Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_638.727027012511e-176
YGL019W (CKB1)2782619931e-137
CAGL0A00275g2662529261e-127
Sklu_1768.43292529321e-126
Kwal_47.174492502559121e-125
KLLA0A04818g2772338721e-118
AGR163W2752438601e-116
Scas_699.432562394254e-51
Kwal_55.215702412334219e-51
ACR087C2572444202e-50
Sklu_1979.22732324187e-50
KLLA0E21967g2602294161e-49
CAGL0I00946g2592524045e-48
YOR039W (CKB2)2582214012e-47
Kwal_26.8595103483710.64
YMR223W (UBP8)47168626.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_638.7
         (270 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_638.7                                                            486   e-176
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   387   e-137
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   361   e-127
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        363   e-126
Kwal_47.17449                                                         355   e-125
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   340   e-118
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   335   e-116
Scas_699.43                                                           168   4e-51
Kwal_55.21570                                                         166   9e-51
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   166   2e-50
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        165   7e-50
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   164   1e-49
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   160   5e-48
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   159   2e-47
Kwal_26.8595                                                           32   0.64 
YMR223W (UBP8) [4179] chr13 (716714..718129) Putative ubiquitin-...    28   6.3  

>Scas_638.7
          Length = 270

 Score =  486 bits (1251), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/270 (87%), Positives = 236/270 (87%)

Query: 1   MSQQFVEVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVP 60
           MSQQFVEVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVP
Sbjct: 1   MSQQFVEVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVP 60

Query: 61  HYRKXXXXXXXXXXXXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGL 120
           HYRK                     MVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGL
Sbjct: 61  HYRKALDLILDLEAISEEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGL 120

Query: 121 IHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQD 180
           IHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQD
Sbjct: 121 IHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQD 180

Query: 181 LYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSG 240
           LYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSG
Sbjct: 181 LYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSG 240

Query: 241 QRMKWLRQYPSNXXXXXXXXXXXXXIPNID 270
           QRMKWLRQYPSN             IPNID
Sbjct: 241 QRMKWLRQYPSNEEEWEEFAKCEFEIPNID 270

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  387 bits (993), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 189/261 (72%), Positives = 209/261 (80%), Gaps = 9/261 (3%)

Query: 1   MSQQFVEVPSH-GELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEV 59
           MSQ+FVE  S  G   DEDSG Y+EWIPSFC+RFGHEYFC+VPTEFIEDDFN+TSLSQEV
Sbjct: 1   MSQEFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEV 60

Query: 60  PHYRKXXXXXXXXXXXXXXXXXXXXXM--------VGANNGQTDELVKKKAQAVNRSIIE 111
           PHYRK                     +        + +N+G  +   + K+  VN+SIIE
Sbjct: 61  PHYRKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIE 120

Query: 112 HAAEQLYGLIHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTV 171
           HAAEQLYGLIHAR+ILTKPGLQAMAEKFDHKEFGTCPRY+C GMQLLPCGLSDT+GK+TV
Sbjct: 121 HAAEQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTV 180

Query: 172 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGF 231
           RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELE+YV RK+K SYELKVFGF
Sbjct: 181 RLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGF 240

Query: 232 KINDRAVSGQRMKWLRQYPSN 252
           +IND AVSG RMKWLRQYPS 
Sbjct: 241 RINDEAVSGPRMKWLRQYPST 261

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  361 bits (926), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 196/252 (77%), Gaps = 13/252 (5%)

Query: 4   QFVEVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYR 63
           +++E  SH +    DSG Y+EWIPSFC+RFGHEYFC+VPT+FIEDDFN+TSL+QEVPHYR
Sbjct: 3   EYMEDNSHSD----DSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYR 58

Query: 64  KXXX-----XXXXXXXXXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLY 118
           K                            GANN      V  KA  VNR+II HAAEQLY
Sbjct: 59  KALDLILDLEMVSDEEDMDEKESGAESSSGANNNGG---VNSKA-LVNRNIIGHAAEQLY 114

Query: 119 GLIHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSC 178
           GLIHARYILTKPGLQAMAEKFDHK+FGTCPRY C GMQLLPCGLSDTIGK  VRLYCPSC
Sbjct: 115 GLIHARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSC 174

Query: 179 QDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAV 238
           QDLYLPQSSR LCLEGA+WGTSFPGVFLKHFKELE+YV RK K SYELKVFGF+IND+AV
Sbjct: 175 QDLYLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAV 234

