Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.82012019641e-135
YDR084C1992016852e-92
CAGL0K09988g1962016843e-92
Kwal_56.233791951976253e-83
Sklu_501.11952006011e-79
AGR153C2012005533e-72
KLLA0C11869g1951965482e-71
Scas_694.9299108710.29
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.8
         (201 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.8                                                            375   e-135
YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein ...   268   2e-92
CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces c...   268   3e-92
Kwal_56.23379                                                         245   3e-83
Sklu_501.1 YDR084C, Contig c501 280-867                               236   1e-79
AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)...   217   3e-72
KLLA0C11869g complement(1020415..1021002) similar to sp|P38962 S...   215   2e-71
Scas_694.9                                                             32   0.29 

>Scas_636.8
          Length = 201

 Score =  375 bits (964), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/201 (91%), Positives = 184/201 (91%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60
           MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL
Sbjct: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60

Query: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120
           TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV
Sbjct: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120

Query: 121 WAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180
           WAVFGILCI                 TGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI
Sbjct: 121 WAVFGILCILRLKLFYLVLVVVAVFLTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180

Query: 181 PGLDNLQRMARFQSFFQGQSS 201
           PGLDNLQRMARFQSFFQGQSS
Sbjct: 181 PGLDNLQRMARFQSFFQGQSS 201

>YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spbc2a9.05cp [600 bp, 199 aa]
          Length = 199

 Score =  268 bits (685), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 149/201 (74%), Gaps = 4/201 (1%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60
           M+   NFYNTILKSSHP+LL  HLAGKA PIVFYIIGS+FL FT QFI VVLLL+FDFYL
Sbjct: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYL 60

Query: 61  TKNISGRKLVQLRWWYDSTTENTET-FRFESYKQYPPSLGPPINPIDSRLFWWSMYATPI 119
           TKNI+GRKLVQLRWWYDST  N ++ F FESYKQY P  GPPIN IDS+LFWWSMY TP+
Sbjct: 61  TKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAP--GPPINAIDSKLFWWSMYVTPV 118

Query: 120 VWAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNAD-NSTESWFQLP 178
           +W VF +LC+                 T WNTYGFRCCD+W+P +  +D   T +WF LP
Sbjct: 119 IWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALP 178

Query: 179 SIPGLDNLQRMARFQSFFQGQ 199
           S+PG +NL R+A  QSFFQ Q
Sbjct: 179 SVPGFENLSRLANIQSFFQRQ 199

>CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces
           cerevisiae YDR084c, start by similarity
          Length = 196

 Score =  268 bits (684), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 151/201 (75%), Gaps = 5/201 (2%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60
           M+H+ NFY+TIL+SSHP+L+  HLAGKAAP+ FYI G LF  FTA FI +VLLLA DFY 
Sbjct: 1   MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYF 60

Query: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120
           TKNISGR+LVQLRWWYDS+  +TETF FES+KQY  + GPPINPIDS+LFWWSMY TP +
Sbjct: 61  TKNISGRRLVQLRWWYDSSATSTETFTFESHKQY--TAGPPINPIDSKLFWWSMYLTPAI 118

Query: 121 WAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180
           W V GIL I                 TGWNTYGFRCCD+W+P   N   STE +FQLPSI
Sbjct: 119 WFVLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNP---NNSQSTEPFFQLPSI 175

Query: 181 PGLDNLQRMARFQSFFQGQSS 201
           PGLDN+ R+ARFQSFFQ  ++
Sbjct: 176 PGLDNITRLARFQSFFQSAAN 196

>Kwal_56.23379
          Length = 195

 Score =  245 bits (625), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 142/197 (72%), Gaps = 4/197 (2%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60
           M+H  NFY TILKSSHP++L LH+AGKA P+V Y+IGS FL FTA FI V+LLLA DFYL
Sbjct: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHFITVLLLLAVDFYL 60

Query: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120
           TKNI+GRKLVQLRWWYDS++       FESYK+Y P  GPPINP+DS+LFWWS+Y +P +
Sbjct: 61  TKNINGRKLVQLRWWYDSSSSKDSPLTFESYKEYAP--GPPINPVDSKLFWWSLYVSPAL 118

Query: 121 WAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180
           W +FG+LC+                 TGWN +GFR CDKWDP A ++   TE+WFQLP+I
Sbjct: 119 WVIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSK--TETWFQLPNI 176

