Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.161554155481720.0
CAGL0L11814g1576157356600.0
YER166W (DNF1)1571157456460.0
YDR093W (DNF2)1612153756100.0
Scas_576.81591159355490.0
CAGL0G08085g1578157753320.0
KLLA0C17644g1576153650740.0
AGR120C1547154649420.0
KLLA0A04015g1343106117590.0
Kwal_26.70701315107717490.0
CAGL0G06270g1328105517230.0
YAL026C (DRS2)1355106117000.0
ADR350W1311109916260.0
Sklu_2193.111439608931e-100
YIL048W (NEO1)115110248883e-99
Kwal_56.234672803118081e-97
Scas_704.38116110278691e-96
ADL079C11669428672e-96
Kwal_23.578911338918592e-95
CAGL0L00715g11449008582e-95
KLLA0C08393g11489298343e-92
CAGL0H04477g16265448314e-90
KLLA0E01650g15505468197e-89
Kwal_23.355615975428127e-88
AFL191W15755377966e-86
YMR162C (DNF3)16565467896e-85
Scas_669.316385457441e-79
Scas_505.410253705834e-61
Scas_89.12712863971e-42
Kwal_47.1754712406551655e-11
CAGL0M11308g14523241648e-11
AFR567W14493221638e-11
Scas_665.3014393271621e-10
Kwal_26.920714693451541e-09
KLLA0B08217g14393241476e-09
CAGL0L01419g12143281413e-08
AFR354C12103241404e-08
CAGL0A00517g11226651395e-08
YGL006W (PMC1)11731881371e-07
KLLA0A08910g12803711315e-07
YEL031W (SPF1)12153251307e-07
Scas_583.14*8753151298e-07
AFL011W12426491243e-06
KLLA0E22352g12063221201e-05
YOR291W14723301201e-05
Kwal_14.14989392831128e-05
CAGL0I04312g9512151092e-04
KLLA0E14630g1082424980.003
Kwal_23.31601100839980.004
AEL301W957198970.005
KLLA0F20658g1082182950.008
KLLA0A03157g938439940.009
YDR040C (ENA1)1091292890.044
YGL167C (PMR1)950210870.073
Scas_297.180067860.075
Scas_710.4190458850.13
YDR039C (ENA2)1091294840.14
YDR038C (ENA5)1091294840.15
CAGL0A00495g90258840.16
Scas_688.191358840.17
YPL036W (PMA2)94758820.23
YGL008C (PMA1)91858820.25
AGL085C90958800.48
AGL097C1096174800.52
Scas_707.48*741205790.52
Kwal_47.1752289958780.72
KLLA0A09031g89958780.85
YJL103C618129761.1
CAGL0J01870g94661771.1
AGL041C123373752.0
CAGL0K12034g1087411733.1
YOR243C (PUS7)67648705.9
Scas_715.47d533126706.1
Scas_569.0d468145698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.16
         (1554 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.16                                                          3152   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...  2184   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...  2179   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...  2165   0.0  
Scas_576.8                                                           2142   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...  2058   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...  1959   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...  1908   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   682   0.0  
Kwal_26.7070                                                          678   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   668   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   659   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   630   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         348   e-100
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   346   3e-99
Kwal_56.23467                                                         315   1e-97
Scas_704.38                                                           339   1e-96
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   338   2e-96
Kwal_23.5789                                                          335   2e-95
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   335   2e-95
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   325   3e-92
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   324   4e-90
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   320   7e-89
Kwal_23.3556                                                          317   7e-88
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   311   6e-86
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   308   6e-85
Scas_669.3                                                            291   1e-79
Scas_505.4                                                            229   4e-61
Scas_89.1                                                             157   1e-42
Kwal_47.17547                                                          68   5e-11
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    68   8e-11
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    67   8e-11
Scas_665.30                                                            67   1e-10
Kwal_26.9207                                                           64   1e-09
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    61   6e-09
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    59   3e-08
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    59   4e-08
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    58   5e-08
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    57   1e-07
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    55   5e-07
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    55   7e-07
Scas_583.14*                                                           54   8e-07
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    52   3e-06
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    51   1e-05
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    51   1e-05
Kwal_14.1498                                                           48   8e-05
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    47   2e-04
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    42   0.003
Kwal_23.3160                                                           42   0.004
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    42   0.005
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    41   0.008
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    41   0.009
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    39   0.044
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    38   0.073
Scas_297.1                                                             38   0.075
Scas_710.41                                                            37   0.13 
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    37   0.14 
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    37   0.15 
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    37   0.16 
Scas_688.1                                                             37   0.17 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    36   0.23 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    36   0.25 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    35   0.48 
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    35   0.52 
Scas_707.48*                                                           35   0.52 
Kwal_47.17522                                                          35   0.72 
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    35   0.85 
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    34   1.1  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    34   1.1  
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    33   2.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    33   3.1  
YOR243C (PUS7) [5032] chr15 complement(790211..792241) Member of...    32   5.9  
Scas_715.47d                                                           32   6.1  
Scas_569.0d                                                            31   8.1  

>Scas_636.16
          Length = 1554

 Score = 3152 bits (8172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1519/1554 (97%), Positives = 1519/1554 (97%)

Query: 1    MSRSPFQDRGHDRENPLSPFDDSFQFEDKDKTNSFLKGDAVTVEDVEETKYDDSSSILPT 60
            MSRSPFQDRGHDRENPLSPFDDSFQFEDKDKTNSFLKGDAVTVEDVEETKYDDSSSILPT
Sbjct: 1    MSRSPFQDRGHDRENPLSPFDDSFQFEDKDKTNSFLKGDAVTVEDVEETKYDDSSSILPT 60

Query: 61   PVVGGTAQFEDIELNSELPNSSETEMKRLRLGTKRVKRETNFDRNKTKTIKWAQKNVHIP 120
            PVVGGTAQFEDIELNSELPNSSETEMKRLRLGTKRVKRETNFDRNKTKTIKWAQKNVHIP
Sbjct: 61   PVVGGTAQFEDIELNSELPNSSETEMKRLRLGTKRVKRETNFDRNKTKTIKWAQKNVHIP 120

Query: 121  FKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTP 180
            FKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTP
Sbjct: 121  FKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTP 180

Query: 181  LTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDS 240
            LTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPG                   EDS
Sbjct: 181  LTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVIIILTAIKDAIEDS 240

Query: 241  RRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATGX 300
            RRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATG 
Sbjct: 241  RRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATGK 300

Query: 301  XXXXXXXXXXXXXXXLGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENGEISVL 360
                           LGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENGEISVL
Sbjct: 301  EARKQRQMKRRRAKKLGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENGEISVL 360

Query: 361  DPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGE 420
            DPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGE
Sbjct: 361  DPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGE 420

Query: 421  SNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPIT 480
            SNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPIT
Sbjct: 421  SNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPIT 480

Query: 481  INNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLF 540
            INNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLF
Sbjct: 481  INNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLF 540

Query: 541  ILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISV 600
            ILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISV
Sbjct: 541  ILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISV 600

Query: 601  EIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKK 660
            EIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKK
Sbjct: 601  EIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKK 660

Query: 661  CTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYP 720
            CTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYP
Sbjct: 661  CTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYP 720

Query: 721  EELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDE 780
            EELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDE
Sbjct: 721  EELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDE 780

Query: 781  TALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEK 840
            TALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEK
Sbjct: 781  TALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEK 840

Query: 841  DEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWS 900
            DEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWS
Sbjct: 841  DEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWS 900

Query: 901  EYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEA 960
            EYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEA
Sbjct: 901  EYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEA 960

Query: 961  GIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYL 1020
            GIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYL
Sbjct: 961  GIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYL 1020

Query: 1021 MEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVL 1080
            MEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVL
Sbjct: 1021 MEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVL 1080

Query: 1081 CCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDY 1140
            CCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDY
Sbjct: 1081 CCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDY 1140

Query: 1141 AIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTY 1200
            AIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTY
Sbjct: 1141 AIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTY 1200

Query: 1201 LTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQS 1260
            LTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQS
Sbjct: 1201 LTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQS 1260

Query: 1261 VICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFF 1320
            VICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFF
Sbjct: 1261 VICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFF 1320

Query: 1321 AFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMK 1380
            AFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMK
Sbjct: 1321 AFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMK 1380

Query: 1381 YLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCAS 1440
            YLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCAS
Sbjct: 1381 YLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCAS 1440

Query: 1441 DSQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSS 1500
            DSQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSS
Sbjct: 1441 DSQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSS 1500

Query: 1501 SSRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDLPGVTHAEMLLRGSTSKDK 1554
            SSRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDLPGVTHAEMLLRGSTSKDK
Sbjct: 1501 SSRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDLPGVTHAEMLLRGSTSKDK 1554

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 2184 bits (5660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1057/1573 (67%), Positives = 1261/1573 (80%), Gaps = 50/1573 (3%)

Query: 18   SPFDDSFQFEDKDKT--NSFLKGDAVT-----------VEDVEETKYDDS----SSILPT 60
            SPFDD+F+FE+ D T  NS   G+  T           +E+ E T  DD+    SSI PT
Sbjct: 15   SPFDDAFEFEEGDNTVNNSSSNGNGHTSGSGNWNDGHKMEEKETTLADDTDIEISSIQPT 74

Query: 61   PVVGG--TAQFEDIELNSELPNSSETEMKRLRLGTKRVK-RETNF-DRNKTKTIKWAQKN 116
            P +GG  T  F+D+ L+++  N S  EMKRLR+GT+RVK  ++ F + ++ KT+KWA+KN
Sbjct: 75   PHLGGAKTGMFDDVALDNDDHNDSSREMKRLRMGTRRVKGHKSQFGNMSRNKTLKWAKKN 134

Query: 117  VHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTT 176
            +  PF     D + +++ +   NR+D+ RT+YHN+PLP+EML E+G PIMEYPRNKIRTT
Sbjct: 135  IKNPFDDFSRDEEEENDRS--TNRADQLRTVYHNLPLPEEMLDEEGNPIMEYPRNKIRTT 192

Query: 177  KYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXX 236
            KYTPL+FFPKN++ QF NFAN+YFL++IILGAFQIFGVTNPG                  
Sbjct: 193  KYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITAIKDG 252

Query: 237  XEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFT 296
             EDSRRT+LD+EVNNTRTHIL+G  N NV +DNVS WR+FKKAN++L+++F Q+  ER T
Sbjct: 253  IEDSRRTILDLEVNNTRTHILEGVVNENVSVDNVSLWRRFKKANSRLLMQFIQWCKERMT 312

Query: 297  ATGXXXXXXXXXXXXXXXXLGKTELPRTSLDSYQSTRMSADYY-RPSLEQSNIDSTF-EN 354
              G                      PR SLDS  S R SADYY RPSL+  N+     E+
Sbjct: 313  EDGKRRRLQRQRRKLRKSTR-NGHGPRNSLDSMDSYRPSADYYNRPSLDYDNMGHIVGED 371

Query: 355  GEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVET 414
             ++ ++D +LPP  +++FA D+WK+V+VGDIVRIHNNDEIPAD+ILLSTSD DGGCYVET
Sbjct: 372  EDVDIIDRTLPPRTDTRFARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVET 431

Query: 415  KNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQT 474
            KNLDGE+NLKVRQ+L+C+  I+ SRDI RT+FW+ESEGPHANLY YQGNLKW DS + + 
Sbjct: 432  KNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNEL 491

Query: 475  HNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLI 534
             NEP+TINNMLLRGCTLRNTKWAMGIVVFTGDDTK M+NAGVTPTKKSRISRELNFSVLI
Sbjct: 492  RNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLI 551

Query: 535  NFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPI 594
            NF+ LFILC I+G+ANG  Y K PRSRDFFEFGT+AGNP TNGFVSFWVAVILYQSLVPI
Sbjct: 552  NFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPI 611

Query: 595  SLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQN 654
            SLYISVEIIKTAQA FIY DVLLYN +LDYPCTPKSW+ISDDLGQIEYIFSDKTGTLTQN
Sbjct: 612  SLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 671

Query: 655  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISN 714
            VMEFKKCTINGVSYGRAYTEALAGLRKRQGID E EGR E+E IA+DR++MI+DLR +SN
Sbjct: 672  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSN 731

Query: 715  NSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELT 774
            N+QF+P+E+TF+SKE  QD  G NG++Q+K C+HFMLALALCHSVL EP   +PNKLE+ 
Sbjct: 732  NTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMK 791

Query: 775  AQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKL 834
            AQSPDE ALVTTARD+GF F+GKTK G++VE+QGIQKEF+ILNILEFNS+RKRMSCI+K+
Sbjct: 792  AQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKEFEILNILEFNSARKRMSCIIKI 851

Query: 835  PPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQ 894
            P AT  DEPRALLICKGADSVIYSRLS K G NDETLLEKTALHLEQYATEGLRTLC+ Q
Sbjct: 852  PGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQ 911

Query: 895  REISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSI 954
            RE++WSEY EWN +Y+IAAASL  REE+L+ V+D IERDL+LLGGTAIEDRLQDGVP+SI
Sbjct: 912  RELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESI 971

Query: 955  ALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNA 1014
            ALLAEAGIKLWVLTGDKVETAINIGFSCNLLN DMELLV+KT GEDV E+G+DP E+VN+
Sbjct: 972  ALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNS 1031

Query: 1015 LVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCK 1074
            L+SKYL EKF ++GSE EL  AK DHS P+G+FA++IDG+ALKIALTGD MKRKFLLLCK
Sbjct: 1032 LISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCK 1091

Query: 1075 NCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQA 1134
            NCKAVLCCRVSPAQKAAVVKLVK+TLDVMTLAIGDGSNDVAMIQSADVG+GIAGEEGRQA
Sbjct: 1092 NCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQA 1151

Query: 1135 VMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSY 1194
            VMCSDYAIGQFRY+TRL+LVHG+W YKRL+EMIP+FFYKNVIFTLALFWYG++N+FDGSY
Sbjct: 1152 VMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSY 1211

Query: 1195 LFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMF 1254
            LFEYTYL FYNLAFTS+PVI LGILDQDV+ T+S++VPQLYR GILR EWNQTKFLWYMF
Sbjct: 1212 LFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLWYMF 1271

Query: 1255 DGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWD 1314
            DG+YQSVIC+FFPYL+Y++  ++T+NG+GL+HRYYVGI VT IAV +CN Y+L+ QYRWD
Sbjct: 1272 DGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQYRWD 1331

Query: 1315 WFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFT 1374
            WF+ FF FLS IV  GWTGIW+SS  S + WK   R+Y +PSFWAV+F+G  FC+LPRFT
Sbjct: 1332 WFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFT 1391

Query: 1375 YDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGD 1434
            +D + ++  PSDV+IIREMW+ GD+  YP  YDPTDPN+PK+ K  ++G      E +G 
Sbjct: 1392 WDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPNRPKISKGAKFG------ERLGQ 1445

Query: 1435 AVVCASD-------SQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSM 1487
             +V   +       S+ ++ TEEIPM+ +      ++   R  ++S  + D    + +S 
Sbjct: 1446 GIVLEDETYAGGNVSRDSVFTEEIPMNII----SGTDGTPRGFEMSGRTPDIPQTQWESP 1501

Query: 1488 NNARNSMQFRPSSS-------SRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDLPGVT 1540
                 ++   P ++         VR S+DRTRD MLA+ +LD RYSVDRAR SLDLPGVT
Sbjct: 1502 EREEQNLLNSPQANVGLGTFEQTVRQSIDRTRDSMLANRELDNRYSVDRARASLDLPGVT 1561

Query: 1541 HAEMLLRGSTSKD 1553
            HA  L+    S++
Sbjct: 1562 HAAALMEERKSRE 1574

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 2179 bits (5646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1051/1574 (66%), Positives = 1255/1574 (79%), Gaps = 46/1574 (2%)

Query: 6    FQDRGHDRENPLSPFDDSFQFEDK------------------------------DKTNSF 35
            F   GH    P+SPF+D+FQFED                               D+T   
Sbjct: 5    FHGDGH---APMSPFEDTFQFEDNSSNEDTHIAPTHFDDGATSNKYSRPQVSFNDETPKN 61

Query: 36   LKGDAVTVEDVEETKYDDSSSILPTPVVG-GTAQFEDIELNSEL--PNSSETEMKRLRLG 92
             + DA      ++T+YD+ S   PTP +  G+  F+D+EL+++   P+++   MKR R+G
Sbjct: 62   KREDAEEFTFNDDTEYDNHS-FQPTPKLNNGSGTFDDVELDNDSGEPHTNYDGMKRFRMG 120

Query: 93   TKRVKRETNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNMP 152
            TKR K+  N    ++KT+KWA+KN+  PF    ED   DD + G +NR+ E RT+Y+NMP
Sbjct: 121  TKRNKK-GNPIMGRSKTLKWARKNIPNPF----EDFTKDDIDPGAINRAQELRTVYYNMP 175

