Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.8d43343321130.0
KLLA0C11891g6171612082e-17
Kwal_56.233806551621896e-15
YDR085C (AFR1)6203121743e-13
AGR154C6282851405e-09
YER158C573831309e-08
CAGL0I08591g517811066e-05
Scas_459.1*648681066e-05
Sklu_2422.585289995e-04
Kwal_23.440093777900.007
YNL233W (BNI4)89272840.033
KLLA0D19723g82385820.052
ABL200W78972820.059
Scas_532.785170740.50
Scas_712.1070886701.4
AFR264W70785692.0
Sklu_2324.170183692.0
KLLA0F09097g52484682.7
CAGL0K08294g404125673.7
CAGL0J07480g97668664.3
KLLA0A00682g70882639.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.8d
         (433 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.8d                                                           818   0.0  
KLLA0C11891g complement(1021360..1023213) some similarities with...    85   2e-17
Kwal_56.23380                                                          77   6e-15
YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein inv...    72   3e-13
AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -...    59   5e-09
YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein...    55   9e-08
CAGL0I08591g complement(837496..839049) some similarities with s...    45   6e-05
Scas_459.1*                                                            45   6e-05
Sklu_2422.5 YNL233W, Contig c2422 10639-13197                          43   5e-04
Kwal_23.4400                                                           39   0.007
YNL233W (BNI4) [4373] chr14 (211921..214599) Protein involved in...    37   0.033
KLLA0D19723g complement(1661329..1663800) weakly similar to sp|P...    36   0.052
ABL200W [392] [Homologous to ScYNL233W (BNI4) - SH] complement(3...    36   0.059
Scas_532.7                                                             33   0.50 
Scas_712.10                                                            32   1.4  
AFR264W [3456] [Homologous to ScYGL245W - SH] complement(908583....    31   2.0  
Sklu_2324.1 YGL245W, Contig c2324 7-2112 reverse complement            31   2.0  
KLLA0F09097g complement(846171..847745) similar to sp|P41833 Sac...    31   2.7  
CAGL0K08294g complement(824619..836744) similar to sp|P36022 Sac...    30   3.7  
CAGL0J07480g complement(720484..723414) similar to sp|P53858 Sac...    30   4.3  
KLLA0A00682g 67685..69811 highly similar to sp|P46655 Saccharomy...    29   9.0  

>Scas_636.8d
          Length = 433

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/433 (95%), Positives = 415/433 (95%)

Query: 1   MSIQRPQSTMDFIEIPXXXXXXXXXXXXXXXXXXDFDKIHQLQSGISSNYDKFQTAADIK 60
           MSIQRPQSTMDFIEIP                  DFDKIHQLQSGISSNYDKFQTAADIK
Sbjct: 1   MSIQRPQSTMDFIEIPKSRKLKKSKSLSNLKLSRDFDKIHQLQSGISSNYDKFQTAADIK 60

Query: 61  QKGLTVRSKSLYDLSKSRPKNISAFQPSLHLIKEPLVIEKTDLHLTPRDMPSTPISKDNS 120
           QKGLTVRSKSLYDLSKSRPKNISAFQPSLHLIKEPLVIEKTDLHLTPRDMPSTPISKDNS
Sbjct: 61  QKGLTVRSKSLYDLSKSRPKNISAFQPSLHLIKEPLVIEKTDLHLTPRDMPSTPISKDNS 120

Query: 121 STFSNAHKKMTIERNSAEVSMRPSPLSESKTVNKHERQENRFFKKASSIIRSSFKKNWHS 180
           STFSNAHKKMTIERNSAEVSMRPSPLSESKTVNKHERQENRFFKKASSIIRSSFKKNWHS
Sbjct: 121 STFSNAHKKMTIERNSAEVSMRPSPLSESKTVNKHERQENRFFKKASSIIRSSFKKNWHS 180