Query: 239 SGQRMKWLRQYP 250
           SG RMKWLRQYP
Sbjct: 235 SGPRMKWLRQYP 246

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 176/252 (69%), Positives = 196/252 (77%), Gaps = 10/252 (3%)

Query: 1   MSQQFVEVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVP 60
           MSQ+F+E       +  DSG Y+EWIPSFC+RFGHEYFC+VPTEFIEDDFN+T LSQE+P
Sbjct: 70  MSQEFIE--DQSSSNSSDSGTYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIP 127

Query: 61  HYRKXXXXXXXXXXXXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGL 120
           HYRK                          +G          + VNRSI+EHAAEQLYGL
Sbjct: 128 HYRKALDLILDLEAMSDEDDEDDNDGAAEEDGS--------GEPVNRSIMEHAAEQLYGL 179

Query: 121 IHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQD 180
           IHARYILTKPGLQ+MAEKFDHKEFGTCPRY+CGGMQ+LPCGLSDT+GK TVRLYCPSCQD
Sbjct: 180 IHARYILTKPGLQSMAEKFDHKEFGTCPRYYCGGMQMLPCGLSDTLGKQTVRLYCPSCQD 239

Query: 181 LYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSG 240
           LYLPQSSR LC++GAFWGTSFPGVFLKHFKELEDYV RK+K+ YELKVFGFKIN  AVSG
Sbjct: 240 LYLPQSSRHLCMDGAFWGTSFPGVFLKHFKELEDYVERKSKDVYELKVFGFKINGEAVSG 299

Query: 241 QRMKWLRQYPSN 252
            RMKWLRQYP+ 
Sbjct: 300 PRMKWLRQYPAT 311

>Kwal_47.17449
          Length = 250

 Score =  355 bits (912), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 168/255 (65%), Positives = 193/255 (75%), Gaps = 18/255 (7%)

Query: 15  SDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXX 74
           S ++SG ++EWIPSFCARFGHEYFC+VPTEFIEDDFN+T L QEVPHYRK          
Sbjct: 13  SSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHYRKALD------- 65

Query: 75  XXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQA 134
                      +V      +DE  +   + V+RSI+EHAAEQLYGL+HARYILTKPGLQA
Sbjct: 66  -----------LVLDLEAMSDEEGQDSEEPVSRSIVEHAAEQLYGLVHARYILTKPGLQA 114

Query: 135 MAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEG 194
           MAEKFDHKEFGTCPRY+C GMQ+LPCGL+DT+GK TVRLYCPSCQDLYLPQSSR LCLEG
Sbjct: 115 MAEKFDHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEG 174

Query: 195 AFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKWLRQYPSNXX 254
           AFWGTSFPGVFLKHFKELEDYV RK+K++YEL+VFGF+I   A SG RM+WLRQ+P    
Sbjct: 175 AFWGTSFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGARMRWLRQHPKTPQ 234

Query: 255 XXXXXXXXXXXIPNI 269
                      IP +
Sbjct: 235 ELRELQECEFHIPEV 249

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  340 bits (872), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 160/233 (68%), Positives = 178/233 (76%), Gaps = 8/233 (3%)

Query: 18  DSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXXXXX 77
           DSGNYEEWIP+FC+RFGHEYFC+VPT+FIEDDFNLT LSQEV +YRK             
Sbjct: 12  DSGNYEEWIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTILDLESTSD 71

Query: 78  XXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMAE 137
                        N  +    K     V RSI+EH+AEQLYGLIHAR+ILTK GLQAMAE
Sbjct: 72  EEE--------EKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMAE 123

Query: 138 KFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAFW 197
           KFD KEFGTCPRYHCG +QLLPCGLSDT+GK TVRLYCPSCQDLY+PQSSR L LEGA+W
Sbjct: 124 KFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAYW 183

Query: 198 GTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKWLRQYP 250
           GTSFPGVFLKHFKELEDYV +K K +YELK+FGF I   A+ G RM+WLRQYP
Sbjct: 184 GTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEAICGPRMQWLRQYP 236

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  335 bits (860), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 160/243 (65%), Positives = 180/243 (74%), Gaps = 8/243 (3%)

Query: 18  DSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXXXXX 77
           +S NY+EWI SFC+RFGHE+FC+VPTEFIEDDFNLT LS EVPHYR+             
Sbjct: 12  ESSNYDEWITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLILDLESLSE 71

Query: 78  XXXXXXXXMVG--------ANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTK 129
                     G        +N     +      Q +N+SII+H AEQLYGLIHARYILTK
Sbjct: 72  EDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLIHARYILTK 131