Query: 153  LPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIF 212
            LP +M+ E+G PIM+YPRNKIRTTKYTPLTF PKN++ QF+NFAN+YFL++IILGAFQIF
Sbjct: 176  LPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIF 235

Query: 213  GVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVSS 272
            GVTNPG                   EDSRRT+LD+EVNNT+THIL+G EN NV  DN+S 
Sbjct: 236  GVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDNISL 295

Query: 273  WRKFKKANTKLMLKFFQFINERFTATGXXXXXXXXXXXXXXXXLGKTELPRTSLDSYQST 332
            WR+FKKAN++L+ KF Q+  E  T  G                   T  PR+SLDS  S 
Sbjct: 296  WRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSIDSY 355

Query: 333  RMSADYYRPSLEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNND 392
            R+SADY RPSL+  N++     GE +++D SLPP  + KFA ++WK V+VGDIVRIHNND
Sbjct: 356  RVSADYGRPSLDYDNLEQG--AGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNND 413

Query: 393  EIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEG 452
            EIPAD+ILLSTSD DG CYVETKNLDGE+NLKVRQSL+CTN IR S+DI RTKFW+ESEG
Sbjct: 414  EIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEG 473

Query: 453  PHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMI 512
            PH+NLY YQGN+KW +  DG+  NEPITINN+LLRGCTLRNTKWAMG+V+FTG DTK M+
Sbjct: 474  PHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIML 533

Query: 513  NAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGN 572
            N+G+TPTKKSRISRELNFSV+INFV LFILC ++G+ANG YY KK RSR  +EFGTIAG+
Sbjct: 534  NSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGS 593

Query: 573  PTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWS 632
              TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVLLYN +LDYPCTPKSW+
Sbjct: 594  AATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWN 653

Query: 633  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGR 692
            ISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID E EGR
Sbjct: 654  ISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGR 713

Query: 693  IEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLA 752
             E+  IA+DR+ MID+LR +S NSQFYPEE+TFVSKEF +DL G +GEVQQ+ C+HFMLA
Sbjct: 714  REKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCCEHFMLA 773

Query: 753  LALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKE 812
            LALCHSVLVE + ++P KL+L AQSPDE ALV TARD+GFSF+GKTK+GL++E+QGIQKE
Sbjct: 774  LALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQGIQKE 833

Query: 813  FQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLL 872
            F+ILNILEFNSSRKRMSCIVK+P     DEPRALLICKGADS+IYSRLSR+ G N E +L
Sbjct: 834  FEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGSNSEAIL 893

Query: 873  EKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIER 932
            EKTALHLEQYATEGLRTLC+ QRE+SWSEY++WNEKY+IAAASLA RE+EL+ VAD IER
Sbjct: 894  EKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIER 953

Query: 933  DLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELL 992
            +L+LLGGTAIEDRLQDGVPD I LLAEAGIKLWVLTGDKVETAINIGFSCNLLN +MELL
Sbjct: 954  ELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELL 1013

Query: 993  VIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIID 1052
            VIKTTG+DVKEFG +P+EIV+AL+SKYL E FN+TGSEEE+  AKKDH  P+G +AI+ID
Sbjct: 1014 VIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVID 1073

Query: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSN 1112
            G+ALK+AL G+ ++RKFLLLCKNC+AVLCCRVSP+QKAAVVKLVKD+LDVMTLAIGDGSN
Sbjct: 1074 GDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSN 1133

Query: 1113 DVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFY 1172
            DVAMIQSADVG+GIAGEEGRQAVMCSDYAIGQFRY+ RLVLVHG+W YKRLAEMIP+FFY
Sbjct: 1134 DVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFY 1193

Query: 1173 KNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVP 1232
            KN+IF LALFWYG++NDFDGSYL+EYTY+ FYNLAFTSLPVIFLGILDQDV+ T+S++VP
Sbjct: 1194 KNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVP 1253

Query: 1233 QLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGI 1292
            QLYR GILR+EWNQ KFLWYM DG+YQS+IC+FFPYL+Y K  I+T NGLGLDHRY+VG+
Sbjct: 1254 QLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGV 1313

Query: 1293 PVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMY 1352
             VT IAV SCN YVL+ QYRWDWF+  F  LS +V F WTGIWSS+IAS EF+K A+R+Y
Sbjct: 1314 YVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFKAAARIY 1373

Query: 1353 GTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPN 1412
            G PSFWAV+FV  LFC+LPRFTYD F K+ YP+DVEI+REMWQHG F  YP  YDPTDPN
Sbjct: 1374 GAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGYDPTDPN 1433

Query: 1413 KPKVEKAHEWGQYKIVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDSSNQVTREKQV 1472
            +PKV KA + G+  I   ++ D +  ++ S+ ++VTEEIPM+F+  +  S +   +++  
Sbjct: 1434 RPKVTKAGQHGEKIIEGIALSDNLGGSNYSRDSVVTEEIPMTFMHGEDGSPSGYQKQETW 1493

Query: 1473 SRDSLDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDRTRDEMLASNQLDTRYSVDRARV 1532
                 +  D  +      + +  F    S+ VR+SLDRTR++M+A+NQLD RYSV+RAR 
Sbjct: 1494 MTSPKETQDLLQSP--QFQQAQTFGRGPSTNVRSSLDRTREQMIATNQLDNRYSVERART 1551

Query: 1533 SLDLPGVTHAEMLL 1546
            SLDLPGVT+A  L+
Sbjct: 1552 SLDLPGVTNAASLI 1565

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 2165 bits (5610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1046/1537 (68%), Positives = 1241/1537 (80%), Gaps = 38/1537 (2%)

Query: 36   LKGDAVTVEDVEETKYDDSSSILPTPVVGGTAQFEDIEL-NSELPNS---SETEMKRLRL 91
            L G    + + E    DD  S   TP+   T  FED+EL N+E  N+   ++ ++KR+R 
Sbjct: 96   LNGKKTEIHEHENEVDDDLHSFQATPM-PNTGGFEDVELDNNEGSNNDSQADHKLKRVRF 154

Query: 92   GTKRVKRETNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNM 151
            GT+R  +    D N++KT+KWA+KN H    +     D  +N + L NRSDE RT+Y+N+
Sbjct: 155  GTRR-NKSGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLEN-SALQNRSDELRTVYYNL 212

Query: 152  PLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQI 211
            PLP++ML EDGLP+  YPRNKIRTTKYTPLTFFPKN++ QF+NFANIYFLI++ILGAFQI
Sbjct: 213  PLPEDMLDEDGLPLAVYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQI 272

Query: 212  FGVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVS 271
            FGVTNPG                   EDSRRT+LD+EVNNTRTHIL G +N NV +DNVS
Sbjct: 273  FGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVKNENVAVDNVS 332

Query: 272  SWRKFKKANTKLMLKFFQFINERFTATGXXXXXXXXXXXXXXXXLGKTELPRTSLDSYQS 331
             WR+FKKANT+ ++K F++ +E  TA G                  ++  PR SLDS  S
Sbjct: 333  LWRRFKKANTRALIKIFEYFSENLTAAGREKKLQKKREELRRKRNSRSFGPRGSLDSIGS 392

Query: 332  TRMSADYYRPSLEQSNIDST------FENGEISVLDPSLPPMANSKFANDFWKNVRVGDI 385
             RMSAD+ RPSL+  N++ T      + +GE +++D +L P    +FA D+WKNV+VGDI
Sbjct: 393  YRMSADFGRPSLDYENLNQTMSQANRYNDGE-NLVDRTLQPNPECRFAKDYWKNVKVGDI 451

Query: 386  VRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTK 445
            VR+HNNDEIPAD+ILLSTSD+DG CYVETKNLDGE+NLKVRQSL+C+  I++SRDI RTK
Sbjct: 452  VRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDITRTK 511

Query: 446  FWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTG 505
            FWVESEGPHANLY YQGN KW D+ +G   NEP+ INN+LLRGCTLRNTKWAMG+V+FTG
Sbjct: 512  FWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTG 571

Query: 506  DDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFE 565
            DDTK MINAGVTPTKKSRISRELNFSV++NFV LFILC  AG+ NG YY++KPRSRD+FE
Sbjct: 572  DDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFE 631

Query: 566  FGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYP 625
            FGTI G+ +TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIY DVLLYN +LDYP
Sbjct: 632  FGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYP 691

Query: 626  CTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGI 685
            CTPKSW+ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+
Sbjct: 692  CTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGV 751

Query: 686  DTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKR 745
            D E EGR E+E IA+DRE MID+LR +S+N+QF PE+LTFVSKE  +DL G++G+ QQK 
Sbjct: 752  DVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGSSGDHQQKC 811

Query: 746  CQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVE 805
            C+HF+LALALCHSVLVEP+K+DP KL++ AQSPDE+ALV+TAR +G+SF+G +K GL+VE
Sbjct: 812  CEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGSSKSGLIVE 871

Query: 806  VQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPG 865
            +QG+QKEFQ+LN+LEFNSSRKRMSCI+K+P +T KDEP+ALLICKGADSVIYSRL R   
Sbjct: 872  IQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQ- 930

Query: 866  YNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDH 925
             ND TLLEKTALHLE+YATEGLRTLC+ QRE++WSEY+ W + Y++AAAS+  REEELD 
Sbjct: 931  -NDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDK 989

Query: 926  VADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 985
            V D+IER+L+LLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCN+L
Sbjct: 990  VTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVL 1049

Query: 986  NTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQG 1045
            N DMELLV+K +GEDV+EFG DP ++VN LV+KYL EKF M+GSEEEL  AK++H  PQG
Sbjct: 1050 NNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQG 1109

Query: 1046 EFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTL 1105
             FA+IIDG+ALK+AL G+ M+RKFLLLCKNCKAVLCCRVSPAQKAAVVKLVK TLDVMTL
Sbjct: 1110 NFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTL 1169

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE
Sbjct: 1170 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1229

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
            MIPQFFYKNVIFTL+LFWYG++N+FDGSYLFEYTYLTFYNLAFTS+PVI L +LDQDVS 
Sbjct: 1230 MIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSD 1289

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285
            TVSM+VPQLYR GILR+EWNQTKFLWYM DG+YQSVIC+FFPYL Y K  ++T+NGLGLD
Sbjct: 1290 TVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMVVTENGLGLD 1349

Query: 1286 HRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFW 1345
            HRY+VG+ VT IAVTSCNFYV MEQYRWDWF   F  LS  V++GWTGIW+SS +S EF+
Sbjct: 1350 HRYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLSLAVFYGWTGIWTSSSSSNEFY 1409

Query: 1346 KGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDD 1405
            KGA+R++  P++WAV FVG LFC+LPRFT D   K  YP D+EI+REMW  GDF  YP  
Sbjct: 1410 KGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRKIFYPKDIEIVREMWLRGDFDLYPQG 1469

Query: 1406 YDPTDPNKPKVEKAHEWGQYK--IVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDS- 1462
            YDPTDP++P++ +      +K  I  ++  D V   S SQ TIVTEEIPMS L+ ++ S 
Sbjct: 1470 YDPTDPSRPRINEIRPLTDFKEPISLDTHFDGV---SHSQETIVTEEIPMSILNGEQGSR 1526

Query: 1463 -----SNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDRTRDEMLA 1517
                 S  + R  Q+S  +   +  RR SM +AR          +++RTSLDRTR+EMLA
Sbjct: 1527 KGYRVSTTLERRDQLSPVTTTNNLPRR-SMASAR---------GNKLRTSLDRTREEMLA 1576

Query: 1518 SNQLDTRYSVDRARVSLDLPGVTHAEMLLRGSTSKDK 1554
            ++QLDTRYSV+RAR SLDLPG+ HAE LL    S+D+
Sbjct: 1577 NHQLDTRYSVERARASLDLPGINHAETLL-SQRSRDR 1612

>Scas_576.8
          Length = 1591

 Score = 2142 bits (5549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1042/1593 (65%), Positives = 1255/1593 (78%), Gaps = 52/1593 (3%)

Query: 4    SPFQDRGHDRENPLSPFDDSFQFEDKD-----------KTNSFLKGDAVTVEDVEETKYD 52
            +PF+D G+   NP+SPFDD+FQFED D             N+    +A   +    T +D
Sbjct: 6    NPFEDNGN---NPMSPFDDNFQFEDIDFDAQPNHSSNTTANNTSSSNAYHGDSTHLTSFD 62

Query: 53   DSS----------------SILPTPVVGGT-AQFEDIELNSELPN--------SSETEMK 87
            DS                 S  PTP +G +   F+DI L ++  +        +SE  MK
Sbjct: 63   DSKEKESLSFHEDVDNDIHSFEPTPRIGTSNGAFDDISLENDDHDPSSSHHHSTSENIMK 122

Query: 88   RLRLGTKRVKRETNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTI 147
            RLR+GT+R K+       + KT+KWAQK    PF++ +   D+ D + GL NR+ E RT+
Sbjct: 123  RLRMGTQRNKKGKP-TVGRAKTLKWAQKTFVNPFEESNNRDDIFD-DAGLTNRASELRTV 180

Query: 148  YHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILG 207
            Y+NMPLP EM+ EDG PI +YPRNKIRTTKY+PL FFPKN+M QF NFAN+YFL++IILG
Sbjct: 181  YYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILG 240

Query: 208  AFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTHILQGPENPNVPI 267
            AFQIFGVTNPG                   EDSRRTLLDMEVNNTRTHIL+G +N NV +
Sbjct: 241  AFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHILEGVDNGNVSV 300

Query: 268  DNVSSWRKFKKANTKLMLKFFQFINERFTATGXXXXXXXXXXXXXXXXL---GKTELPRT 324
            DNVS WR+FKKANT+L++KF ++    FT  G                    G  ++ R 
Sbjct: 301  DNVSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQTAAINGGIDMARN 360

Query: 325  SLDSYQSTRMSADYYRPSLEQSNI-DSTFENGEISVLDPSLPPMANSKFANDFWKNVRVG 383
            SLDS  S RMS DY RPSLE   +  S  +    +++D SLPP ++ KF+ D+WKNV+VG
Sbjct: 361  SLDSIGSYRMSGDYGRPSLEYDTVGQSALKTDNANIMDRSLPPRSDCKFSKDYWKNVKVG 420

Query: 384  DIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICR 443
            DIVRIHNNDEIPAD+ILLSTSD DGGCY+ETKNLDGE+NLKVR+SL+C+++IRNSRDI R
Sbjct: 421  DIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRNSRDIAR 480

Query: 444  TKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVF 503
            TKFWVESEGPHANLY YQGN+KW+DS DG   NEP+TINN+LLRGCTLRNTKWAMG+VVF
Sbjct: 481  TKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWAMGMVVF 540

Query: 504  TGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDF 563
            TGDDTK M+N+G TPTKKSRISRELN SV +NF+FLFI+C I+ + NG  Y K PRSRDF
Sbjct: 541  TGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKHPRSRDF 600

Query: 564  FEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLD 623
            FEFGT+AG+ +TNGFVSFWVAVILYQSLVPISLYISVEIIKTAQA FIY DVLLYN +LD
Sbjct: 601  FEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLD 660

Query: 624  YPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQ 683
            YPCTPKSW+ISDD+GQIEYIFSDKTGTLTQNVMEFKKCTING+SYGRAYTEALAGLRKRQ
Sbjct: 661  YPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALAGLRKRQ 720

Query: 684  GIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQ 743
            GID E+EGR E+E IA+DR+ MI+ LR +S+NSQFYP+++TF+SKEF  DL G +G++QQ
Sbjct: 721  GIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGASGDMQQ 780

Query: 744  KRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLL 803
            K C+HFMLALALCHSVLVEP+K+D  KL++ AQSPDE ALV TARD+GFSFIGKTK GL+
Sbjct: 781  KCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGKTKTGLI 840

Query: 804  VEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRK 863
            +EVQG+QKEFQILN LEFNS+RKRMSCIVK+P A   DEPRALLICKGADS+IYSRL  K
Sbjct: 841  IEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTK 900

Query: 864  PGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEEL 923
             G N E LLEKTALHLEQYATEGLRTLC+ QRE+SW EY EWN++Y+IAAAS+  REE+L
Sbjct: 901  NGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQL 960

Query: 924  DHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCN 983
            + V+D IER+L LLGGTAIEDRLQDGVP+SI++LA+AGIKLWVLTGDKVETAINIGFSCN
Sbjct: 961  EAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCN 1020

Query: 984  LLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPP 1043
            LLN DMELLV+KT G+DV+EFG+DP EI  +L++KYL EKF +TGSE ELA AKK+H  P
Sbjct: 1021 LLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELADAKKNHDFP 1080