Query: 181 QKIHTAKDMKFDDNNNEPLRKIRPLSIQFHGNIDVAIDEDDFSMNIDYIFDNILSRLDSN 240
           QKIHTAKDMKFDDNNNEPLRKIRPLSIQFHGNIDVAIDEDDFSMNIDYIFDNILSRLDSN
Sbjct: 181 QKIHTAKDMKFDDNNNEPLRKIRPLSIQFHGNIDVAIDEDDFSMNIDYIFDNILSRLDSN 240

Query: 241 GSTEFETAKNRETNESNEDYLNISQPSEESVPEEMNPDYVDTDLIEEFDDLAYLITSPSI 300
           GSTEFETAKNRETNESNEDYLNISQPSEESVPEEMNPDYVDTDLIEEFDDLAYLITSPSI
Sbjct: 241 GSTEFETAKNRETNESNEDYLNISQPSEESVPEEMNPDYVDTDLIEEFDDLAYLITSPSI 300

Query: 301 LTPPPRSERRPRGMDKTISRRYHHHNRPLLVRLKEEWETVHIGESPDTRKTNKSDAATPK 360
           LTPPPRSERRPRGMDKTISRRYHHHNRPLLVRLKEEWETVHIGESPDTRKTNKSDAATPK
Sbjct: 301 LTPPPRSERRPRGMDKTISRRYHHHNRPLLVRLKEEWETVHIGESPDTRKTNKSDAATPK 360

Query: 361 TVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQ 420
           TVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQ
Sbjct: 361 TVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQ 420

Query: 421 VHEDSKQYTQLLS 433
           VHEDSKQYTQLLS
Sbjct: 421 VHEDSKQYTQLLS 433

>KLLA0C11891g complement(1021360..1023213) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c singleton,
           hypothetical start
          Length = 617

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/161 (33%), Positives = 80/161 (49%), Gaps = 16/161 (9%)

Query: 281 DTDLIEEFDDLAYLITSPSILTPPPRSERRPRGMDKTISRRYHHHNRP-------LLVRL 333
           D  LI +F++   +  SP  + PP RS +RP  +     R  HHHN         ++  L
Sbjct: 463 DIALINQFNESTRI--SPPTVEPPLRSSKRPLLVKDYQGRLIHHHNNGQTTHSDRIIEHL 520

Query: 334 KEEWETVHIGES-PDTRKTNKSDA-ATPKTVRFDTDIYVDDTWSPLEYERHGTTIARNMK 391
            + W+ VH     P   ++N S +  + K  RF+ +IYV+DT+SP EY R       + K
Sbjct: 521 HQNWKAVHFNAVVPSVVRSNDSSSPVSAKKCRFNEEIYVNDTFSPTEYLRSDKAFPESRK 580

Query: 392 EMVRLIQRDHVFIDNIKREINYFKMYEMQVHEDSKQYTQLL 432
           ++ +       +ID IK E+N FK  EM VH +S QYT   
Sbjct: 581 QLSK-----SRYIDGIKMELNEFKKREMLVHPNSSQYTHFF 616

>Kwal_56.23380
          Length = 655

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 76/162 (46%), Gaps = 22/162 (13%)

Query: 280 VDTDLIEEFDDLAYLIT-----SPSILTPPPRSERRPRGMDKTISRRYHHHNRP------ 328
           +D DLI EF  L   IT       +   PPPRS++RPR  +K     ++ H         
Sbjct: 492 IDQDLIREFSRLGSFITDGITHQQTASVPPPRSQKRPRLSNKESVVGFYRHQASQNHLAL 551

Query: 329 -----LLVRLKEEWETVHIGESPDTRKTNKSDAATPKTVRFDTDIYVDDTWSPLEYERHG 383
                L   L+ +WE+V+     D      +D    K +RF T +YV DT++  EYER  
Sbjct: 552 DPDERLAHSLQRDWESVYY----DAVVATSTDVTAGKKLRFSTAVYVKDTYAAAEYERSD 607