Query: 130 PGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRF 189
            GLQAMAEKFDHKEFGTCPRY+CGGMQLLPCGLSDT+GK TVRLYC SCQDLYLP SSR 
Sbjct: 132 QGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDLYLPHSSRH 191

Query: 190 LCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKWLRQY 249
           LCLEGAFWGTSFPGVFLKHFKELEDYV +K KN Y L++FGF +   ++SG RM+WLRQY
Sbjct: 192 LCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKESISGPRMEWLRQY 251

Query: 250 PSN 252
           PS 
Sbjct: 252 PST 254

>Scas_699.43
          Length = 256

 Score =  168 bits (425), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 133/239 (55%), Gaps = 28/239 (11%)

Query: 7   EVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXX 66
           E  S GE++D  S   +EWI  F  + GHEYFC++  ++I D FNL +L + V  + +  
Sbjct: 19  EDDSMGEVTDS-SEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQ-- 75

Query: 67  XXXXXXXXXXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYI 126
                              +V     + DE + +         +E+ A + YGLIHARYI
Sbjct: 76  -------------------VVQYIVDELDESILETMSNARLEQLENDARKFYGLIHARYI 116

Query: 127 LTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQS 186
           +T  GLQ M +KF   +FG CPR +C    LLP GL DT G   V+LYC SC+DLY+P+S
Sbjct: 117 ITVKGLQKMLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKS 176

Query: 187 SRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245
            R  C++GAF+GTSFPG+FL+ F E+   V +     Y  K+FGF+++ +A   Q  +W
Sbjct: 177 MRHSCIDGAFFGTSFPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQA---QLARW 229

>Kwal_55.21570
          Length = 241

 Score =  166 bits (421), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 131/233 (56%), Gaps = 30/233 (12%)

Query: 18  DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXXXX 76
           DS  Y E WI  F  R GHEYFC++ TE+I D FNL +L + V  + +            
Sbjct: 18  DSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQ------------ 65

Query: 77  XXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMA 136
                    ++     + D+ + ++  +     +EH A +LYGLIHARY++T  GLQ M 
Sbjct: 66  ---------VIQYMVDELDDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKML 116

Query: 137 EKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAF 196
           +K+   +FG CPR +C    LLP GL D  GK  V+LYC  C+DLY+P+SSR   ++GA+
Sbjct: 117 QKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAY 176

Query: 197 WGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSG-----QRMK 244
           +GTSFPG+FL+ F E+   V +     Y  K+FGF+++ +A        QRMK
Sbjct: 177 FGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQAQVARWQELQRMK 226

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  166 bits (420), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 133/244 (54%), Gaps = 34/244 (13%)

Query: 6   VEVPSHGELSDEDSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRK 64
           VE+    E +   S +Y E WI  F  + GHEYFC+V TE+I D FNL +L + V  + +
Sbjct: 17  VEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQ 76

Query: 65  XXXXXXXXXXXXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSI---IEHAAEQLYGLI 121
                                         DEL     +A++R+    +E  A +LYGLI
Sbjct: 77  VIQY------------------------MVDELDDTTLEAMSRTKLTQLEADARKLYGLI 112

Query: 122 HARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDL 181
           HARYI+T  GLQ M +K+   +F  CPR HC    LLP GL D  G   V+LYCPSC+DL
Sbjct: 113 HARYIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDL 172

Query: 182 YLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQ 241
           Y+P+SSR   ++GA++GTSFPG+FL+ F E+   V +     Y  KVFGF ++ +A   Q
Sbjct: 173 YIPKSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA---Q 226

Query: 242 RMKW 245
             +W
Sbjct: 227 LARW 230

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  165 bits (418), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 129/232 (55%), Gaps = 34/232 (14%)

Query: 18  DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXXXX 76
           DS  Y E WI  F  R GHEYFC+V T++I D FNL +L + V  + +            
Sbjct: 45  DSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYI------- 97

Query: 77  XXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHA---AEQLYGLIHARYILTKPGLQ 133
                             DEL     + ++RS +E     A +LYGLIHARYI+T  GLQ
Sbjct: 98  -----------------VDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIITVKGLQ 140

Query: 134 AMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLE 193
            M +K+   +FG CPR +C    LLP GL D  G   V+LYCPSC+DLY+P+SSR   ++
Sbjct: 141 KMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSSID 200

Query: 194 GAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245
           GA++GTSFPG+FL+ F E+   V +     Y  ++FGF+++ +A   Q  +W
Sbjct: 201 GAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQA---QLARW 246

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  164 bits (416), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 124/229 (54%), Gaps = 28/229 (12%)