Query: 1044 QGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVM 1103
            +G+FA++IDGEALK+AL G++++RKFLLLCKNCKAVLCCRVSPAQKAAVVKLV  +LDVM
Sbjct: 1081 RGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVMTSLDVM 1140

Query: 1104 TLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRL 1163
            TLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRY+TRLVLVHG+W Y+RL
Sbjct: 1141 TLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLVHGRWSYRRL 1200

Query: 1164 AEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDV 1223
            AEMIP FFYKNVIFTLALFWYG++N+FDGSYLFEYT+L FYNLAFTSLPVIF+GI+DQDV
Sbjct: 1201 AEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVIFMGIMDQDV 1260

Query: 1224 SATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLG 1283
            S TVS+++PQLYRSGILR +WNQTKFLWYM DG+YQS IC+FFPY +Y K  I++ NGLG
Sbjct: 1261 SDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLYHKNQIVSNNGLG 1320

Query: 1284 LDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYE 1343
            LDHR+YVG+ VT +AV SCN Y+L+ QYRWDWF+  F  LS I+ F WTG+WSSS+ S E
Sbjct: 1321 LDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTGVWSSSLTSKE 1380

Query: 1344 FWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYP 1403
            F+K ASR+YG PSFW V+FVG ++C+LPRFT D F K+ YP+DVEI+REMWQ GDF+ YP
Sbjct: 1381 FFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDVEIVREMWQRGDFSHYP 1440

Query: 1404 DDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDSS 1463
              YDPTDPN+PKV K+ ++G+  +    +  +    + S  ++ TEEIPM+ L    D+ 
Sbjct: 1441 PGYDPTDPNRPKVAKSGKFGERIVEGIHLSQSFGENNFSHESVATEEIPMNILHT--DAG 1498

Query: 1464 NQVTREKQVSRDSLDEDDARRDSMNNAR-NSMQFRPSSSSRVRTSLDRTRDEMLASNQLD 1522
              + R+ Q    S  ++   +D + + R N  Q +   S+  R+SL+RTR++MLA+NQLD
Sbjct: 1499 QTIRRDTQDQWASSPKE--TQDLLFSPRLNQEQEQRQKSNLGRSSLERTREDMLATNQLD 1556

Query: 1523 TRYSVDRARVSLDLPGVTHAEMLL--RGSTSKD 1553
             RYSV++AR SLDLPGVTHA  L+  R ST+++
Sbjct: 1557 NRYSVEKARTSLDLPGVTHAASLVGKRKSTTRE 1589

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 2058 bits (5332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1012/1577 (64%), Positives = 1213/1577 (76%), Gaps = 36/1577 (2%)

Query: 2    SRSPFQDRGHDRENPLSPFDDSFQFEDKDKT--NSFLKGDAVTVED-------VEETKYD 52
            SRSPF+D    +E   SPFDDS +F+D +       +K    TV D        EE   D
Sbjct: 3    SRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEEDDMD 62

Query: 53   DSSSILPTPVVGGT--AQF-----------EDIELNSELPNSSET----EMKRLRLGTKR 95
            D  S+ PTP+VG +   QF           +D+E  ++   + E+    ++KRLR GT+R
Sbjct: 63   DDYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGTQR 122

Query: 96   VKRE-TNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLP 154
             ++    +D  ++KT+KWA+KN+  P ++   + +   +ETG+ N++DE R IY N PLP
Sbjct: 123  RRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQPLP 182

Query: 155  DEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGV 214
             +ML ED  P+  YPRNKIRTTKYTPLTF PKN++LQF+NFANIYFLI+IILGAFQIFGV
Sbjct: 183  QDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGV 242

Query: 215  TNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWR 274
            TNPG                   EDSRRT+LD+EVNNT+TH+L G EN NV  D++S WR
Sbjct: 243  TNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWR 302

Query: 275  KFKKANTKLMLKFFQFINERFTATGXXXXXXXXXXXXXXXXLGKTELPRTSLDSYQSTRM 334
            +FKKAN++++  F Q   E  T  G                    +  R SL+SY+S RM
Sbjct: 303  RFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKF-RNSLNSYRSNRM 361

Query: 335  SADYYRPSLE---QSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNN 391
            S D  RPS++    ++I+  ++  E ++++ +LP     +F+ D+WKNV+VGDIVRIHNN
Sbjct: 362  SRDV-RPSMDFRPSTDING-YQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNN 419

Query: 392  DEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESE 451
            +EIPAD+ILLSTSD DG CYVETKNLDGE+NLKVRQS++CT+ IR+S DI RT+FW+ESE
Sbjct: 420  EEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESE 479

Query: 452  GPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTM 511
            GPHANLY YQGN +W    D Q  NEP+ INN+LLRGCTLRNTKWAMG+V FTGDDTK M
Sbjct: 480  GPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIM 539

Query: 512  INAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAG 571
            +NAGVTPTKKSRIS+ELN SVL NF  LF+LC IAG+ NG Y+ K PRSRDFF+FGT  G
Sbjct: 540  LNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDFFDFGTGTG 599

Query: 572  NPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSW 631
               T+GFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV++YNE+LDYPCTPKSW
Sbjct: 600  GSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSW 659

Query: 632  SISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEG 691
            +ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+D   E 
Sbjct: 660  NISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHES 719

Query: 692  RIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFML 751
            +IE+EGI +DRE MI+ L+ ++ NSQFY +E+TFVSKEF  DL G +G VQQK CQHFML
Sbjct: 720  KIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFML 779

Query: 752  ALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQK 811
            ALALCHSVL EP K DP KLE+ AQSPDE ALVTTARDMGFSF+ KTK+G+++EVQGI+K
Sbjct: 780  ALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEK 839

Query: 812  EFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL 871
            EFQILNILEFNSSRKRMSCIVK+P      +P+ALLICKGADSVIYSRL  K G N+E+L
Sbjct: 840  EFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD-KTGLNEESL 898

Query: 872  LEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
            LEKTALHLEQYATEGLRTLC+ QRE+SW EY+ WN+KY+IAAA++  REEEL+ V+D IE
Sbjct: 899  LEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIE 958

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991
            R L+LLGGTAIEDRLQDGVPDSIALL EAGIKLWVLTGDKVETAINIGFSCNLLN DMEL
Sbjct: 959  RHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMEL 1018

Query: 992  LVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIII 1051
            LVIKTTG DV++ G  P +IV+ L+S+YL +KF M GSEEEL  AK +H  P+GEFA+II
Sbjct: 1019 LVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVII 1078

Query: 1052 DGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGS 1111
            DGEALK AL+ + MKRKFLLLCKNCK+VLCCRVSPAQKAAVVKLVK+TLDVMTLAIGDGS
Sbjct: 1079 DGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGS 1138

Query: 1112 NDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFF 1171
            NDVAMIQSA++GVGIAGEEGRQAVM SDYAIGQFRY+TRL+LVHGKWCYKRLAEMIPQFF
Sbjct: 1139 NDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFF 1198

Query: 1172 YKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIV 1231
            YKN+IFTLALFW+G++ND+DGSYLFEYTYLTFYNLAFTS+PVI LGI DQDVS T+S++ 
Sbjct: 1199 YKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVF 1258

Query: 1232 PQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVG 1291
            PQLYR GILR+EW+QTKFLWYM DG+YQSVI +FFPYL+YR+  I+T NGLGLDHRYYVG
Sbjct: 1259 PQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVG 1318

Query: 1292 IPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRM 1351
            +PVT IA  SCN Y+L++Q  WD F +FF  +S +++F WTGIWSS+  S EF+ GA+R+
Sbjct: 1319 VPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARV 1378

Query: 1352 YGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDP 1411
            +GTP+FWAV FVG +FC+LPRFT DVF +Y YP D++IIREMW  GDF  +P  YDPTDP
Sbjct: 1379 FGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDP 1438

Query: 1412 NKPKVEKAHEWGQYKIVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDSSNQVTREKQ 1471
               K+  +          +        +S S   I++EEIP+       DS  +   E  
Sbjct: 1439 EVHKIAMSDIRVFSGAESKEFNSNSNTSSSSSEDILSEEIPLELGKGMNDSGKKSEYESG 1498

Query: 1472 VSRDSLDEDDARRDSMNNARNSMQFRPSSSSRV--RTSLDRTRDEMLASNQLDTRYSVDR 1529
            V  + L     +  + N      Q R S+ SR   RTSLDRTR++MLA+NQLDTR+SV+R
Sbjct: 1499 VGDEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRFSVER 1558

Query: 1530 ARVSLDLPGVTHAEMLL 1546
            AR SL+LPG+THAE LL
Sbjct: 1559 ARASLELPGITHAENLL 1575

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 1959 bits (5074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 971/1536 (63%), Positives = 1149/1536 (74%), Gaps = 66/1536 (4%)

Query: 26   FEDKDKTNSFLKGDAVTVEDVEETKYDDSSSILPTPVVG----GTAQFEDIELNSELPNS 81
            F D  KT S LK +       E T  DD  S + TP++        + ++ E + +L ++
Sbjct: 88   FGDTGKT-SDLKNEEFEEISFETTGADDQRSYVNTPIINQGNFAVDEEDEREKDRQLSSA 146

Query: 82   SETE-MKRLRLGTKRVKRETNFDRNKTKTIKWAQKNVHIPF--------KKHDEDADVDD 132
             +++ +KR+R GT+R K+       + KT++W +KN H PF        + H  D D D+
Sbjct: 147  EDSKHVKRMRWGTRRDKKGKP-AMGRAKTLRWTKKNFHNPFADDTNLAAEGHSSDDDNDE 205

Query: 133  NETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQF 192
            N     +R  E RTIY+N+PLP+++L EDG   + YPRNKIRTTKYTPLTFFPKN+  QF
Sbjct: 206  NYDKS-HRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIRTTKYTPLTFFPKNIAFQF 264

Query: 193  NNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNT 252
             N AN+YFL++II+G FQIFGV NPG                   EDSRRT+LDMEVNN 
Sbjct: 265  KNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFKDAIEDSRRTILDMEVNNA 324

Query: 253  RTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATGXXXXXXXXXXXXX 312
             THIL+G EN NV  D VS WRKFKKANT+++ +F     E FT  G             
Sbjct: 325  PTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQELFTEEGKKQRAQRKRHEMH 384

Query: 313  XXXLGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENG--EISVLDPSLPPMANS 370
               + +T+ PR SLDS  S       YR S+E        E G  ++ +LDPSLP + + 
Sbjct: 385  NK-IRQTQTPRNSLDSVGS-------YRNSMESEFGGDLTERGKDDLCLLDPSLPVLPDC 436

Query: 371  KFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLR 430
            KFA D+WK+V VGDIVR+HNNDEIPAD+ILLS+SD DG CYVETKNLDGE+NLKVRQSL+
Sbjct: 437  KFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLK 496

Query: 431  CTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCT 490
            C++ IRNSR+I RTKF VESEGPH+NLY YQGNLKW+D   G   NEP+ INN+LLRGCT
Sbjct: 497  CSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCT 556

Query: 491  LRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVAN 550
            LRNTKWAMGIVVFTG DTK M+NAGVTPTK SRISRELN SV +NF  LF+LC  AG+ N
Sbjct: 557  LRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVN 616

Query: 551  GAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 610
            G YYR    SR++FEFG+IAG+   NG VSFWVA+ILYQS+VPISLYIS+EIIKTAQA+F
Sbjct: 617  GVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALF 676

Query: 611  IYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 670
            IY DV LYNERLDYPCTPKSW+ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR
Sbjct: 677  IYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 736

Query: 671  AYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEF 730
            AYTEALAGLRKRQGID E+EG +E+EGIAQD+EIM+ +L+ +  NSQ  PE +TFVSKEF
Sbjct: 737  AYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEF 796

Query: 731  SQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDM 790
             QD  G NGE Q+K  ++FMLALALCH+VLVE +K+DP  ++  AQSPDE ALV TARDM
Sbjct: 797  VQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDM 856

Query: 791  GFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICK 850
            GFSF+G+TK G++V++QG+QKE+++LN+LEFNS+RKRMSCI+K+P     +EPRALLICK
Sbjct: 857  GFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICK 916

Query: 851  GADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYN 910
            GADS+IYSRLS+    NDE LLEKTALHLEQYATEGLRTLC+ QRE+SW EYQEWNEK+ 
Sbjct: 917  GADSIIYSRLSKN---NDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHE 973

Query: 911  IAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGD 970
            IAAA+L  RE+E++ VAD+IER+L LLGGTAIEDRLQDGVPDSIA L EAGIKLWVLTGD
Sbjct: 974  IAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGD 1033

Query: 971  KVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE 1030
            KVETAINIGFSCNLLN +MELLVIK +G+DV  +G  P EIV  L+ KYL EKF M+GS 
Sbjct: 1034 KVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSY 1093

Query: 1031 EELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKA 1090
            EEL  AKK H PP G F +IIDG+ALK+AL  D +KR+FLLLCK CKAVLCCRVSPAQKA
Sbjct: 1094 EELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKA 1153

Query: 1091 AVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTR 1150
            AVVKLVK+TLDVMTLAIGDGSNDVAMIQSAD+GVGIAGEEGRQAVM SDYAIGQFRY+TR
Sbjct: 1154 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTR 1213

Query: 1151 LVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTS 1210
            LVLVHG+W YKR+AEMIP FFYKNVIFTL+LFWYGV+N++DGSYLFEYTYLT +NLAFTS
Sbjct: 1214 LVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTS 1273

Query: 1211 LPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLI 1270
            LPVIFLGILDQDV+  VSM+VPQLYR GILR EWNQTKF  YMFD +YQSVIC+F PYL 
Sbjct: 1274 LPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLC 1333

Query: 1271 YRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFG 1330
            Y KT I+TQNG GLDHRY+VG+ V  IAV SCN YVL+ QYRWDWF++ F  LS +  F 
Sbjct: 1334 YYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFA 1393

Query: 1331 WTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEII 1390
            WTGIWSS  +S EF+K A+ +YG P FWA+ F G LFC+LPRF  D F++   P D++II
Sbjct: 1394 WTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDII 1453

Query: 1391 REMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCASDSQGTIVTEE 1450
            RE W+ GDF  YP+ YDPTDP++PKV+ A  + +           +  A  S  +I TEE
Sbjct: 1454 RECWKRGDFDHYPEGYDPTDPDRPKVKNAFVYNK----------DIEMAQSSTDSIQTEE 1503

Query: 1451 IPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDR 1510
            IPM                          D+    S  + R+    R   SS  R SL+ 
Sbjct: 1504 IPM--------------------------DELFNSSATSPRSYPHNRHQRSSG-RPSLEI 1536

Query: 1511 TRDEMLASNQLDTRYSVDRARVSLDLPGVTHAEMLL 1546
            TR EM  SNQLD RYSV+RARVSL+LPGVT A  LL
Sbjct: 1537 TRAEMRNSNQLDNRYSVERARVSLELPGVTRAATLL 1572

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 1908 bits (4942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 943/1546 (60%), Positives = 1138/1546 (73%), Gaps = 59/1546 (3%)

Query: 18   SPFDDSFQFE---DKDKTNSFLKGD-------------AVTVEDVEETKYDDSSSILPTP 61
            SPF D FQFE    + +  S LK +               T E V+    + S ++ PT 
Sbjct: 41   SPFSDEFQFEVGGREGRQPSILKAERQPQRQGGKLAFATGTGEHVDGANSEFSMTLTPTR 100

Query: 62   VVGGTAQFEDIELNSELPNSSETEMKRLRLGTKRVKRETNFDRNKTKTIKWAQKNV-HIP 120
            V  G  Q   +         S  EMK LR GT+R    T     + +T++W +KN  ++P
Sbjct: 101  V--GQPQSVPLSDGKRRELRSAKEMKILRWGTQR--HRTGRPVGRARTLRWGKKNYDNLP 156

Query: 121  FKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTP 180
              +    +D D    G  +R+ E R +Y NMPLP E+  E+G P++ YPRNKIRTTKYTP
Sbjct: 157  EDRGSGGSDTDAGVAGK-SRAAEKRAVYFNMPLPPELTGENGRPVVNYPRNKIRTTKYTP 215

Query: 181  LTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDS 240
            L+F PKN+  QF N ANIYFL+++ L    IFGVTNP                    EDS
Sbjct: 216  LSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAIVVITGLKDAFEDS 275

Query: 241  RRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATGX 300
            RRT+LD+EVNN R+HIL G EN NV  DNVS WRKFKK NT+L++   +F  E FT  G 
Sbjct: 276  RRTILDLEVNNMRSHILHGVENNNVSADNVSLWRKFKKLNTRLLIATVRFFRESFTEAGR 335

Query: 301  XXXXXXXXXXXXXXXLGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENGEISVL 360
                                 PR SLDS  S       YRPSL+  NI     + ++SVL
Sbjct: 336  RRRAQRAREESQMAASRLGSDPRMSLDSMGS-------YRPSLDFDNIGQLVSSDQVSVL 388