Query: 384 TTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQVHEDS 425
               R  + M++   ++  +I+ +  ++N FK  EM+VH  S
Sbjct: 608 KKFIRTRRRMMQT--KNMAYIEAVTSQLNQFKKGEMKVHGAS 647

>YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein
           involved in morphogenesis of the mating projection
           (shmoo) [1863 bp, 620 aa]
          Length = 620

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 54/312 (17%)

Query: 165 KASSIIRSSFKKNWHSQKIHTAKDMK-----------FDDNNNEPLRKIRPLSIQFHGNI 213
           K  S+++  ++ + +S   H  KD K             D N+E    I  +     G  
Sbjct: 318 KLGSVLKKLWRTSGNSNTKHGKKDTKRRRIPIDDMVTHSDGNSEAENDIELMDANLDG-- 375

Query: 214 DVAIDEDDFSMNIDYIFDNILSRLDSNGSTEFETAKNR----ETNESNEDYLNISQPSEE 269
            +  D+D+  M+ D IFD++LS+ +          + R    ET+ +++  ++     + 
Sbjct: 376 -IEFDDDETLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHETSHNDDGKVSFRDTEKH 434

Query: 270 SVPEEMNPDYVDTDLIEEFDDLA-YLITSPSILTPPPRSERRPRGMDKTISRRYH----- 323
           +V E +    +D  +IEEF  L  Y+I + +   PPPRS +RP  +D   S RY      
Sbjct: 435 NVNEGL----IDKTIIEEFSKLGEYIIDTRN--QPPPRSSKRP-SLDDNESARYFYNIST 487

Query: 324 --------------HHNRPLLVRLKEEWETVHIGESPDTRKTNKSDAA-TP-----KTVR 363
                         H    ++ RL+ +WE +   +  ++   +  D   TP     K VR
Sbjct: 488 DLRQSLSGPISLPMHVGNDMVNRLRNDWEYIRFEDRRNSLPDSSFDKVETPPKPIKKDVR 547

Query: 364 FDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRD---HVFIDNIKREINYFKMYEMQ 420
           F  ++ +  TWS   YER       N   ++ +++     +  ++ IK E+N +K  EM 
Sbjct: 548 FAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMNEIKLELNSYKKNEMV 607

Query: 421 VHEDSKQYTQLL 432
           VHE+SK +T  L
Sbjct: 608 VHENSKCFTHYL 619

>AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -
           SH] (1038731..1040617) [1887 bp, 628 aa]
          Length = 628

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 112/285 (39%), Gaps = 86/285 (30%)

Query: 224 MNIDYIFDNIL--------SRLDSNGSTEFETAKNRETNESNEDYLNISQPSEESVPEEM 275
            +ID +FD +L         + D  G  + E+ K ++      D    +  +  S+  E+
Sbjct: 353 FDIDLVFDTLLLKSDRHDEPKKDCKGLAKEESTKTKQCVVIKHDTPPAA--NRTSLTHEL 410

Query: 276 NPDYVDTDLIEEFDDLAYLITSPS----------------ILTPPPRSERRPRGMDKTIS 319
                D +LI EF  L   I + +                 LTPPPRS RRP      +S
Sbjct: 411 -----DYELIHEFSKLGEYIRTGTEGQELGATLLSLSSFSNLTPPPRSNRRPVFRQPDVS 465

Query: 320 RRYHHHNRPL-----------------------LVRLKEEWETVHIGES----------- 345
           + ++H N  L                       L  L++ W+ VH+ E+           
Sbjct: 466 QSFYHSNMTLSPDFAKGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPRQSSPSKSI 525

Query: 346 ----PDTRKTNKS--------DAA----TPKTVRFDTDIYVDDTWSPLEYERHGTTIARN 389
               P     N S        D+A    + K + F   IYV+DT+S  +Y R   +  R 
Sbjct: 526 ISSQPSLEFANSSSSRSSSPLDSAKSVKSTKRIEFSDVIYVNDTYSHWDYRR---SDKRF 582