Query: 18  DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXXXX 76
           DSG Y E WI  F  + GHEYFC++ TE+I D FNL +L + V  +              
Sbjct: 32  DSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKF-------------- 77

Query: 77  XXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMA 136
                    +V       +E + +         +E    +LYGLIHARYI+T  GLQ M 
Sbjct: 78  -------TTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKML 130

Query: 137 EKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAF 196
           +K+   +FG CPRYHC    LLP GL D  G   V+LYCPSC+DLY P+SSR   ++GA+
Sbjct: 131 QKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAY 190

Query: 197 WGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245
           +GTSFPG+FL+ F E+     +     Y  KVFGF ++ +A   Q  +W
Sbjct: 191 FGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA---QLTRW 233

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  160 bits (404), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 132/252 (52%), Gaps = 34/252 (13%)

Query: 1   MSQQFVEVPSHGELSDE------DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLT 53
           M+ +     S  EL DE      DS  Y + WI  F  R GHEYFC+V  E+I D FNL 
Sbjct: 8   MADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLI 67

Query: 54  SLSQEVPHYRKXXXXXXXXXXXXXXXXXXXXXMVGANNGQTDELVKKKAQAVNRSIIEHA 113
           +L + V  + +                     +V     + D+ + +         +E+ 
Sbjct: 68  NLQKTVSKFSQ---------------------VVQYIVDELDDSIVENMSKARLEQLEND 106

Query: 114 AEQLYGLIHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRL 173
           A + YGLIHARYI+T  GLQ M  K+   +FG C R +C    LLP GL D  G  +V+L
Sbjct: 107 ARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKL 166

Query: 174 YCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKI 233
           YCPSC+DLY P+SSR   ++GA++GTSFPG+FL+ F    D V +     Y  K+FGF++
Sbjct: 167 YCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAFP---DMVPKHPTARYVPKIFGFEL 223

Query: 234 NDRAVSGQRMKW 245
           + +A   Q  +W
Sbjct: 224 HKQA---QLTRW 232

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  159 bits (401), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 120/221 (54%), Gaps = 27/221 (12%)

Query: 25  WIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYRKXXXXXXXXXXXXXXXXXXXX 84
           WI  F  R GHEYFC+V  E+I D FNL +L + V  +                      
Sbjct: 38  WIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKF---------------------S 76

Query: 85  XMVGANNGQTDELVKKKAQAVNRSIIEHAAEQLYGLIHARYILTKPGLQAMAEKFDHKEF 144
            +V       D+ + +         +E  + +LYGLIHARYI+T  GLQ M  K+   +F
Sbjct: 77  YVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAKYKEADF 136

Query: 145 GTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGV 204
           G CPR +C   QLLP GL D  G   V+LYCPSC+DLY+P+SSR   ++GA++GTSFPG+
Sbjct: 137 GRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSFPGM 196

Query: 205 FLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQRMKW 245
           FL+ F    D V +     Y  K+FGF+++ +A   Q  +W
Sbjct: 197 FLQAF---PDMVPKHPTKRYVPKIFGFELHKQA---QLTRW 231

>Kwal_26.8595
          Length = 1034

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 9/83 (10%)

Query: 137  EKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLYLPQSSRFLCLEGAF 196
            E+ +    G C +YH   M     G+SD     TV  Y PSC+ + L Q S+        
Sbjct: 935  EEINETNNGDCEKYHVNDM-----GVSDA-DSGTVEQYIPSCEQIRLHQLSQE---RDPA 985

Query: 197  WGTSFPGVFLKHFKELEDYVGRK 219
            +  S     ++  K LE+ +G +
Sbjct: 986  YHASVKNTIIETLKYLEETLGSQ 1008

>YMR223W (UBP8) [4179] chr13 (716714..718129) Putative
           ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [1416 bp, 471 aa]
          Length = 471

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 5/68 (7%)

Query: 168 KYTVRLYCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELK 227
           K+   + C +C ++     + F+CL+  F G      FL H K++    G  + N     
Sbjct: 39  KFLNTMKCGTCHEI--NSGATFMCLQCGFCGCWNHSHFLSHSKQIGHIFGINSNNGL--- 93

Query: 228 VFGFKIND 235
           +F FK  D
Sbjct: 94  LFCFKCED 101

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,252,471
Number of extensions: 327139
Number of successful extensions: 651
Number of sequences better than 10.0: 17
Number of HSP's gapped: 643
Number of HSP's successfully gapped: 22
Length of query: 270
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 170
Effective length of database: 13,134,309
Effective search space: 2232832530
Effective search space used: 2232832530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)