Query: 361  DPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGE 420
            + +LPP+ + +F    WK++RVGDIVRIHNNDEIPAD+ILLSTSD DG CYVETKNLDGE
Sbjct: 389  NRNLPPVPDCRFGKSHWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGE 448

Query: 421  SNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPIT 480
            +NLKVRQSL+C++ IRNS+DI R KFWVESEGPHANLY YQGN KW+DS  G  HNEP+ 
Sbjct: 449  TNLKVRQSLKCSHRIRNSKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVN 508

Query: 481  INNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLF 540
            INNMLLRGC+LRNTKWAMGIV+FTG DTK M+NAGVTPTK+SRISRELN+SV++NFVFLF
Sbjct: 509  INNMLLRGCSLRNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLF 568

Query: 541  ILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISV 600
            +LCL AG+ NG YYR+   SR FFEFGT+AG P  NG ++F+VA+ILYQSLVPISLYIS+
Sbjct: 569  VLCLAAGLVNGIYYRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISI 628

Query: 601  EIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKK 660
            EIIKTAQA FIY DVLLYN +LDYPCTP++W+ISDDLGQIEYIFSDKTGTLTQNVMEFKK
Sbjct: 629  EIIKTAQAAFIYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKK 688

Query: 661  CTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYP 720
            CTINGVSYGRAYTEALAGLRKRQG+D E+EG  ER  I +D++ M++ L K+  NSQ  P
Sbjct: 689  CTINGVSYGRAYTEALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDP 748

Query: 721  EELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDE 780
              +TFVSKE  QDL G N + Q++  +HFML+LALCHSV+VE +KN+P KL++ AQSPDE
Sbjct: 749  HTVTFVSKELVQDLGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDE 808

Query: 781  TALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEK 840
             ALV TARDMGFSF+G+TK G+++E+QG+QKEF+ILN+LEFNS+RKRMSCIVK+P A E 
Sbjct: 809  AALVETARDMGFSFVGRTKNGVIIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADEN 868

Query: 841  DEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWS 900
             +P+ALL+CKGADSVIYSRL R    ND  LLE+TALHLEQ+ATEGLRTLCV QREI W 
Sbjct: 869  SKPKALLLCKGADSVIYSRLDRS--RNDPKLLERTALHLEQFATEGLRTLCVAQREIDWD 926

Query: 901  EYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEA 960
            EY  WNE+  +AAASL  REE L+ VAD IER LVLLGGTAIEDRLQDGVPDSI++LA+A
Sbjct: 927  EYLNWNERRELAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADA 986

Query: 961  GIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYL 1020
            GIKLWVLTGDKVETAINIGFSCNLL +DMELLVIK++GEDV+  G+  +++V AL+ KYL
Sbjct: 987  GIKLWVLTGDKVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYL 1046

Query: 1021 MEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVL 1080
               FNM GS EELAAA+KDH+PPQ  F ++IDG+ALK+AL G+ ++RKFLLLCKNCKAVL
Sbjct: 1047 ETHFNMKGSPEELAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVL 1106

Query: 1081 CCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDY 1140
            CCRVSP+QKAAVVKLVK++LDV+TLAIGDGSNDVAMIQ+ADVG+GIAGEEGRQAVM +DY
Sbjct: 1107 CCRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADY 1166

Query: 1141 AIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTY 1200
            AIGQFRY+TRLVLVHG+W YKRLAEMIPQFFYKN+ FTLALFW+G+ +++DGSYLFEYTY
Sbjct: 1167 AIGQFRYLTRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTY 1226

Query: 1201 LTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQS 1260
            L FYNLAFTSLPVIFLGI+DQD S  +S++VPQLY+ GILR EW Q KF WY FDG+YQS
Sbjct: 1227 LMFYNLAFTSLPVIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQS 1286

Query: 1261 VICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFF 1320
            +IC+FFPYL Y +T +IT+N  GLDHRY  G+ VT IAV SCN YVL+ QYRWDWFTT F
Sbjct: 1287 IICFFFPYLCYYRTGLITKNAYGLDHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLF 1346

Query: 1321 AFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMK 1380
             FLS  + F WTG+WSS+  S EF+K A R+Y  P FWAV FVG +FC+LPRFT+D   K
Sbjct: 1347 IFLSCGILFFWTGVWSSATYSGEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQK 1406

Query: 1381 YLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKAHEWGQYKIVDESIGDAVVCAS 1440
              +P D++I+RE W  GDF  YP+DYDPTDPN+P++  +H  G  +  D+          
Sbjct: 1407 LFFPRDIDIVRECWWRGDFDMYPEDYDPTDPNRPRINVSHT-GVDRASDDERSRTGSDLG 1465

Query: 1441 DSQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDSLDEDDARRDSMNNARNSMQFRPSS 1500
             ++ T+++E+IPM  +D     S         S DS                        
Sbjct: 1466 VTRTTVISEDIPMGLIDKTAPHSRADPTTPLGSEDS------------------------ 1501

Query: 1501 SSRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDLPGVTHAEMLL 1546
                R SL+ TR EML ++QLD+RYSV+RAR SLDLPGVT A  L+
Sbjct: 1502 ---ARYSLEVTRREMLQTHQLDSRYSVERARTSLDLPGVTRARTLI 1544

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1061 (38%), Positives = 597/1061 (56%), Gaps = 94/1061 (8%)

Query: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402
            L++SN D    +    VLD       + +F    W ++ VGDI+R+ + + IPAD+I+LS
Sbjct: 274  LKRSNADKELNHSLCDVLDER-----SGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILS 328

Query: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462
            +S+ +G CY+ET NLDGE+NLK++Q+ + T    + + +C+    V+SE P+++LY Y+G
Sbjct: 329  SSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEG 388

Query: 463  NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522
             +    +L+G T   P++ + MLLRG TLRNT W  G++VFTG +TK M NA  TP K++
Sbjct: 389  TM----TLNGSTF--PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRT 442

Query: 523  RISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEF-GTIAGNPTTNGFVSF 581
             + R +N  +L  F  L +L LI+   N    ++      +    GT          ++F
Sbjct: 443  AVERVINMQILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTF 502

Query: 582  WVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIE 641
            W   IL+ +LVPISL+++VE+IK  QA  I  D+ LY+E  D P   ++ S+ ++LGQIE
Sbjct: 503  W---ILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIE 559

Query: 642  YIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQD 701
            YIFSDKTGTLT+NVMEFK  +I G    R Y E                       I +D
Sbjct: 560  YIFSDKTGTLTRNVMEFKSVSIAG----RCYIET----------------------IPED 593

Query: 702  REIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLV 761
            R   ++D             E+ F S E  +D + +  + +      F+  LA CH+V+ 
Sbjct: 594  RRATVED-----------GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVI- 641

Query: 762  EPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQ-GIQKEFQILNILE 820
             P+      ++  A SPDE ALV  A D+GF F  +    + +      Q E+Q+LNI E
Sbjct: 642  -PETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICE 700

Query: 821  FNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLE 880
            FNS+RKRMS I ++P  + K      L CKGAD+VI  RL  +  +N    ++ T  HLE
Sbjct: 701  FNSTRKRMSAIFRMPDGSIK------LFCKGADTVILERLDSE--FN--PYVQSTLRHLE 750

Query: 881  QYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGGT 940
             YA EGLRTLC+  R I   EY+EW++ Y  A+ ++  R EELD  A+LIE DL  LG T
Sbjct: 751  DYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGAT 810

Query: 941  AIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGED 1000
            AIED+LQ+GVP++I  L EAG+K+WVLTGD+ ETAINIG SC LL+ DM LL++    E+
Sbjct: 811  AIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVN---EE 867

Query: 1001 VKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIAL 1060
             KE  D  T          L  K N   S +    +++D        A++IDG++L  AL
Sbjct: 868  TKE--DTRTN---------LQSKLNAIESHQ---ISQQD----MNSLALVIDGKSLGYAL 909

Query: 1061 TGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSA 1120
              D ++ +FL + K CKAV+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A
Sbjct: 910  EED-LEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAA 968

Query: 1121 DVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLA 1180
             VGVGI+G EG QA   +D+AIGQFR++ +L++VHG W Y+R++  I   FYKN+   + 
Sbjct: 969  HVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMT 1028

Query: 1181 LFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGIL 1240
             FWY   N F G  + E   LTFYN+ FT +P   +GI DQ V++ +    PQLY+ G  
Sbjct: 1029 QFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQK 1088

Query: 1241 RQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYY-VGIPVTGIAV 1299
             Q ++ T F  ++ +G Y S + +    L YR  N +   G   DH  + VGI  T I +
Sbjct: 1089 GQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIII 1148

Query: 1300 TSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSI----ASYEFWKGASRMYGTP 1355
                  ++  Q  W  FT      S +++  +   +S+       S E++     +YG+ 
Sbjct: 1149 VLGKAALITSQ--WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSA 1206

Query: 1356 SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH 1396
            +FW +  V  +F +L  F +  + +   P    +++EM ++
Sbjct: 1207 TFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKY 1247

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 48/118 (40%), Gaps = 8/118 (6%)

Query: 140 RSDEFRTIYHNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIY 199
           +SDE RTI  N    +            Y  N I TTKY   TF PK +  +F+ +AN++
Sbjct: 182 KSDEPRTILLNDSSANSRF--------GYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233

Query: 200 FLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTHIL 257
           FL   I+        TN                     ED +R+  D E+N++   +L
Sbjct: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVL 291

>Kwal_26.7070
          Length = 1315

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1077 (37%), Positives = 605/1077 (56%), Gaps = 117/1077 (10%)

Query: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402
            L+++  DS   +    V    L     SK     W N+ VGDI+++++ + IPADVI+++
Sbjct: 269  LKRAQSDSELNDSRAQVFSEQLQDFTLSK-----WVNISVGDIIKVNSEEAIPADVIVIA 323

Query: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462
            +S+ +G CY+ET NLDGE+NLK++Q+   T+   +  D+   +  V SE P+++LY Y+G
Sbjct: 324  SSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEG 383

Query: 463  NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522
             +    +L+G+  N  ++   M+LRG TLRNT W  G+VVFTG +TK M NA  TP K++
Sbjct: 384  TM----NLNGK--NISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATPIKRT 437

Query: 523  RISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGF---- 578
             + R +N  ++  F  L +L LI+ + N     K     +   +  + G      F    
Sbjct: 438  AVERVINMQIVALFGVLIVLALISSIGNVI---KVTSDAEHLTYLYLQGTNKVGLFFKDI 494

Query: 579  VSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLG 638
            +++W   IL+ +LVPISL+++VE+IK  QA  I  D+ LY+E  D P   ++ S+ ++LG
Sbjct: 495  LTYW---ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELG 551

Query: 639  QIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGI 698
            QIEYIFSDKTGTLT+NVMEFK C+I G    + Y E +           E +     +GI
Sbjct: 552  QIEYIFSDKTGTLTRNVMEFKSCSIAG----KCYIETIP----------EDKAATTEDGI 597

Query: 699  AQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHS 758
                                   E+ F   +  ++ L +  +        F+  LA CH+
Sbjct: 598  -----------------------EIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHT 634

Query: 759  VLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGL--LVEVQGIQKEFQIL 816
            V+  P+  +   ++  A SPDE ALV  A  +G+ FI +    +  L+E  G ++E+Q+L
Sbjct: 635  VI--PEFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLL 692

Query: 817  NILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTA 876
            NI EFNS+RKRMS I +LP    K      L CKGAD+VI  RL  K G N    +E T 
Sbjct: 693  NICEFNSTRKRMSAIFRLPNGEIK------LFCKGADTVILERL--KAGEN--PYIEATL 742

Query: 877  LHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVL 936
             HLE YA EGLRTLC+  R ++ SEY EW + Y+ A+ +L  R ++LD  A+LIE+DL L
Sbjct: 743  RHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFL 802

Query: 937  LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKT 996
            LG TAIED+LQDGVP++I  L +AGIK+WVLTGD+ ETA+NIG SC LL+ DM LL+I  
Sbjct: 803  LGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIIN- 861

Query: 997  TGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE---FAIIIDG 1053
              E+ KE              K L EK            A  DH   Q +    A++IDG
Sbjct: 862  --EEDKE-----------ATRKNLTEKLK----------AISDHQISQQDMNSLALVIDG 898

Query: 1054 EALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSND 1113
            ++L  AL  D ++   L + K CKAV+CCRVSP QKA VVK+VK   D + LAIGDG+ND
Sbjct: 899  KSLGFALEAD-LEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGAND 957

Query: 1114 VAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYK 1173
            V+MIQ+A VGVGI+G EG QA   +D+AI QF+Y+ +L+LVHG W Y+R+++ I   FYK
Sbjct: 958  VSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYK 1017

Query: 1174 NVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQ 1233
            N+   +  FWY   N + G  + E   +TFYN+ FT LP   +G+ DQ VS+ +    PQ
Sbjct: 1018 NIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQ 1077

Query: 1234 LYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIP 1293
            LY+ G   Q ++   F  ++ +G Y S + +    L YR  N++  +G   DH  +    
Sbjct: 1078 LYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAW---- 1133

Query: 1294 VTGIAVTSCNFYVLMEQY-----RWDWFTTFFAFLSTIVYFGWTGIWSSSI----ASYEF 1344
              G+++ +C+  +++ +      +W  FT F    S + +  +  I++S +     S E+
Sbjct: 1134 --GVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEY 1191

Query: 1345 WKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH--GDF 1399
            +   S +YG+ +FW +  V   F ++    +  + +   P    +++EM ++  GD+
Sbjct: 1192 YGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDY 1248

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           +  N I TTKY   TF PK +  +F+ +AN++FL    +        TN           
Sbjct: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHIL 257
                     ED +R   D E+N++R  + 
Sbjct: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1055 (37%), Positives = 585/1055 (55%), Gaps = 109/1055 (10%)

Query: 368  ANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQ 427
            A   F    W +++VGDI+R+++ + IPAD+I+LS+S+ +G CY+ET NLDGE+NLK++Q
Sbjct: 273  AEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQ 332

Query: 428  SLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLR 487
            +   T  I +SR++   K  + SE P+++LY Y+G L+    ++G     P++   M+LR
Sbjct: 333  ARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLE----MNGT--KIPLSPEQMILR 386

Query: 488  GCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAG 547
            G TLRNT W  GIV+FTG +TK M NA  TP K++ + + +N  ++  F  L +L LI+ 
Sbjct: 387  GATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISS 446

Query: 548  VANGAYYRKKPRSRDFFEF-GTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTA 606
            + N        +   +    GT         F++FW   IL+ +LVPISL+++VE+IK  
Sbjct: 447  IGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYY 503

Query: 607  QAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGV 666
            QA  I  D+ LY E  D P   K+ S+ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G 
Sbjct: 504  QAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGR 563

Query: 667  SYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFV 726
             Y                           E I +D+    +D  ++   S          
Sbjct: 564  CYA--------------------------EHIPEDKAATFEDGIEVGYRS---------- 587

Query: 727  SKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTT 786
              +  + L  N+ +   K    F+  LA CH+V+  P+      ++  A SPDE ALV  
Sbjct: 588  FDDLKKQLTTNSDDC--KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDEGALVEG 643

Query: 787  ARDMGFSFIGKTKQGLLVEV-QGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRA 845
               +G+ F+ +    + + + +  ++E+Q+LNI EFNS+RKRMS I + P  + K     
Sbjct: 644  GALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK----- 698

Query: 846  LLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEW 905
             L+CKGADSVI  RLS    +     ++ T  HLE YATEGLRTLC+  ++I   EY  W
Sbjct: 699  -LLCKGADSVILERLSETGNF----YVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753

Query: 906  NEKYNIAAASLAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLW 965
            N+KY  AA +L  R E+LD VA+ IE  L L+G TAIED+LQ+GVPD+I  L EAGIK+W
Sbjct: 754  NKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIW 813

Query: 966  VLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFN 1025
            VLTGDK ETAINIG SC LL+ DM LL+I    E+ KE                   + N
Sbjct: 814  VLTGDKQETAINIGMSCRLLSEDMNLLII---SEETKE-----------------ATRRN 853

Query: 1026 MTGSEEELAAAKKDHSPPQGE---FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCC 1082
            M    EE  AA  +HS  + +    A++IDG +L  AL  D ++  FL + K CKAV+CC
Sbjct: 854  M----EEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEAD-LEDYFLAIGKMCKAVICC 908

Query: 1083 RVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAI 1142
            RVSP QKA VVK+VK   + + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D ++
Sbjct: 909  RVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISV 968

Query: 1143 GQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLT 1202
            GQFR++ +L+LVHG W Y+R++  I   FYKN    +  FWY   N F G  + E   ++
Sbjct: 969  GQFRFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMS 1028

