct: 37 IKSAYRQLSKKFHPD--KNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF 82

>ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH]
          complement(732201..733511) [1311 bp, 436 aa]
          Length = 436

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T +Y+L   + P    I      +++K YR    Q HPD   N  +       +++AY V
Sbjct: 5  TAYYDLLGVS-PDAKAI------EIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQV 57

Query: 72 LKEPLTRSQY 81
          L     R++Y
Sbjct: 58 LSSDELRAKY 67

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
          peroxisomal biogenesis, has similarity to E. coli DnaJ
          and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 28.1 bits (61), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 12 TTFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHV 71
          T +Y+L        T   S++   ++K YR    Q HPD   N          +++AY V
Sbjct: 5  TEYYDLLG----VSTTASSIE---IKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQV 57

Query: 72 LKEPLTRSQY 81
          L +   R++Y
Sbjct: 58 LGDDDLRAKY 67

>YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein
           possibly involved in pre-mRNA splicing, has similarity
           to E. coli DnaJ and other DnaJ-like proteins [852 bp,
           283 aa]
          Length = 283

 Score = 27.7 bits (60), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 22  FPTKTPIWSV--DQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRS 79
            PT   + ++  D  +++++YR L  ++HPD   ++  +     LL+ A ++L     R 
Sbjct: 22  LPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHLLSTATNILTNADVRP 81

Query: 80  QYLIKLLDNVDLTQDSVKEKITQ 102
            Y   L++ +  T D  + K+ Q
Sbjct: 82  HYDRWLIEFLRKTNDIERNKLIQ 104

>AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH]
          (885026..886309) [1284 bp, 427 aa]
          Length = 427

 Score = 27.7 bits (60), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 30 SVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSL---LNKAYHVLKEPLTRSQY 81
          S  + ++++ YR L  ++HPD   +  E +   +    ++ AY VL +   R++Y
Sbjct: 14 SASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQKRAEY 68

>Kwal_56.23782
          Length = 414

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 33 QSKLRKEYRALQAQHHPDMAQNS---EELDTHSSLLNKAYHVLKEPLTRSQY 81
          Q +++K YR L  QHHPD   +    EE +     +  AY +L     R  Y
Sbjct: 15 QDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKRRNY 66

>KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces
           cerevisiae YOR254c SEC63 ER protein-translocation
           complex subunit singleton, start by similarity
          Length = 669

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 35  KLRKEYRALQAQHHPD-MAQNSEELDTHS-----SLLNKAYHVLKEPLTRSQY 81
           +++  YR L  + HPD ++++  E++  +      ++NKAY  L + +T+  Y
Sbjct: 126 EIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDEITKENY 178

>Scas_695.14
          Length = 327

 Score = 27.3 bits (59), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 30 SVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          + ++ +L+K YR    ++HPD      E       +++A+ +L +P TR  Y
Sbjct: 16 TANEQELKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILNDPNTREVY 64

>Kwal_14.1136
          Length = 286

 Score = 27.3 bits (59), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 13 TFYELFPRTFPTKTPIWSVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSS 63
          T YE+F        P   VD   L+K+Y A+   +HPD++     L  ++S
Sbjct: 41 TPYEIF------GMPPGQVDSRSLKKKYHAMAKLYHPDISNGVRILKQNTS 85

>YOR254C (SEC63) [5042] chr15 complement(805031..807022) Component
           of ER protein-translocation subcomplex, which includes
           Sec62p, Sec63p, Sec66p, and Sec72p, member of DnaJ
           protein family [1992 bp, 663 aa]
          Length = 663

 Score = 27.7 bits (60), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 6/59 (10%)

Query: 30  SVDQSKLRKEYRALQAQHHPDMAQNSEELDTHSSL------LNKAYHVLKEPLTRSQYL 82
           S     ++  YR L  + HPD        D  S +      + KAY  L + L R  YL
Sbjct: 135 SASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQNYL 193

>AAR027W [213] [Homologous to ScYBR251W (MRPS5) - SH]
           complement(390042..390992) [951 bp, 316 aa]
          Length = 316