Query: 181 PGLDNLQRMARFQSFFQ 197
              +NL R A  Q+FF+
Sbjct: 177 ATFENLGRFATVQNFFR 193

>Sklu_501.1 YDR084C, Contig c501 280-867
          Length = 195

 Score =  236 bits (601), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 139/200 (69%), Gaps = 6/200 (3%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFL-GFTAQFICVVLLLAFDFY 59
           M+ + NFY TILKSSHP++L LHL GKAAPI+ Y++GS F+  F A FI V+LLLA DFY
Sbjct: 1   MDQIKNFYETILKSSHPLILSLHLLGKAAPILSYLLGSWFIHSFAALFILVILLLAADFY 60

Query: 60  LTKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPI 119
           LTKNISGRKLVQLRWWYDS  +    F FESYKQYP   G PINPIDS+LFWWS+Y TP+
Sbjct: 61  LTKNISGRKLVQLRWWYDSMGQAKTPFTFESYKQYPA--GNPINPIDSKLFWWSIYLTPV 118

Query: 120 VWAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPS 179
           VWA+FGILCI                  GWN +GFR CDKW+P     D+   SW  LP+
Sbjct: 119 VWAIFGILCILKFQFLYLLLVVLALGLNGWNAHGFRSCDKWEP---GQDSGNNSWIXLPN 175

Query: 180 IPGLDNLQRMARFQSFFQGQ 199
           +  L+NL R+ARF SFFQ  
Sbjct: 176 LSSLENLSRIARFXSFFQSN 195

>AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)
           [606 bp, 201 aa]
          Length = 201

 Score =  217 bits (553), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 142/200 (71%), Gaps = 4/200 (2%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICV-VLLLAFDFY 59
           M+ + NFY+TI+KSSHP++L LHLAGKA P+ FY++G  F+ +T+ F+ + +LLLA DFY
Sbjct: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60

Query: 60  LTKNISGRKLVQLRWWYDST--TENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYAT 117
           LTKNISGRKLV LRWW+++T   E+   F FESYKQYP   GP +NPIDS+LFW S YA 
Sbjct: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120

Query: 118 PIVWAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNADNSTESWFQL 177
           P +WA+FG+LC+                 TG+N YGFR CD+W+P  K+++ S+  W Q+
Sbjct: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSS-IWPQM 179

Query: 178 PSIPGLDNLQRMARFQSFFQ 197
           P+   ++N+QR+  FQ+FF+
Sbjct: 180 PTFTNVENIQRLFTFQTFFR 199

>KLLA0C11869g complement(1020415..1021002) similar to sp|P38962
           Saccharomyces cerevisiae YDR084c singleton, start by
           similarity
          Length = 195

 Score =  215 bits (548), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 125/196 (63%), Gaps = 4/196 (2%)

Query: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICVVLLLAFDFYL 60
           M+   NFY TIL SSHP++L +HL GKA PIVFY++GS FL  T QFI V+L LA DFY 
Sbjct: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQFIIVILTLAADFYF 60

Query: 61  TKNISGRKLVQLRWWYDSTTENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYATPIV 120
           TKNI+GRKL+Q RWWYD + E+T TFRFES+K+YP     PINPIDS+LFW S+Y  P +
Sbjct: 61  TKNINGRKLIQQRWWYDVSGEDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVAPTI 120

Query: 121 WAVFGILCIXXXXXXXXXXXXXXXXXTGWNTYGFRCCDKWDPIAKNADNSTESWFQLPSI 180
           W VFG LC+                   WN Y +R CD+W+P       +    FQLP +
Sbjct: 121 WVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEP----GHTAEAPLFQLPML 176

Query: 181 PGLDNLQRMARFQSFF 196
           P   NL R+ R QSFF
Sbjct: 177 PSFANLDRVTRLQSFF 192

>Scas_694.9
          Length = 299

 Score = 32.0 bits (71), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 18/108 (16%)

Query: 3   HLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGF---TAQFICVVLLLAFDFY 59
           H S    ++LK   P++LG+  AG+       ++G +  G    T+Q+   VL+  +DF 
Sbjct: 18  HFSPVPLSVLKGDSPVILGVDEAGRGP-----VLGPMVYGISYCTSQYQDEVLIPHYDFD 72

Query: 60  LTKNISG-------RKLVQLRWWYD---STTENTETFRFESYKQYPPS 97
            +K ++         K+ + R   D   +TT  T T       ++PPS
Sbjct: 73  DSKKLTDAVRRDLFHKMYETRDIEDVGYATTVITPTDISSGMLRFPPS 120

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,331,394
Number of extensions: 240615
Number of successful extensions: 753
Number of sequences better than 10.0: 12
Number of HSP's gapped: 732
Number of HSP's successfully gapped: 12
Length of query: 201
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 104
Effective length of database: 13,238,163
Effective search space: 1376768952
Effective search space used: 1376768952
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)