Query: 1203 FYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVI 1262
             YN+ FT LP   +G+ DQ V++ +    PQLY+ G   Q ++ + F  ++ +G Y S +
Sbjct: 1029 LYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAV 1088

Query: 1263 CYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQY-----RWDWFT 1317
             +    L YR    + ++G   DH  +      GIA+ + +  +++ +      +W  FT
Sbjct: 1089 VFVGTILFYRYGFALRKHGETADHWSW------GIAIYTSSVIIVLGKAALVTNQWTKFT 1142

Query: 1318 TFFA----FLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRF 1373
             F      F   I +  +  I+  +  S E++      YG+ +FW    V   F +   F
Sbjct: 1143 LFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDF 1202

Query: 1374 TYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDP 1408
             +  + +   P    +I+EM ++        DY P
Sbjct: 1203 IWKYYKRMYAPESYHLIQEMQKYN-----VSDYRP 1232

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 37/89 (41%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N I TTKY   TF PK +  +F+ +AN++FL    +        TN           
Sbjct: 181 YIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLMVV 240

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHI 256
                     ED +R   D E+NN++  I
Sbjct: 241 LIVSAIKESVEDLKRASSDNELNNSKAEI 269

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1061 (37%), Positives = 584/1061 (55%), Gaps = 93/1061 (8%)

Query: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402
            ++++N D    N    +        A+  F    W ++RVGDI+R+ + + IPAD I+LS
Sbjct: 270  IKRANSDKELNNSTAEIFSE-----AHDDFVEKRWIDIRVGDIIRVKSEEPIPADTIILS 324

Query: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462
            +S+ +G CY+ET NLDGE+NLK++QS   T    + + +      V SE P+++LY Y+G
Sbjct: 325  SSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEG 384

Query: 463  NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522
             +   D         P++ + M+LRG TLRNT W  G+V+FTG +TK + NA  TP K++
Sbjct: 385  TMTLND------RQIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRT 438

Query: 523  RISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEF-GTIAGNPTTNGFVSF 581
             + + +N  ++  F  L +L LI+ + N        +   +    GT         F++F
Sbjct: 439  AVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDFLTF 498

Query: 582  WVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIE 641
            W   IL+ +LVPISL+++VE+IK  QA  I  D+ LY E+ D P   ++ S+ ++LGQIE
Sbjct: 499  W---ILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIE 555

Query: 642  YIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQD 701
            YIFSDKTGTLT+N+MEFK C+I G  Y                I  +K   +E +GI   
Sbjct: 556  YIFSDKTGTLTRNIMEFKSCSIAGHCY-------------IDKIPEDKTATVE-DGIEVG 601

Query: 702  REIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLV 761
                 DDL+K  N+           S E S  +              F+  LA CH+V+ 
Sbjct: 602  YR-KFDDLKKKLNDP----------SDEDSPII------------NDFLTLLATCHTVI- 637

Query: 762  EPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGL--LVEVQGIQKEFQILNIL 819
             P+      ++  A SPDE ALV    D+G+ FI +    +  L+E  G +KE+Q+LNI 
Sbjct: 638  -PEFQSDGSIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNIC 696

Query: 820  EFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHL 879
            EFNS+RKRMS I + P  + K      L CKGAD+VI  RL  +        +E T  HL
Sbjct: 697  EFNSTRKRMSAIFRFPDGSIK------LFCKGADTVILERLDDEAN----QYVEATMRHL 746

Query: 880  EQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLLGG 939
            E YA+EGLRTLC+  R+IS  EY+EWN  YN AA +L  R E+LD  A+LIE++L+L+G 
Sbjct: 747  EDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGA 806

Query: 940  TAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGE 999
            TAIED+LQDGVP++I  L EAGIK+WVLTGD+ ETAINIG SC LL+ DM LL+I     
Sbjct: 807  TAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETR 866

Query: 1000 DVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIA 1059
            D  E              + L+EK N   +E +L+      +      A++IDG++L  A
Sbjct: 867  DDTE--------------RNLLEKINAL-NEHQLS------THDMKSLALVIDGKSLGFA 905

Query: 1060 LTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQS 1119
            L  + ++   L + K CKAV+CCRVSP QKA VVK+VK     + LAI  G+NDV+MIQ+
Sbjct: 906  LEPE-LEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQA 964

Query: 1120 ADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTL 1179
            A VGVGI+G EG QA   +D A+GQF+++ +L+LVHG W Y+R++  I   FYKN    +
Sbjct: 965  AHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYM 1024

Query: 1180 ALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQLYRSGI 1239
              FWY   N F G  + E   ++FYNL FT  P   +G+ DQ VS+ +    PQLY+ G 
Sbjct: 1025 TQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQ 1084

Query: 1240 LRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAV 1299
              Q ++   F  ++ +G + S I +    LIYR    +  +G   DH  + G+ V   +V
Sbjct: 1085 KGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSW-GVTVYTTSV 1143

Query: 1300 TSCNFYVLMEQYRWDWFTTFF---AFLSTIVYFG-WTGIWSSSIASYEFWKGASRMYGTP 1355
                    +   +W  FT      + L  +++F  +  I+  +  S E++      YG+ 
Sbjct: 1144 IIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGVVKHTYGSG 1203

Query: 1356 SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH 1396
             FW    V  +F ++  F +  + +   P    +I+EM ++
Sbjct: 1204 VFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQKY 1244

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 36/90 (40%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N I TTKY   TF PK +  +F+ +AN++FL    +        TN           
Sbjct: 198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVV 257

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHIL 257
                     ED +R   D E+NN+   I 
Sbjct: 258 LIVSAMKECIEDIKRANSDKELNNSTAEIF 287

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1099 (36%), Positives = 594/1099 (54%), Gaps = 136/1099 (12%)

Query: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402
            L++SN D    +    V    +      +F +  W ++ VGDI+R+ + + IPAD+I+LS
Sbjct: 266  LKRSNSDKELNHSRADVYSDEM-----GQFISKKWIDIAVGDIIRVRSEEAIPADLIVLS 320

Query: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462
            +S+ +G CY+ET NLDGE+NLK++Q+   T+ I + R++   +  + SE P+ +LY Y+G
Sbjct: 321  SSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNTSLYTYEG 380

Query: 463  NLKWIDSLDGQTHNE--PITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTK 520
             +          HN   P++ + +LLRG TLRNT W  GIV+FTG +TK   NA  TP K
Sbjct: 381  TMI--------LHNNRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 521  KSRISRELNFSVLINFVFLFILCLIAGVANG-AYYRKKPRSRDFFEFGTIAGNPTTNGFV 579
            ++ + R +N  ++  F  L  L LI+   N    Y +K      +  GT          +
Sbjct: 433  RTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNIL 492

Query: 580  SFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQ 639
            +FW   IL+ +LVPISL+++VE+IK  QA  I  D+ L++E  + P   ++ S+ ++LGQ
Sbjct: 493  TFW---ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQ 549

Query: 640  IEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIA 699
            IEYIFSDKTGTLTQNVMEFK C+I G    R Y          Q I  +K+   + EGI 
Sbjct: 550  IEYIFSDKTGTLTQNVMEFKSCSIAG----RCYI---------QSIPEDKDAAFD-EGI- 594

Query: 700  QDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSV 759
                                  E+ + + +   +LL   G         F+  L++CH+V
Sbjct: 595  ----------------------EVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTV 632

Query: 760  LVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKE--FQILN 817
            +  P+  +   ++  A SPDE ALV  A D+G+ FI +    + +  + I +E  +++LN
Sbjct: 633  I--PEFQENGSIKYQAASPDEGALVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLN 690

Query: 818  ILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTAL 877
            I EFNS+RKRMS I + P  + +      L+CKGAD+VI  RL+          +  T  
Sbjct: 691  ICEFNSTRKRMSAIFRFPDNSIR------LLCKGADTVILERLAA----TSNPYVAATLR 740

Query: 878  HLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVLL 937
            HLE YA EGLRTLC+  R I  SEY+EW++ Y+ AA ++  R EELD VA++IE+ LVLL
Sbjct: 741  HLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLL 800

Query: 938  GGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTT 997
            G TAIED+LQDGVP++I  L +AGIK+WVLTGD+ ETAINIG SC LL+ DM LL++   
Sbjct: 801  GATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVN-- 858

Query: 998  GEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE---FAIIIDGE 1054
             ED KE         N L+ K                 A  DH   Q +    A++IDG+
Sbjct: 859  -EDTKE------STRNNLIDKL---------------RAINDHQISQQDMNTLALVIDGK 896

Query: 1055 ALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDV 1114
            +L  AL  D ++   L + K C+AV+CCRVSP QKA VVK+VK     + LAIGDG+NDV
Sbjct: 897  SLGFALEPD-LEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDV 955

Query: 1115 AMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKN 1174
            +MIQ+A VGVGI+G EG QA   +D+A+GQF+Y+ +L+LVHG W Y+R+++ I   FYKN
Sbjct: 956  SMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKN 1015

Query: 1175 VIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP---------VIFLGILDQDV-S 1224
            +   +  FWY ++N F G  + E   LTFYN   T+ P             G+L++D  S
Sbjct: 1016 IALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQS 1075

Query: 1225 ATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGL 1284
             TV          G   Q W  T F     +G Y + I      + YR       +G   
Sbjct: 1076 CTV----------GQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETA 1125

Query: 1285 DHRYY-VGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSI---- 1339
            DH  + V I  T I        ++  Q  W  FT      S + +  +  I++  +    
Sbjct: 1126 DHWVWGVAIQPTSIIFVLGKAALITNQ--WTKFTVLAIPGSLVFWLLFFPIYAYLLPGLN 1183

Query: 1340 ASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDF 1399
             S E++   S +YG+ +FWA+ +V  +  +L    +  + +   P    +++EM +    
Sbjct: 1184 VSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQEMQK---- 1239

Query: 1400 ARYPDDYDPTDPNKPKVEK 1418
                  YD +D N+P++E+
Sbjct: 1240 ------YDISD-NRPRIEQ 1251

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 40/91 (43%)

Query: 166 MEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXX 225
           M Y  N I TTKY   TF PK +  +F+ +AN++FL   I+        TN         
Sbjct: 192 MGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLI 251

Query: 226 XXXXXXXXXXXXEDSRRTLLDMEVNNTRTHI 256
                       ED +R+  D E+N++R  +
Sbjct: 252 VVLVVSAIKESVEDLKRSNSDKELNHSRADV 282

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  348 bits (893), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 269/960 (28%), Positives = 464/960 (48%), Gaps = 149/960 (15%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            K+++VGD+++IH    IPAD++LL +S+  G  +++T  LDGE++ K+R +   T  +  
Sbjct: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL-- 321

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            S D    K  + +  P  +++ + G L + DS      +  ++++N +     L +    
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDS-----SSNALSVDNTMWANTVLASVGSC 376

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLFILCLIAGVANGAYYR 555
            +G VV+TG DT+  +N  ++  K   +  E+N    +L   VF+  + L+A         
Sbjct: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVA--------- 427

Query: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615
                          AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 428  -------------FAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDA 474

Query: 616  LLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEA 675
             + +  +      ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY       
Sbjct: 475  TIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYT------ 522

Query: 676  LAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLL 735
                     +DT               +I+ D ++++ ++S   P   +   K+      
Sbjct: 523  ---------MDT--------------MDIVTDYVQELVSSSTTTPMPQSTAKKDLPN--- 556

Query: 736  GNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFI 795
                     R +  ++ LA+CH+V   P   D  +L   A SPDE A+V     +G S  
Sbjct: 557  ---------RVRDLVVTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLSLF 604

Query: 796  GKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGAD 853
             + +    L  +      E+ IL +  FNS  KRM  IV      +K +     + KGAD
Sbjct: 605  KRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVY-----DKVKGEHWFMQKGAD 659

Query: 854  SVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAA 913
            +V+ +R+ +   + DE         +   A EGLRTL +G++++S   Y+++ ++Y+ A+
Sbjct: 660  TVM-ARIVQSNDWLDE--------EVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDAS 710

Query: 914  ASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 972
             S+  R+E +  V    +E +L LLG T +ED+LQ+ V  SI LL  AG+K+W+LTGDKV
Sbjct: 711  LSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKV 770

Query: 973  ETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEE 1032
            ETA  +  S  L++    +  +             P   +NAL  +YL  K N +     
Sbjct: 771  ETARCVSISAKLISRGQYVHTVTKLSR--------PEGALNAL--EYL--KINKSS---- 814

Query: 1033 LAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1092
                            ++IDGE+L + LT    K++F  +  +  AV+ CR +P QKA V
Sbjct: 815  ---------------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVIACRCTPQQKADV 857

Query: 1093 VKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1152
              L+++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+++ QF ++T+L+
Sbjct: 858  ALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLL 917

Query: 1153 LVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP 1212
            L HG+  YKR A++     ++ +I ++    Y V + F+   L++   +  Y   +T  P
Sbjct: 918  LWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAP 977

Query: 1213 VIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWY---MFDGIYQSVICYFFPY 1268
            V  L  LD D+  +++ I P+LY+        + +T F+W    +F G     I  +F  
Sbjct: 978  VFSL-TLDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTS 1036

Query: 1269 LIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVY 1328
            L              +D +  V +  T + +      V +E Y W+        ++ ++Y
Sbjct: 1037 LD------------EVDFKKLVALSFTALVINEL-IMVALEIYTWNKTMVITEIVTFLIY 1083

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 51/126 (40%), Gaps = 7/126 (5%)

Query: 143 EFRTIYHNMPLPDEM----LYEDGLPIME---YPRNKIRTTKYTPLTFFPKNVMLQFNNF 195
           ++R+   ++ L D+     ++ D  PI +   YP N I   KY P+TF P  +  QF  F
Sbjct: 134 KYRSTNSSIELTDQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFF 193

Query: 196 ANIYFLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTH 255
            N+YFL++ +  A     +                       +D +R   D E NN    
Sbjct: 194 FNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYE 253

Query: 256 ILQGPE 261
           +L   +
Sbjct: 254 VLNKAQ 259

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  346 bits (888), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 282/1024 (27%), Positives = 478/1024 (46%), Gaps = 153/1024 (14%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            K+++VGD++++H  D IPAD++LL +S+  G  +++T  LDGE++ K+R +   T  +  
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            +  I R    + +  P  +++ + G + + DS      + P++++N L     L ++ + 
Sbjct: 328  NDLINRIS--ITASAPEKSIHKFLGKVTYKDST-----SNPLSVDNTLWANTVLASSGFC 380

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLFILCLIAGVANGAYYR 555
            +  VV+TG DT+  +N      K   +  E+N    +L   VF   + L+A         
Sbjct: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVA--------- 431

Query: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615
                          AG    + ++     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 432  -------------FAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK 478

Query: 616  LLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTE 674
             +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     +
Sbjct: 479  TI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLD 531

Query: 675  ALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDL 734
             ++     Q + + K   +    +A      +   RK          +++F         
Sbjct: 532  IVSDYV--QSLVSSKNDSLNNSKVA------LSTTRK----------DMSF--------- 564

Query: 735  LGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSF 794
                      R +  +L LA+CH+V   P   D ++L   A SPDE A+V     +G S 
Sbjct: 565  ----------RVRDMILTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTESVGLSL 611

Query: 795  IGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGA 852
              + +    LL E  G    ++IL +  FNS  KRM  IV+     ++       + KGA
Sbjct: 612  FKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVR-----DEQLDEYWFMQKGA 666

Query: 853  DSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIA 912
            D+V+   +       +ET            A EGLRTL +G+++++   Y+++ ++YN A
Sbjct: 667  DTVMSKIVESNDWLEEET---------GNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDA 717

Query: 913  AASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDK 971
            + S+  R++++  V    +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDK
Sbjct: 718  SLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 777

Query: 972  VETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEE 1031
            VETA  +  S  L++    +  I             P    N L  +YL  K N      
Sbjct: 778  VETARCVSISAKLISRGQYVHTITKVTR--------PEGAFNQL--EYL--KINRNA--- 822

Query: 1032 ELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAA 1091
                             ++IDGE+L + L     +++F  +  +   V+ CR +P QKA 
Sbjct: 823  ----------------CLLIDGESLGMFLKH--YEQEFFDVVVHLPTVIACRCTPQQKAD 864

Query: 1092 VVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRL 1151
            V  +++         IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T L
Sbjct: 865  VALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTEL 924

Query: 1152 VLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSL 1211
            +L HG+  YKR A++     ++ +I  +    Y + + F+   L++   +  Y   +T  
Sbjct: 925  LLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMA 984

Query: 1212 PVIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWYMFDGIYQSVICYFFPYLI 1270
            PV  L  LD D+  +++ I P+LY+     +  + +T F+W +      SVI  F     
Sbjct: 985  PVFSL-TLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF- 1042