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 92  TQDSVKEKITQSDPEILMKVIEIHEQLMDIDTE 124
           T+D+ K  + Q  P+ L+K IE+ EQ +  D E
Sbjct: 27  TKDAYKSMLAQYYPQELLKSIEVGEQAIPDDAE 59

>YDL231C (BRE4) [645] chr4 complement(38868..42245) Protein of unknown
            function, has a putative zinc finger domain [3378 bp,
            1125 aa]
          Length = 1125

 Score = 27.3 bits (59), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 13/103 (12%)

Query: 55   SEELDTHSSLLNKAYHVLKEPLTRSQY----LIKLLDNVDLTQDSVKEKITQSDPEILMK 110
            ++ L+    LL KA H   EP+  S +       L+++       + E        I   
Sbjct: 917  TQSLEAIRELLKKARH---EPIIISNFNPEKYASLINSCQFLLSKIIEA------RISGA 967

Query: 111  VIEIHEQLMDIDTEEDVKKIRRENTERMATIEGQLENAFKKKD 153
              EI +Q  DI+T   +  +RR++   +  +   L N F+ K+
Sbjct: 968  FFEIWDQDFDIETTRALLSLRRDSVSSVIFVFYILSNCFRSKN 1010

>AGL252W [4060] [Homologous to ScYPL045W (VPS16) - SH]
           complement(228290..230677) [2388 bp, 795 aa]
          Length = 795

 Score = 27.3 bits (59), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 19/42 (45%)

Query: 140 TIEGQLENAFKKKDFETAIKLTVELKYWSNVAYAIKEWAPGK 181
           TI+G LE   +   F   I++   L Y   +    KEWA  K
Sbjct: 406 TIDGVLEILMRLHKFHKCIQICSFLNYEKKLGNVFKEWAVAK 447

>Scas_542.2
          Length = 280

 Score = 27.3 bits (59), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 36 LRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          ++K YR L  ++HPD   N  E+      L+ A H+L     + +Y
Sbjct: 38 IKKRYRTLALKYHPDKHPNEPEIVHKFYQLSVATHILTNEALKKRY 83

>Sklu_1617.3 YJR097W, Contig c1617 3142-3639
          Length = 165

 Score = 26.9 bits (58), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 34 SKLRKEYRALQAQHHPD---MAQNSEELDTHSSL--LNKAYHVLKEPLTRSQYLIKL 85
          S++++ YR      HPD     Q   +  T +S+  + +AY VL +P  R QY  +L
Sbjct: 18 SQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPTRREQYDAEL 74

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic
          reticulum membrane protein, member of the DnaJ family
          of putative protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 26.9 bits (58), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 28 IWSVDQ----SKLRKEYRALQAQHHPDMAQNSEELDTHSSLLNKAYHVLKEPLTRSQY 81
          I  VD+    S+++K YR L  + HPD   + +  +    ++N+A+ VL     RS Y
Sbjct: 25 ILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAF-KVINRAFEVLSNEEKRSIY 81

>AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH]
          complement(1271436..1272539) [1104 bp, 367 aa]
          Length = 367

 Score = 26.9 bits (58), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 11/70 (15%)

Query: 28 IWSVDQSKLRKE----YRALQAQHHPDMAQNSEELDTHSSLL--NKAYHVLKEPLTR--- 78
          I  VD+    K+    YR L  ++HPD  +N  +   H + +   +AY  L +P  R   
Sbjct: 25 ILGVDREATEKDIKSAYRQLSKKYHPD--KNPGDTTAHHNFIEVGEAYEALSDPEKRRIY 82

Query: 79 SQYLIKLLDN 88
           QY  + L N
Sbjct: 83 DQYGAEALKN 92

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,211,614
Number of extensions: 261399
Number of successful extensions: 1624
Number of sequences better than 10.0: 184
Number of HSP's gapped: 1605
Number of HSP's successfully gapped: 190
Length of query: 188
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 92
Effective length of database: 13,272,781
Effective search space: 1221095852
Effective search space used: 1221095852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)