Query: 390 MKEMVRLIQRDHV--FIDNIKREINYFKMYEMQVHEDSKQYTQLL 432
           ++E  +L+   H   F+  +K E+N +K +EM VH +S Q TQ  
Sbjct: 583 LRERKQLMTSAHGLPFVQAVKWELNEYKRHEMMVHPESMQNTQFF 627

>YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein of
           unknown function [1722 bp, 573 aa]
          Length = 573

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 43/83 (51%), Gaps = 13/83 (15%)

Query: 360 KTVRFDTDIYVDDTWSPLEYERHGTTIARNM-KEMVRLIQRDHVFIDN------------ 406
           K++RF  +IYV+DTWS  +Y R   T   N  K   + I     F+ N            
Sbjct: 487 KSLRFADEIYVNDTWSAADYCRCDNTFLNNFFKGKSQDITNPSTFVGNNLSSTKNISNIE 546

Query: 407 IKREINYFKMYEMQVHEDSKQYT 429
           IK E+N FK  EM+VH+DS +YT
Sbjct: 547 IKMEVNEFKRKEMRVHQDSAKYT 569

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 22/108 (20%)

Query: 273 EEMNPDYVDTDLIEEFDDLAYLITSPSILTPPPRSERRPRGMDKTISRRYH--------- 323
           E   P   D+ +++E   L      P +  PPPRS  RP   DK  ++ Y+         
Sbjct: 336 ETAVPSIKDSGIVQELTALGDNNRIPVL--PPPRSPNRPTLSDKRTTKLYYCSQDSSNED 393

Query: 324 ----HHNRPLLVRLKEEWETVHIGESPDTRKTNKSDAATPKTVRFDTD 367
                 +   L RL++EW TV++ + P T       A+ P ++   TD
Sbjct: 394 IAPEEKSTVFLKRLQDEWSTVYLNKLPLT-------ASVPSSLSTTTD 434

>CAGL0I08591g complement(837496..839049) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c, hypothetical
           start
          Length = 517

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 360 KTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDN-------IKREIN 412
           K +RF  ++ + DTW+P  YER   +   N  E+       +    N       IK+EIN
Sbjct: 437 KKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEIN 496

Query: 413 YFKMYEMQVHEDSKQYTQLLS 433
            FK  EM VHE S +YT +  
Sbjct: 497 EFKKNEMVVHEKSAKYTHIYC 517

>Scas_459.1*
          Length = 648

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 362 VRFDTDIYVDDTWSPLEYERH----GTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMY 417
           +RF  +I + +T+SP EY R      TT +     +V L  + H FI+ IK EIN +K  
Sbjct: 575 LRFAKEITISETYSPFEYLRADPDTSTTKSLYGDNLVYL--KGHGFINEIKFEINQYKRN 632

Query: 418 EMQVHEDS 425
           EM VHE S
Sbjct: 633 EMSVHEMS 640

>Sklu_2422.5 YNL233W, Contig c2422 10639-13197
          Length = 852

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 45/89 (50%), Gaps = 10/89 (11%)

Query: 345 SPDTRKTNKSDA-ATPKTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVF 403
           SP T  T+ +    T + V F + I + DT+S  EY+RH   IA   +   +L Q     
Sbjct: 773 SPQTNITSSTSVRGTKRVVEFSSRIILYDTYSEYEYDRH-PDIATCNQLTPQLAQM---- 827

Query: 404 IDNIKREINYFKMYEMQVHEDSKQYTQLL 432
              IK E+N  K  EM++HEDSK YT   
Sbjct: 828 ---IKDELNELK-NEMEIHEDSKCYTHFF 852