Query: 1271 YRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFG 1330
                     + L  D    V I  T + V      V +E Y W+  T     ++T++++ 
Sbjct: 1043 --------TSLLDTDFTRMVAISFTALVVNEL-IMVALEIYTWNK-TMLVTEIATLLFY- 1091

Query: 1331 WTGIWSSSIASYEFWKGASRM--YGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVE 1388
                    I S  F      +    T +++A   V  L  I P +T     + L+P    
Sbjct: 1092 --------IVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAKAIYRRLHPPSYA 1143

Query: 1389 IIRE 1392
             ++E
Sbjct: 1144 KVQE 1147

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 158 LYEDGLPIME---YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGA 208
           ++ D  P+ +   Y  N++   KY  +TF P  +  QF  F N+YFL++ +  A
Sbjct: 157 IHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQA 210

>Kwal_56.23467
          Length = 280

 Score =  315 bits (808), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 206/311 (66%), Gaps = 35/311 (11%)

Query: 1240 LRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIPVTGIAV 1299
            +R EWN TKF  YM DG+YQSVI +FFP+L Y KT +++ NGLGLDHRY+VGI V  IA 
Sbjct: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 1300 TSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWA 1359
             SCN Y+L+ Q+RWDWF+T F  LS +V +GWTGIWS+   S EF+K A+ +YG+P +WA
Sbjct: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 1360 VYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPNKPKVEKA 1419
            ++FVG LFC+LPRFT+DVF K  +P D++IIRE W  G F +YP+DYDPTDPN+P++ KA
Sbjct: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 1420 HEWGQYKIVDES--IGDAVVCASD-SQGTIVTEEIPMSFLDVKKDSSNQVTREKQVSRDS 1476
                  + V+E      A+  A+  S+ T+ TEEIPM+F++                   
Sbjct: 181  DTKLHPRYVEEGSDYAHAITTANHGSRDTVYTEEIPMTFMEA------------------ 222

Query: 1477 LDEDDARRDSMNNARNSMQFRPSSSSRVRTSLDRTRDEMLASNQLDTRYSVDRARVSLDL 1536
               DD          N   F P S+  +RTSLDRTR +M ASN+LD RYS++RAR S +L
Sbjct: 223  ---DD---------NNPEPFHPRSN--IRTSLDRTRMQMRASNELDGRYSIERARTSHEL 268

Query: 1537 PGVTHAEMLLR 1547
            PGVT AE L+R
Sbjct: 269  PGVTRAESLMR 279

>Scas_704.38
          Length = 1161

 Score =  339 bits (869), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 290/1027 (28%), Positives = 483/1027 (47%), Gaps = 159/1027 (15%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            K+++VGD+++I   D +PAD++LL +S+  G  +++T  LDGE++ K+R +   T  +  
Sbjct: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-- 335

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            +      K  + +  P   ++ + G + + D     T + P++I+N L     L +T + 
Sbjct: 336  TEPDLMNKVSITASAPEKAIHNFLGKVTYKD-----TSSNPLSIDNTLWANTVLASTGFC 390

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLF--ILCLIAGVANGAY 553
            +G VV+TG DT+  +N      K   +  E+N    +L   VF    IL + AG  N  +
Sbjct: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450

Query: 554  YRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 613
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 451  YLDVMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486

Query: 614  DVLLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 672
            D  +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 487  DDTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTS-- 537

Query: 673  TEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQ 732
                                 E   I  D    +D L   SN++    + +   S+   +
Sbjct: 538  ---------------------ETLDIVSD---YVDALVNSSNSANPSGKSVPSTSR---K 570

Query: 733  DLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGF 792
            DL          R +  ++ LA+CH+V   P   D ++L   A SPDE A+V     +G 
Sbjct: 571  DL--------SARVRDMVVTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTESVGL 619

Query: 793  SFIGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICK 850
            S   + +    LL    G    ++IL +  FNS  KRM  IV      +KDE     + K
Sbjct: 620  SLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVH---DEQKDE--YWFMQK 674

Query: 851  GADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYN 910
            GAD+V+ +R+      N++ L E+T       A EGLRTL VG++++S + Y ++ + Y+
Sbjct: 675  GADTVM-ARIVE----NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYD 725

Query: 911  IAAASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 969
             A+ S+  R+++++ V    +E DL LLG T +ED+LQ+ V  SI LL  AGIK+W+LTG
Sbjct: 726  DASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTG 785

Query: 970  DKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGS 1029
            DKVETA  +  S  L++    + +I    +        P   +N L  +YL  K N    
Sbjct: 786  DKVETARCVSISAKLISRGQYVHIITKLTK--------PEGALNQL--EYL--KVNKGA- 832

Query: 1030 EEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQK 1089
                               ++IDGE+L + L     KR+F  +      V+ CR +P QK
Sbjct: 833  ------------------CLLIDGESLGMFLR--YYKREFFDVVICLPTVVACRCTPQQK 872

Query: 1090 AAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVT 1149
            A V  ++++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I +F ++T
Sbjct: 873  ADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLT 932

Query: 1150 RLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFT 1209
             L+L HG+  YKR A++     ++ ++  +    Y + + F+   L++   +  Y   +T
Sbjct: 933  ELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYT 992

Query: 1210 SLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWYMFDGIYQSVICYFFPY 1268
              PV F   LD D+  +++ I P+LY+     +  + +T F+W              F  
Sbjct: 993  MAPV-FSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALS---------LFQG 1042

Query: 1269 LIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWD---WFTTFFAFLST 1325
             + +  + +  + L +D    V I  T + +      V +E Y W+    FT    FL  
Sbjct: 1043 CVIQGCSQVFSSLLEVDFTKMVAIGFTALILNEL-IMVALEIYTWNKIMVFTEILTFLCY 1101

Query: 1326 IVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPS 1385
            ++   + G         E++     M  T  F+       L  + P +      + L+P 
Sbjct: 1102 VISVPFLG---------EYFDLKYMM--TLRFYGELLFILLVSVFPVWAAKAIHRRLHPP 1150

Query: 1386 DVEIIRE 1392
                ++E
Sbjct: 1151 SYAKVQE 1157

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 35/90 (38%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           YP N+I   KY   TF P  +  QF  F N+YFL++ +  A     +             
Sbjct: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHIL 257
                     +D +R   D E N+   H+L
Sbjct: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL 269

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  338 bits (867), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 255/942 (27%), Positives = 456/942 (48%), Gaps = 140/942 (14%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            KN+RVGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGE++ K+R +   T  +  
Sbjct: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL-- 343

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            ++D   TK  + +  P  +++++ G L +  S      + P++++N L     L ++   
Sbjct: 344  TQDEMLTKVHITASAPEKSIHMFTGKLTYKGS------SAPLSVDNTLWANTVLASSGTC 397

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKK 557
            +  V++TG DT+  +N   +  K   +  E+N    I  + +F L ++  V         
Sbjct: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVV--------- 448

Query: 558  PRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLL 617
                       I G      +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 449  -----------IGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497

Query: 618  YNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 677
             +  +      ++ +I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY         
Sbjct: 498  PDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY--------- 542

Query: 678  GLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGN 737
                                  +  +++ D ++ +++ +      +            G+
Sbjct: 543  --------------------TMETMDMVTDYIQTLTSPANMGAAGVAVT---------GS 573

Query: 738  NGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGK 797
              EV Q R +  ++ LA CH+V   P+  D N+L   A SPDE A+V     +G S   +
Sbjct: 574  RKEVSQ-RVRDLVVTLATCHNV--TPNFED-NELAYQAASPDEIAIVKFTERVGLSLFKR 629

Query: 798  TKQGLLV--EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSV 855
             +  L +  E  G+  ++ IL++  F S  KRM  IV+     ++ +     + KGAD+V
Sbjct: 630  DRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKGADTV 684

Query: 856  IYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAAS 915
            + S++ +   + +E         +   A EGLRTL + ++++S   Y++++++Y  A+ S
Sbjct: 685  M-SKIVQSNDWLEE--------EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735

Query: 916  LAGREEELDHVADL-IERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVET 974
            +  R+E ++ V    +E +L LLG T +ED+LQ  V  SI LL  AG+K+W+LTGDKVET
Sbjct: 736  MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795

Query: 975  AINIGFSCNLLNTDMELLVI-KTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEEL 1033
            A  +  S  L++    +  I K T  D                           G+   L
Sbjct: 796  ARCVCVSAKLISRGQYVHTITKLTRRD---------------------------GALSRL 828

Query: 1034 AAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVV 1093
               K + +       ++IDG++L I ++    + +F  +      V+ CR +P QKA V 
Sbjct: 829  EYLKANRNS-----CLLIDGDSLAIYMSH--YRAEFFEIVICLPVVIACRCTPQQKADVA 881

Query: 1094 KLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVL 1153
             L+++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +DY+I QF ++T+L+L
Sbjct: 882  LLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLL 941

Query: 1154 VHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPV 1213
             HG+  YKR A++     ++ ++ ++    Y + ++     L++   +  Y   +T  PV
Sbjct: 942  WHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPV 1001

Query: 1214 IFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRK 1273
              L  LD D+  +++   P+LY+     +  +   F  ++   ++Q  +   F  L    
Sbjct: 1002 FSL-TLDHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFI-- 1058

Query: 1274 TNIITQNGLGLD-HRYYVGIPVTGIAVTSCNFYVLMEQYRWD 1314
                   G+G +  +  V +  T + +      V +E Y W+
Sbjct: 1059 -------GVGSEVFKKMVALSFTALVINEL-IMVALEIYTWN 1092

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 149 HNMPLPDEM----LYEDGLPIME---YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFL 201
           H++ L D+     ++ D  PI +   YP N I   KY  +TF P  +  QF  F N+YFL
Sbjct: 162 HSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFL 221

Query: 202 IM 203
           ++
Sbjct: 222 LV 223

>Kwal_23.5789
          Length = 1133

 Score =  335 bits (859), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 257/891 (28%), Positives = 436/891 (48%), Gaps = 135/891 (15%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            K+++VGD+++I      PAD++LL +S+  G  +++T  LDGE++ K+R  + C      
Sbjct: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            S+D    +  + +  P  ++  + G L +     G+  ++P++++N +       +   A
Sbjct: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLFILCLIAGVANGAYYR 555
            +  VV+TG DT+  +N  ++  K   +  E+N    +L   VF+  + L+A         
Sbjct: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVA--------- 417

Query: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615
                          AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 418  -------------FAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDS 464

Query: 616  LLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTE 674
             +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY      
Sbjct: 465  TI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYT----- 512

Query: 675  ALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDL 734
                      +DT               +I+ D +R +S+N        + V     +DL
Sbjct: 513  ----------MDT--------------MDIVTDYVRAMSDNLNS-----SAVPSASKKDL 543

Query: 735  LGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSF 794
             G        R +  +L LALCH V   P   D  +L   A SPDE A+V     +G + 
Sbjct: 544  PG--------RVRDLVLTLALCHQV--TPTFED-GELTYQAASPDEIAIVKFTESVGLTL 592

Query: 795  IGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGA 852
              + +    LL +  G   E+ IL++  FNS  KRM  ++      +K +     + KGA
Sbjct: 593  FRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGA 647

Query: 853  DSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIA 912
            D V+ S++ +K    ++ L E+T       A EGLRTL +G++ +S    Q + + Y  A
Sbjct: 648  D-VVMSKIVQK----NDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698

Query: 913  AASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDK 971
            +  +  RE  + +V +  +E DL +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDK
Sbjct: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758

Query: 972  VETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEE 1031
            VETA  +  S  L++       + T  +  K  G        AL    L+ K N      
Sbjct: 759  VETARCVSISAKLVSRGQ---YVHTVTKVNKPEG--------ALTHLELL-KINTNS--- 803

Query: 1032 ELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAA 1091
                             ++IDGE+L + L  +  +++F  +  N  AV+ CR +P QKA 
Sbjct: 804  ----------------CLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKAD 845

Query: 1092 VVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRL 1151
            V   +++        IGDG NDV+MIQSADVGVGI G+EG+QA + +D++I QF ++++L
Sbjct: 846  VATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKL 905

Query: 1152 VLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSL 1211
            +L HG+  YKR A++     ++ ++ ++    Y + + F+   L++   +  Y   +T  
Sbjct: 906  LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMA 965

Query: 1212 PVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVI 1262
            PV  L  LD D+  +++   P+LY+     +  +   F  ++   ++Q  +
Sbjct: 966  PVFSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 167 EYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAF 209
           +Y  N I   KY P+TF PK +  QF  F N+YFL++ +  A 
Sbjct: 155 KYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAI 197

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  335 bits (858), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 259/900 (28%), Positives = 436/900 (48%), Gaps = 141/900 (15%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            K+++VGD+++I     +PAD+ILL +S+  G  +++T  LDGE++ K+R  + CT     
Sbjct: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLR--IACTLTQNL 319

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            + D    K  + +  P  +++ + G + + D     T+   +TI+N L     L ++ + 
Sbjct: 320  NEDDLLEKITITASAPEKSIHSFLGRVTYKD-----TNTSGLTIDNTLWANTVLASSGFC 374

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELN--FSVLINFVFLF--ILCLIAGVANGAY 553
            +G V++TG DT+  +N      K   +  E+N    +L   VF+   +L + AG+ N  +
Sbjct: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434

Query: 554  YRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 613
            Y                        V     +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 435  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 470

Query: 614  DVLLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 672
            D  +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 471  DKTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTET 523

Query: 673  TEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQ 732
             + ++            +G IE                                SK  S 
Sbjct: 524  ADIVSDY---------IQGMIE--------------------------------SKNDSV 542

Query: 733  DLLGNNGEVQQKRCQH---FMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARD 789
              LG     ++    H    +  LA+CH+V   P   D ++L   A SPDE A+V     
Sbjct: 543  TNLGPRSTTRKDAATHVIDLITTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTES 599

Query: 790  MGFSFIGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALL 847
            +G S   + +    LL E  G    + +L +  FNS  KRM  IV      +K + +   
Sbjct: 600  VGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWF 654

Query: 848  ICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNE 907
            + KGAD+V+   ++     N++ L E+T       A EGLRTL +G+++++   Y+++ +
Sbjct: 655  LQKGADTVMNRIVA-----NNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKK 705

Query: 908  KYNIAAASLAGREEEL-DHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWV 966
            +Y   +AS+  RE+E+ + ++  +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+
Sbjct: 706  EYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWM 765

Query: 967  LTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNM 1026
            LTGDKVETA  +  S  L++    + V+    +        P    N L  +YL  K N 
Sbjct: 766  LTGDKVETARCVSISAKLISRGQYVHVVTKLSK--------PEGAFNQL--EYL--KVNK 813

Query: 1027 TGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSP 1086
                                  ++IDGE+L + L     +++F  +  +   V+ CR +P
Sbjct: 814  NA-------------------CLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTP 852

Query: 1087 AQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1146
             QKA V  ++++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF 
Sbjct: 853  QQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFC 912

Query: 1147 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNL 1206
            ++T L+L HG+  YKR A++     ++ +I  +    + V + F+   L++   +  Y  
Sbjct: 913  HLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYAT 972

Query: 1207 AFTSLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFF 1266
             +T  PV  L  LD D+  +++ + P+LY+     +  +   F  ++    YQ ++   F
Sbjct: 973  CYTMAPVFSL-TLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVIQGF 1031

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMII 205
           +P N++   KY  +TF P  +  QF  F N+YFL++ +
Sbjct: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVAL 201

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  325 bits (834), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 256/929 (27%), Positives = 445/929 (47%), Gaps = 141/929 (15%)

Query: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437
            K+++VGDI+++     +PADV++L T++ +G  +++T  LDGE++ K+R +   T ++  
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSL-- 328

Query: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497
            + +       + +  P  +++ + G + + DS      + P++++N +     L ++   
Sbjct: 329  TENDLLNNITITASAPEHSIHNFLGKITYKDST-----SSPLSVDNTMWENTVLASSAAC 383

Query: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELN--FSVLINFVFLFILCLIAGVANGAYYR 555
            +  +V+TG +T+  +N   +  K   +  E+N    +L   VFL  + L+A         
Sbjct: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVA--------- 434

Query: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615
                          AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 435  -------------FAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDK 481

Query: 616  LLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEA 675
             + +  +      ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY       
Sbjct: 482  QIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTN----- 530

Query: 676  LAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLL 735
                                    +  +I+ D ++  S NS+      T   K  S    
Sbjct: 531  ------------------------ETMDIVTDFIQ--SMNSRTSNSTPTTTRKNISD--- 561

Query: 736  GNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFI 795
                     R    +  LA+CH+V   P   D  +L   A SPDE A+V     +G S  
Sbjct: 562  ---------RVIDLVTTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGLSLF 609