>Kwal_23.4400
          Length = 937

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 356 AATPKTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFK 415
           A T KTV F ++I +  T++  EY+RH         ++    Q        IK E+N  K
Sbjct: 870 AHTQKTVSFSSNIMLFATYTESEYDRH--------PDVATCNQLTPQLAQIIKEELNTLK 921

Query: 416 MYEMQVHEDSKQYTQLL 432
             EM VHE+S+ YT   
Sbjct: 922 A-EMDVHEESRCYTHFF 937

>YNL233W (BNI4) [4373] chr14 (211921..214599) Protein involved in
           linking chitin synthase III to septins of the neck
           filaments [2679 bp, 892 aa]
          Length = 892

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 9/72 (12%)

Query: 360 KTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEM 419
           + VRF + I + DT+   EY+RH         E+    Q        IK E+N  K   M
Sbjct: 829 QGVRFSSQIILYDTYGEFEYDRH--------PEISTCNQLTPQLAQMIKLELNELKSA-M 879

Query: 420 QVHEDSKQYTQL 431
           +VH+DS+ YT  
Sbjct: 880 EVHDDSRCYTHF 891

>KLLA0D19723g complement(1661329..1663800) weakly similar to
           sp|P53858 Saccharomyces cerevisiae YNL233w BNI4 bud neck
           involved singleton, hypothetical start
          Length = 823

 Score = 36.2 bits (82), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 9/85 (10%)

Query: 348 TRKTNKSDAATPKTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNI 407
           ++K+ +  +   K V+F + I + +T+  LEY+RH  +   N        Q        I
Sbjct: 748 SKKSEERSSYAAKLVKFSSQIVLYETYGELEYDRHPDSATCN--------QLTPQLAQMI 799

Query: 408 KREINYFKMYEMQVHEDSKQYTQLL 432
           K E+N  K  EM +HEDS   T   
Sbjct: 800 KDELNELKA-EMDIHEDSMCNTHFF 823

>ABL200W [392] [Homologous to ScYNL233W (BNI4) - SH]
           complement(33854..36223) [2370 bp, 789 aa]
          Length = 789

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 360 KTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEM 419
           ++V F T I + DT++  EY+R    IA   +   +L Q        IK E+N  K  EM
Sbjct: 726 RSVHFSTRILLHDTYTEDEYDRR-PDIATCNQLTPQLAQL-------IKEELNQVK-SEM 776

Query: 420 QVHEDSKQYTQL 431
           ++HEDS+ YT  
Sbjct: 777 EIHEDSRCYTHF 788

>Scas_532.7
          Length = 851

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 9/70 (12%)

Query: 362 VRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQV 421
           + F + I + +T+   EY+RH         E+    Q        IK E+N  K   M +
Sbjct: 790 IHFSSSILLYETYGEFEYDRH--------PELATCNQLTPQLAQMIKVELNDLKST-MDI 840

Query: 422 HEDSKQYTQL 431
           HEDS+ YT  
Sbjct: 841 HEDSRCYTHF 850

>Scas_712.10
          Length = 708

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 42  LQSGISSNYD--KFQTAADIKQKGLTVRSKSLYDLSKSRPKNISAFQPSLHL-----IKE 94
           +  G+ SN+D  +F T   ++++G+TV     + LS+   +N+   + +L       + +
Sbjct: 447 VDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVID 506

Query: 95  PL------VIEKTDLHLTPRDMPSTP 114
           P+      ++    +HL   D+P TP
Sbjct: 507 PVAPRHTAIVNPVKIHLEGDDVPQTP 532

>AFR264W [3456] [Homologous to ScYGL245W - SH]
           complement(908583..910706) [2124 bp, 707 aa]
          Length = 707

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 13/85 (15%)

Query: 46  ISSNYD--KFQTAADIKQKGLTVRSKSLYDLSKSRPKNISAFQPSLHLI----------- 92
           + SN+D  +F T   ++++G+T+     + LS+   +N+   + +L              
Sbjct: 450 VVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAP 509

Query: 93  KEPLVIEKTDLHLTPRDMPSTPISK 117
           +  +V     LHL   D+P TP+++
Sbjct: 510 RHTVVTNPVKLHLNGADVPQTPLTE 534

>Sklu_2324.1 YGL245W, Contig c2324 7-2112 reverse complement
          Length = 701

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 13/83 (15%)

Query: 45  GISSNYD--KFQTAADIKQKGLTVRSKSLYDLSKSRPKNISAFQPSLHL-----IKEPL- 96
           G  SN+D  +F T   ++++G+TV     + LS+   +N+   + +L       + +P+ 
Sbjct: 449 GCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPVA 508

Query: 97  -----VIEKTDLHLTPRDMPSTP 114
                V++   LHL   D+P  P
Sbjct: 509 PRHTAVVKPVKLHLEGDDVPQNP 531

>KLLA0F09097g complement(846171..847745) similar to sp|P41833
           Saccharomyces cerevisiae YGL192w IME4 positive
           transcription factor for IME2 singleton, start by
           similarity
          Length = 524

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 3/84 (3%)

Query: 95  PLVIE--KTDLHLTPRDMPSTPISKDNSSTFSNAHKKMTIERNSAEVSMRPSPLSESKTV 152
           P +IE   T +H  P   P T +S  + S     HK  T  R    +   P  L + K  
Sbjct: 230 PDIIECSNTHIHFIPNLKPQTDLSLGDCSYLDTCHKLSTC-RYVHYLQYYPESLQKQKIE 288

Query: 153 NKHERQENRFFKKASSIIRSSFKK 176
            + E+++   F        SSFKK
Sbjct: 289 EQKEQRKQYSFYTHGECCSSSFKK 312

>CAGL0K08294g complement(824619..836744) similar to sp|P36022
            Saccharomyces cerevisiae YKR054c DYN1 Dynein heavy chain
            cytosolic, hypothetical start
          Length = 4041

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 20/25 (80%)

Query: 331  VRLKEEWETVHIGESPDTRKTNKSD 355
            ++L +EWETV +G + D+ +T+K+D
Sbjct: 3998 IKLPQEWETVWLGFNKDSLRTHKND 4022

>CAGL0J07480g complement(720484..723414) similar to sp|P53858
           Saccharomyces cerevisiae YNL233w BNI4 bud neck involved,
           hypothetical start
          Length = 976

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 362 VRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDNIKREINYFKMYEMQV 421
           V F ++I + +T+   EY+R    IA   +   +L Q        IK E+N  K  EM++
Sbjct: 915 VCFSSEILLFETYGEEEYDRR-PDIATCNQLTPQLAQM-------IKAELNEIK-DEMEI 965

Query: 422 HEDSKQYT 429
           HE+SK YT
Sbjct: 966 HEESKCYT 973

>KLLA0A00682g 67685..69811 highly similar to sp|P46655 Saccharomyces
           cerevisiae YGL245w, start by similarity
          Length = 708

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 13/82 (15%)

Query: 46  ISSNYD--KFQTAADIKQKGLTVRSKSLYDLSKSRPKNISAFQPSLHL-----IKEPL-- 96
           I SN+D  +F T   ++++G+T+     + LS+   +N+   + +L       + +P+  
Sbjct: 451 IVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWSFNKKVIDPVAP 510

Query: 97  ----VIEKTDLHLTPRDMPSTP 114
               ++    +HL   D+P TP
Sbjct: 511 RHTAIVSPVKVHLEGDDVPQTP 532

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,999,513
Number of extensions: 723640
Number of successful extensions: 2708
Number of sequences better than 10.0: 120
Number of HSP's gapped: 2674
Number of HSP's successfully gapped: 122
Length of query: 433
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 328
Effective length of database: 12,961,219
Effective search space: 4251279832
Effective search space used: 4251279832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)