Query: 796  GKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGAD 853
             + +    L  +  G++ E+ I  +  FNS  KRM  I+      +K +     + KGAD
Sbjct: 610  RRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVII-----FDKLKQEYWFLQKGAD 664

Query: 854  SVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAA 913
            +V+ S + R     +ET            ATEGLRTL +G++++S + ++++ ++Y+ A+
Sbjct: 665  TVMSSIVVRNDWLEEET---------SNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEAS 715

Query: 914  ASLAGREEELDHVA-DLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 972
             ++  RE  + +V    +E DL LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDKV
Sbjct: 716  LTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 775

Query: 973  ETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEE 1032
            ETA  +  S  L+          + G+ V                 + + K N    + E
Sbjct: 776  ETARCVSISAKLI----------SRGQYV-----------------HTVTKVN----KPE 804

Query: 1033 LAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1092
             A    ++        ++IDGE+L + L       +F  +  N   V+ CR +P QKA V
Sbjct: 805  GALHHLEYLQVNQNSCLLIDGESLGLYL--QYFPDEFFDIVVNLPTVVACRCTPQQKADV 862

Query: 1093 VKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1152
               ++         IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I QF ++T+L+
Sbjct: 863  AVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLL 922

Query: 1153 LVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP 1212
            L HG+  YK  A++     ++ +I ++    Y + + F+   L++   +  Y   +T  P
Sbjct: 923  LWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAP 982

Query: 1213 VIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWY---MFDGIYQSVICYFFPY 1268
            V  L  LD D+  +++ + P+LY+   L +  + +T F+W    +F G    +   FF  
Sbjct: 983  VFSL-TLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTS 1041

Query: 1269 LI---YRKTNIITQNGLGLDHRYYVGIPV 1294
            L    + K   I+   L L+    VG+ +
Sbjct: 1042 LNDSDFTKMVAISFTALVLNELIMVGLEI 1070

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 35/94 (37%)

Query: 167 EYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXX 226
           +YP N I   KY P TF P  +  QF  F N+YFLI+ +  A     +            
Sbjct: 172 KYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAF 231

Query: 227 XXXXXXXXXXXEDSRRTLLDMEVNNTRTHILQGP 260
                      +D  R   D E NN    ++  P
Sbjct: 232 VLTVTMSKEAMDDINRRKRDREANNELYEVVNKP 265

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  324 bits (831), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 190/544 (34%), Positives = 296/544 (54%), Gaps = 45/544 (8%)

Query: 867  NDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV 926
            N+E +LEKT   +E ++TEGLRTL    + IS  ++++W  +Y+ A  SL+ R++++D V
Sbjct: 953  NEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEV 1012

Query: 927  ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
               IE +L LLG TAIED+LQ+GV ++I  +  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 1013 GAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH 1072

Query: 987  TDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE 1046
                ++++ T+ E++              +SK       M    +E+ +    H      
Sbjct: 1073 DYSTVVILTTSDENI--------------ISK-------MNAISQEVDSGNVAHC----- 1106

Query: 1047 FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDT-LDVMTL 1105
              I+IDG  L +     T+   F  LC    +V+CCR SPAQKA +V  +++T   ++TL
Sbjct: 1107 -VIVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTL 1165

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDG+ND+AMIQSAD+GVGIAG+EG QA   +DY+IGQFR++ +L+LVHG++ Y R A+
Sbjct: 1166 AIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAK 1225

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
             I   FYK + F L    Y  +  F G+ L+E   L+ YN  FTSLPV+ +G+ ++D+  
Sbjct: 1226 FILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKP 1285

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285
               + VP+LY  G L + +N + F  ++F G   ++I  F   + + +T++       L 
Sbjct: 1286 VTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFLNIVAWGETSLSDNTLYPLG 1345

Query: 1286 HRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSI------ 1339
               +V    T   +     ++ M    W       AF S I+  G   +W  ++      
Sbjct: 1346 ---FVNFSATVALINVKAQFIEMRNRNW------LAFTSVILSCGGWLVWCCALPILNRS 1396

Query: 1340 -ASYEFWKGASRMYGTP-SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHG 1397
               Y+   G    +G   +FW    +  +  I+    Y  F   L PSD +I  E+ Q  
Sbjct: 1397 DGIYDVTYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQKS 1456

Query: 1398 DFAR 1401
            +  +
Sbjct: 1457 EIRK 1460

 Score =  233 bits (593), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 169/557 (30%), Positives = 289/557 (51%), Gaps = 75/557 (13%)

Query: 369 NSKFANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQS 428
           N +     WK++RVGD V +  +D +PAD+++L++   +   ++ET  LDGE+NLK +  
Sbjct: 255 NVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVP 314

Query: 429 LRCTNAI-RNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLR 487
               N + +++  +      V  E P+ +LY ++GNL+ ++S        P+  +N++ R
Sbjct: 315 HPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLE-LNSGSSSKKKYPLGPDNVIYR 373

Query: 488 GCTLRNTKWAMGIVVFTGDDTKTMINAGVTP-TKKSRISRELNFSVLINFVFLFILCLIA 546
           G  +RNT+  +G+V+FTG+++K  +NA   P TK  ++ R++N  V+     +  + L +
Sbjct: 374 GSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFS 433

Query: 547 GVANGAYYRKK-PRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKT 605
            + +    ++    ++ ++     AG   T   +SF   +I+Y +++P+SLY+++E+IK 
Sbjct: 434 YLGHTIQIKRYVNNNKAWYLLQEDAGTAPT--IMSF---IIMYNTIIPLSLYVTMELIKV 488

Query: 606 AQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 665
           AQ+  +  D+ +Y+   D PC  ++ +I ++LGQ+ YIFSDKTGTLT N M F+K +  G
Sbjct: 489 AQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCG 548

Query: 666 VSYGRAYTEAL-----AGLRKRQGIDT------------------------------EKE 690
            S+    T+ +     A L  +  ID                               ++ 
Sbjct: 549 TSWVHNATQDISEFKPAQLSNKNDIDVISIDDQSFLSKLGYTSQSNPKRYMDINDFPDRR 608

Query: 691 GRIEREGIAQDREIMIDDLRKI---------SNNSQ---FYPEEL--TFVSKEFSQDLLG 736
             +E +G A  +      +R +         ++NSQ     PE++  TF   E    +  
Sbjct: 609 TSVEYKGNATVKYTGRPSMRSLYVPPKKETNASNSQDASDIPEDIKSTF---ELIYYIQS 665

Query: 737 NNGEVQQKRCQHFMLALALCHSVL---VEPDKNDPNKLELTAQSPDETALVTTARDMGFS 793
           N   +  K+ + F+L+LA+CH  L    E   ++ + +E  + SPDE ALVT ARDMG+ 
Sbjct: 666 NPKSLFAKKAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYI 725

Query: 794 FIGKTKQGLLVEV--QGIQ-----KEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRAL 846
              +    L ++    G       + F+IL +++FNS RKRMS IV++P   EKD  R L
Sbjct: 726 VYNRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPE--EKD--RVL 781

Query: 847 LICKGADSVIYSRLSRK 863
           L CKGAD+VI  RL  K
Sbjct: 782 LFCKGADNVILERLHNK 798

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N I +++YT ++FFP+ +  QF+  AN+YF I+ IL     +  T            
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHILQ 258
                     +D RR  LD E NN  T +LQ
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVLQ 213

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  320 bits (819), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 197/546 (36%), Positives = 293/546 (53%), Gaps = 49/546 (8%)

Query: 867  NDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV 926
            N+E +LEKT   +++++TEGLRTL    + I   EY+ W  KY+ A  SL  R  ++  V
Sbjct: 932  NEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEV 991

Query: 927  ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
               IE DL LLG TAIED+LQ+GVP++I  +  AGIK+W+LTGDK ETAINIG++C L+ 
Sbjct: 992  GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIY 1051

Query: 987  TDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE 1046
                ++++K   ++              L+SK       MT   EEL   K  H      
Sbjct: 1052 DYSTVVILKKNDDN--------------LISK-------MTALGEELDTGKIAHC----- 1085

Query: 1047 FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVK-DTLDVMTL 1105
              ++IDG +L +     TM   F+ LC    +V+CCR SP+QKA +V  ++    D++TL
Sbjct: 1086 -VLVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTL 1144

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDG+ND+AMIQSAD+GVGI G+EG QA   SDY+I QFRY+ +L+ VHG++ Y R ++
Sbjct: 1145 AIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSK 1204

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
             +   FYK V+F L    Y     F G+ L+E   L+ +N  FTSLPVI +G+ ++D+  
Sbjct: 1205 FVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKP 1264

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285
               + VP+LY  G   Q +N   FL +M      SV+  F  + I+  T    Q+    D
Sbjct: 1265 MTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIWGFT---AQS----D 1317

Query: 1286 HRYYVGIPVTGIAVTSCNFYV-----LMEQYRWDWFTTFFAFLSTIVYFGWT----GIWS 1336
            +  Y   P+  I  TS  F +      +E    +W       +S I +  W     GI+ 
Sbjct: 1318 NSIY---PIGVINFTSICFLINVKCQFIETRNRNWLAFASLLISCIGWILWCCLLPGIYG 1374

Query: 1337 SSIASYEFWKGASRMYGTP-SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQ 1395
             + A Y+   G    +G   ++WA   +  +F ++       F   ++P+D +I  E+ Q
Sbjct: 1375 EN-AIYDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQ 1433

Query: 1396 HGDFAR 1401
              D  +
Sbjct: 1434 KDDIRK 1439

 Score =  243 bits (620), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 185/571 (32%), Positives = 288/571 (50%), Gaps = 97/571 (16%)

Query: 377 WKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSL-----RC 431
           WK+++VG+ V ++++D +PAD++LLST   +   +VET  LDGE+NLK +  L     R 
Sbjct: 274 WKDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRM 333

Query: 432 TNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTL 491
           T+A   S     T      E P+ +LY ++G ++    +DG+ +  P+  +N++ RG  L
Sbjct: 334 TSATGLSMHSATTTL----EDPNNDLYNFEGTVE----IDGELY--PLGSDNVVYRGSIL 383

Query: 492 RNTKWAMGIVVFTGDDTKTMINAGVTP-TKKSRISRELNFSVLINFVFLFILCLIAGVAN 550
           RNT+  +GIV+FTG++TK  +NA   P TK  ++  +      IN + LF++ ++A +A 
Sbjct: 384 RNTQSIVGIVIFTGEETKIRMNAIKNPRTKAPKLQGK------INLIVLFMVFVVAAMAM 437

Query: 551 ----GAYYRKK---PRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEII 603
               G +  KK     +R ++ F   AG   T   +SF   +I+Y +L+P+SLY++ EII
Sbjct: 438 FSYLGQHILKKNYVDNNRAWYLFQEDAGTAPT--IMSF---IIMYNTLIPLSLYVTTEII 492

Query: 604 KTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTI 663
           K  Q+  +  D+ +Y+   D PC  ++ +I ++LGQ+ YIFSDKTGTLT N M F+K +I
Sbjct: 493 KAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSI 552

Query: 664 NGVSYGRAYTEA-------------------LAGLRKRQGIDTEKEGRIEREG------- 697
            G S+     E                    L     R          IE +G       
Sbjct: 553 CGSSWLHEIDEDLIDPIDDDIDVISIEDRSFLNEFDLRSTHSKNPRTSIEYKGNSGAVYS 612

Query: 698 ------IAQDREIMIDDLRKISNNSQFYPEE----------LTFVSKEFSQDLLGNNGEV 741
                 +   R+ + +DL     NS    EE          L ++ K  + +        
Sbjct: 613 GRPSMALQIQRQELAEDLNTTRTNSSRSSEEKNGLKTTVDLLLYIQKHPNTEF------- 665

Query: 742 QQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQG 801
              R + F+L+LALCH+ L +   +  + +   + SPDE ALVT ARDMGF    +    
Sbjct: 666 -SIRAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSST 724

Query: 802 LLVEV-------QGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADS 854
           L +         Q I +++++L  + F+S RKRMS  VK+P     D+ R LLICKGAD+
Sbjct: 725 LSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMP----NDDDRVLLICKGADN 780

Query: 855 VIYSRLSRKPGYNDETLLEKTALHLEQYATE 885
           VI  RL R        +LE+  L +EQ   E
Sbjct: 781 VILERL-RNSELAQNKVLEQQNL-IEQRKLE 809

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 1/122 (0%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N I +++YT  +F P+ +  QF+  AN YFL++ IL     +  T            
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHIL-QGPENPNVPIDNVSSWRKFKKANTKLMLK 286
                     +D +R  LD E NN  T +L  G ++  +  D++ S       +T  +L 
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 287 FF 288
            F
Sbjct: 236 DF 237

>Kwal_23.3556
          Length = 1597

 Score =  317 bits (812), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 185/542 (34%), Positives = 292/542 (53%), Gaps = 41/542 (7%)

Query: 867  NDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV 926
            N+E +LE+T   +E ++T GLRTL    + I   +Y++W++KY+ A  SL  R+E++  V
Sbjct: 952  NEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSV 1011

Query: 927  ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
             +L+E  L LLG TAIED+LQ+GV D+I  +  AGIK+W+LTGDK ETAINIG+SCNL++
Sbjct: 1012 GELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIH 1071

Query: 987  TDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE 1046
                ++++    E++                        +T   +E+      H      
Sbjct: 1072 DYSTVVILSAKDENISS---------------------KLTAVSQEIERGNIAHC----- 1105

Query: 1047 FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDT-LDVMTL 1105
              ++IDG  L    +  T+   F+ LC    +V+CCR SP+QKA +V  +++T   ++TL
Sbjct: 1106 -VVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTL 1164

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDG+ND+AMIQSAD+GVGIAG+EG QA   SDY+I QFR++ +L+LVHG++ Y R  +
Sbjct: 1165 AIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTK 1224

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
             +   FYK ++F L    Y  H  F G+ L+E   L+ +N  FTSLPV+ +G+ ++D+  
Sbjct: 1225 FVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1284

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285
               + +P+LY  G L Q +N   FL++MF     S+I  F  + I+        + L  +
Sbjct: 1285 MTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIW------AVSSLSDN 1338

Query: 1286 HRYYVGIPVTGIAVTSCNFYV-LMEQYRWDWFTTFFAFLSTIVYFGWT----GIWSSSIA 1340
              Y +G+      +T  N    L+E +  +        +S   +  W     GI+S    
Sbjct: 1339 TVYPIGVINFTAIITLVNVKCQLLETHNRNVLAICSLVISVGGWLLWCCLLPGIYSED-G 1397

Query: 1341 SYEFWKGASRMYGTP-SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDF 1399
             Y+   G    +G   +FW    V  +  ++    +      ++PSD EI  E+ Q  + 
Sbjct: 1398 MYDVLTGLYFQFGNDITFWCACLVLVVLPLIIDVVFKTVKIMIFPSDSEISMELEQKDEI 1457

Query: 1400 AR 1401
             +
Sbjct: 1458 RK 1459

 Score =  272 bits (695), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 226/783 (28%), Positives = 366/783 (46%), Gaps = 136/783 (17%)

Query: 138 LNRSDEFRTIY------HNMPLPDEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQ 191
           LN  D F  ++          L DE     G P   Y  N I +++YT  TF P+ +  Q
Sbjct: 78  LNHEDSFYRMFTGDGGSQTAKLTDE---RSGKP---YISNLITSSRYTIYTFLPRQLYAQ 131

Query: 192 FNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXXXXXXXXXXXXEDSRRTLLDMEVNN 251
           F+  AN YF ++ +L     +  T                      +D RR  LD E N+
Sbjct: 132 FSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIFMGISMSREAWDDFRRHKLDREEND 191

Query: 252 TRTHILQGPENPNVPIDNVSSWRKFKKANTKLMLKFFQFINERFTATGXXXXXXXXXXXX 311
               +L    +P+          +F + N+   L  +Q                      
Sbjct: 192 KTARVLVKSSSPHT---------EFSRPNSLYSLPQWQ---------------------- 220

Query: 312 XXXXLGKTELPRTSLDSYQSTRMSADYYRPSLEQSNIDSTFENGEISVLDPSLPPMANSK 371
                             QS   ++    P+LE +   +T +N + +  D     +  SK
Sbjct: 221 ------------------QSATSTSMLTNPTLESTAEAATSQNDDHTNWD-----LLKSK 257

Query: 372 FANDF----WKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQ 427
           +  +     WK+++VGD V +  ++ +PAD+++L+ SD    C+VET  LDGE+NLK +Q
Sbjct: 258 YGVEAVEKKWKDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQ 317

Query: 428 SL-RCTNAIRNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLL 486
            L   +  ++ +  +   K  V  E P+ +L+ ++GNL+    L G+     I  ++++ 
Sbjct: 318 PLTEVSEVMKTAAGLTEFKAKVTVEDPNIDLHNFEGNLE----LLGENRKLTIGPDHIIY 373

Query: 487 RGCTLRNTKWAMGIVVFTGDDTKTMINAGVTP-TKKSRISRELNFSVLINFVFLFILCLI 545
           RG  +RNT  A+G+VVFTG++TK  +NA   P  K  ++ R +N  VL   VF+     +
Sbjct: 374 RGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRIKAPKLQRAINLIVLF-MVFVVASMAL 432

Query: 546 AGVANGAYYRKK--PRSRDFFEFGTIAG-NPTTNGFVSFWVAVILYQSLVPISLYISVEI 602
             +      +KK    +R ++ F + AG  PT   F+      I+Y +L+P+SLY+++EI
Sbjct: 433 FSLLGQRIIKKKYVDNNRAWYLFNSDAGLAPTVMSFI------IMYNTLIPLSLYVTMEI 486

Query: 603 IKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCT 662
           IK  Q+  +  D+ +Y+   + PC  ++ +I ++LGQ+ YIFSDKTGTLT N M F+  +
Sbjct: 487 IKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALS 546

Query: 663 INGVSYGRAYTEALAGLRKRQGIDT--------EKEGRIEREGIAQDREIMIDDLRKI-- 712
           + G S+   +  A   L K +  D+        +    ++  G A DR++  +    I  
Sbjct: 547 VCGSSWIHDFDPAAEKLTKSESSDSNTVEVVSVDDRSFLQNFG-AADRKVPSNHKTSIDY 605

Query: 713 -SNNSQFYPEELTFVSKEFSQDL--------------LGNNGE----VQQ-------KRC 746
             N+S  Y    +  S+   +D               L ++ E    +QQ       K+ 
Sbjct: 606 KGNSSAIYTGRPSMASRICEEDKNPKKIEPEKSSKTGLRSSTELIRYIQQNPNTHFAKKV 665

Query: 747 QHFMLALALCHSVLVEPDKNDPNK--LELTAQSPDETALVTTARDMGFSFIGKTKQGLLV 804
             F+L+LALCH+ L +       +  +E  A SPDE ALVT ARDMG++ + +    L +
Sbjct: 666 SFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVLTI 725

Query: 805 EV--QGIQKE-----FQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIY 857
           +    G   E     ++ILN +EF+S RKRMS +V+LP     +E R LLICKGAD+VI 
Sbjct: 726 KTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLP----HEENRILLICKGADNVIL 781

Query: 858 SRL 860
            RL
Sbjct: 782 ERL 784

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  311 bits (796), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 193/537 (35%), Positives = 291/537 (54%), Gaps = 41/537 (7%)

Query: 867  NDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV 926
            N+E ++E+T   ++ + TEGLRTL    + I   EY+ WN +Y+ A A+L  R E++D V
Sbjct: 933  NEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV 992

Query: 927  ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
             ++IERDL LLG   IED+LQ+GVPD+I  L  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 993  GEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH 1052

Query: 987  TDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE 1046
                ++++    E+              + SK       +T   +E+ A    H      
Sbjct: 1053 DYSTVIILAPNDEN--------------MASK-------ITTITQEIEAGNVAHC----- 1086

Query: 1047 FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVV-KLVKDTLDVMTL 1105
              ++IDG  L I     T+   F+ LC    +V+CCR SP+QKA +V K+ K    ++TL
Sbjct: 1087 -VVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTL 1145

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDG+ND+AMIQSAD+GV I G+EG QA   SDY+I QFRY+ +L+LVHG++ Y R ++
Sbjct: 1146 AIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSK 1205

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
             +   FYK  +F L    + ++  F G+  +E   LT +N  FTSLPV+ +G+ ++D+ +
Sbjct: 1206 FVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKS 1265

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285
               + +P+LY +G   Q +N   FL +M      SVI  F  +  +  T   + N L   
Sbjct: 1266 VTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTNWQCWSLT-AQSDNTL--- 1321

Query: 1286 HRYYVG-IPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWT----GIWSSSIA 1340
              Y +G I  T + V       L+E    +W      F+S   +  W      I+  ++ 
Sbjct: 1322 --YPIGLINYTAVVVLVNVKCQLLEMANRNWLAFASFFISVCGWLCWCLLLPAIYKETLV 1379

Query: 1341 SYEFWKGASRMYGTP-SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH 1396
             Y+  +G    +G   +FWA   V  L  ++    +      +YPSD EI  E+ Q 
Sbjct: 1380 -YDVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQR 1435

 Score =  244 bits (624), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 170/542 (31%), Positives = 284/542 (52%), Gaps = 69/542 (12%)

Query: 377 WKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSL-RCTNAI 435
           WK+V VG+ V ++ +D +PAD+ LL+T   +  CYVET  LDGE+NLK +  L +  +  
Sbjct: 241 WKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQT 300

Query: 436 RNSRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTK 495
           R +  +   +     E P+ +LY ++G ++ +++  G+     I ++N+L RG  +RNT+
Sbjct: 301 RTASGLATFRGMTTVEDPNIDLYNFEGKIE-VETDSGEQQAYSIGLDNVLFRGSIIRNTQ 359

Query: 496 WAMGIVVFTGDDTKTMINAGVTPTKKS-RISRELNFSVLINFVFLFILCLIA-GVANGAY 553
             +G+VVFTG++TK  +NA   P  KS ++  ++N  VL   + + I   ++ G+     
Sbjct: 360 TVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFK 419

Query: 554 YRKKPRSRDFFEFGTIAG-NPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIY 612
            R+    R ++     AG  PT   F+      I+Y +L+P+SLY+++EIIK  Q+  + 
Sbjct: 420 NREVDSDRAWYLMKVDAGLAPTIMSFI------IMYNTLIPLSLYVTMEIIKDMQSRLME 473

Query: 613 LDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY---- 668
            D+ +Y+   +  CT ++ +I ++LGQ+ YIFSDKTGTLT N M F+K +  G ++    
Sbjct: 474 WDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAWEHDV 533

Query: 669 -------GRAYT---------EALAGLRKRQGIDTEKEGRIEREGIAQ---------DRE 703
                  G + T         E+ + ++  +   T+    +E +G+A            +
Sbjct: 534 ARKDQETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEYKGLASATYTGRPSIASQ 593

Query: 704 IMIDDLRKISNNSQ--------------FYPEELTFVSKEFSQDLLGNNGEVQQKRCQHF 749
           I +  L++ S N+                 PE     S +    +  N   V  +R + F
Sbjct: 594 IELMKLQQNSANTNKSSSPKISRLPTLDSSPEPKLKTSLDLIMHIQLNPNTVFSQRAKFF 653

Query: 750 MLALALCHSVLVE----PDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLV- 804
           +LALALCH+ L +     D  D + +E  + SPDE ALVT ARDMG+  + +    L + 
Sbjct: 654 ILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTIK 713

Query: 805 ------EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYS 858
                 E   + +++++LN ++F+S RKRMS +V++    EK     LLICKGAD+VI  
Sbjct: 714 TYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEK----VLLICKGADNVILE 769

Query: 859 RL 860
           RL
Sbjct: 770 RL 771

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 38/96 (39%), Gaps = 3/96 (3%)

Query: 162 GLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXX 221
           GLP   Y  N I +++Y+  +F P+ +  QF+   N YF  M IL     +  T      
Sbjct: 107 GLP---YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTI 163

Query: 222 XXXXXXXXXXXXXXXXEDSRRTLLDMEVNNTRTHIL 257
                           ED RR  LD E NN    +L
Sbjct: 164 VPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVL 199

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  308 bits (789), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 187/546 (34%), Positives = 292/546 (53%), Gaps = 49/546 (8%)

Query: 867  NDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV 926
            N+E ++E+T   +++++TEGLRTL    + I   +Y+ WN++Y+ A  SL  R+ ++D  
Sbjct: 1013 NEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA 1072

Query: 927  ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
               IE  L LLG TAIED+LQDGV ++I  +  AGIK+W+LTGDK ETAINIG+SC L+ 
Sbjct: 1073 GAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK 1132

Query: 987  TDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE 1046
                ++++ TT E++              +SK       M    +E+ +    H      
Sbjct: 1133 DYSTVVILTTTDENI--------------ISK-------MNAVSQEVDSGNIAHC----- 1166

Query: 1047 FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDT-LDVMTL 1105
              ++IDG  + +     T    F+ LC    +V+CCR SP+QKA +V  +++T  +++TL
Sbjct: 1167 -VVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTL 1225

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDG+ND+AMIQSAD+GVGIAG+EG QA   SDY+IGQFR++ +L+ VHG++ Y R ++
Sbjct: 1226 AIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSK 1285

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
             +   FYK + F      Y  +  F GS L+E   L+ +N  FTSLPV+ +G+ ++D+  
Sbjct: 1286 FMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1345

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNII--TQNGLG 1283
               + VP+LY  G L Q +N   F+ ++      S+I  F   +++  +++   T   LG
Sbjct: 1346 MTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLSDNTMYPLG 1405

Query: 1284 LDHRYYVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSI---- 1339
            L       I  T I          +E +  +W     AF S ++  G   +W  ++    
Sbjct: 1406 L-------INFTAIVALINVKSQFVEMHNRNW----LAFTSVVLSCGGWLVWCCALPILN 1454

Query: 1340 ---ASYEFWKGASRMYGTP-SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQ 1395
                 Y+   G    +G   +FW    V  L  I     Y  F   ++PSD +I  E+ Q
Sbjct: 1455 NTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQ 1514

Query: 1396 HGDFAR 1401
              D  +
Sbjct: 1515 KSDIRK 1520

 Score =  204 bits (519), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 168/604 (27%), Positives = 290/604 (48%), Gaps = 106/604 (17%)

Query: 340 RPSLEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVI 399
           R S +   +D+ F N E+      L    N       W+ +RVGD V +  +D +PAD++
Sbjct: 268 RNSSQGHFLDTHFNNFEL------LKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVPADLL 321

Query: 400 LLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAI-RNSRDICRTKFWVESEGPHANLY 458
           LL+    +  C+VET  LDGE+NLK +Q     N + + +  +      V  E P+ +LY
Sbjct: 322 LLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPNIDLY 381

Query: 459 VYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTP 518
            ++GNL+  +  +      P+  +N++ RG  LRNT+  +G+V+F+G++TK  +NA   P
Sbjct: 382 NFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNALKNP 441

Query: 519 -TKKSRISRELNFSVLINFVFLFILCLIAGVANGAY-----YRKK--PRSRDFFEFGTIA 570
            TK  ++ R+      IN + +F++ ++A ++  +Y     ++KK   +++ ++ F   A
Sbjct: 442 RTKAPKLQRK------INMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADA 495

Query: 571 G-NPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPK 629
           G  PT   F+      I+Y +++P+SLY+++EIIK  Q+  +  D+ +Y+   + PC  +
Sbjct: 496 GVAPTIMSFI------IMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESR 549

Query: 630 -------------------------------------SWSISDDLGQIEYIFSDK---TG 649
                                                SW  + DLG  E  F D    T 
Sbjct: 550 TATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDNFEDNRDNTN 609

Query: 650 TLTQNVMEFKKCTINGVSYGR-------AYTEALAGLRKRQGIDTEKEGR--IEREGIAQ 700
           +L          +I+ VS G         +++A      R  +D   + R  IE +G + 
Sbjct: 610 SLRLPPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSLDNFPKSRNSIEYKGNSS 669

Query: 701 DREIMIDDLRKI--SNNSQFYPEELTFVSKE-FSQDLLGNNGEVQ----------QKRCQ 747
                   +R +   +NS    +       E FS+++  +   +Q           ++ +
Sbjct: 670 AIYTGRPSMRSLFGKDNSHLSKQASVISPSETFSENIKSSFDLIQFIQRYPTALFSQKAK 729

Query: 748 HFMLALALCHSVLVEPDKNDP---NKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLV 804
            F L+LALCHS L +   N+    + +E  + SPDE ALVT ARD+G+  + +  Q L +
Sbjct: 730 FFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTI 789

Query: 805 EV-------QGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEP-RALLICKGADSVI 856
           +        +   + ++ILN ++FNS RKRMS +V++P     ++P + LLICKGAD+VI
Sbjct: 790 KTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMP-----NQPNQVLLICKGADNVI 844

Query: 857 YSRL 860
             RL
Sbjct: 845 MERL 848

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N+I +++YT  +F P+ +  QF+  AN YF I+ +L     +  T            
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHIL 257
                     +D RR  LD E NN    +L
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVL 227

>Scas_669.3
          Length = 1638

 Score =  291 bits (744), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 185/545 (33%), Positives = 294/545 (53%), Gaps = 47/545 (8%)

Query: 867  NDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV 926
            ND  ++EKT   +++++TEGLRTL    + +   EYQ+W ++Y+ A  SL  R+ ++  V
Sbjct: 987  NDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV 1046

Query: 927  ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
             + IE+DL LLG TAIED+LQ+GV ++I  +  AGIK+W+LTGDK ETAINIG+SC L+ 
Sbjct: 1047 GEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLI- 1105

Query: 987  TDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE 1046
             D   +VI   G++              ++SK       M    +E+ +    H      
Sbjct: 1106 YDYSTVVILAKGDE-------------NIISK-------MNAISQEVDSGNVAHC----- 1140

Query: 1047 FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDT-LDVMTL 1105
              IIIDG  L +     T+   F+ LC    +V+CCR SP+QK+ +V  ++++  +++TL
Sbjct: 1141 -VIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTL 1199

Query: 1106 AIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAE 1165
            AIGDG+ND+AMIQSAD+G+GI G+EG QA   +DY+I QFR++ +L+LVHG++ Y R A+
Sbjct: 1200 AIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTAK 1259

Query: 1166 MIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSA 1225
             I   F+K + F L    +  +  F GS L+E   L+ +N  FTSLPV+ +G+ ++D+  
Sbjct: 1260 FILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKP 1319

Query: 1226 TVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLD 1285
               + +P+LY  G L Q +N   F  ++      +++  F   +I+ +T +        D
Sbjct: 1320 MTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNIIIWGETALS-------D 1372

Query: 1286 HRYY-VGI----PVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTG---IWSS 1337
            H  Y +G+     +  +    C F + M    W  FT+    LS   +  W     I + 
Sbjct: 1373 HTMYPLGVINFTAIVALVNVKCQF-IEMNNRNWVVFTS--VILSCGGWLVWCCALPILNR 1429

Query: 1338 SIASYEFWKGASRMYGTP-SFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH 1396
            S   Y+   G    +G   ++W   FV  +  I     Y  F   ++PSD +I   + Q 
Sbjct: 1430 SDVIYDVPYGFFYHFGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQK 1489

Query: 1397 GDFAR 1401
             +  +
Sbjct: 1490 SEIRK 1494

 Score =  240 bits (612), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 173/551 (31%), Positives = 289/551 (52%), Gaps = 83/551 (15%)

Query: 377 WKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIR 436
           W N+ VGD V +  ++ +PAD+++L++   +  C+VET  LDGE+NLKV+Q     N + 
Sbjct: 285 WSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECFVETMALDGETNLKVKQPHPELNKLA 344

Query: 437 NSRD-ICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTK 495
            S   +      +  E P+++LY ++GNL+  D+ +      P+  +N+  RG  +RNT 
Sbjct: 345 CSASGLANINALITVEDPNSDLYNFEGNLELTDNNNNSLKKYPVGPDNVAYRGSIIRNTD 404

Query: 496 WAMGIVVFTGDDTKTMINAGVTP-TKKSRISRELNFSVLINFVFLFILCLIAGVANGAYY 554
             +G+V++TG +TK  +NA   P TK  ++ + +N  ++I F+ +F++ +I+  +   + 
Sbjct: 405 NVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN--IIITFM-VFVVAVISLFSYLGHV 461

Query: 555 RKKPRSRD----FFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 610
            +  ++ D    ++     AG   T   +SF   +I+Y +++P+SLY+++EIIK  Q+  
Sbjct: 462 LQNKKAIDENQAWYLLTKDAGAAPT--IMSF---IIMYNTIIPLSLYVTMEIIKAMQSKM 516

Query: 611 IYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 670
           +  D+ +Y+   + PC  ++ +I ++LGQ+ Y+FSDKTGTLT N M F+K +I G S+  
Sbjct: 517 MEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDNKMIFRKFSICGSSWLH 576

Query: 671 AYTEALAGLRK------RQGID-------------------TEKEGR---------IERE 696
           +       L K         ID                   TE + R         +E +
Sbjct: 577 STDLGSNALYKGSPNSNNSDIDVVSLENQSLLDKFVKTEGSTELDARTNFPNFRASVEYK 636

Query: 697 GIAQD--------REIMIDDLRKISNNSQF------YPEELTFVSKEFSQDLLGNNGEVQ 742
           G +          R +   DL    N S+        P+ +   S +  Q +  N   + 
Sbjct: 637 GTSSAVYTGRPSMRSLYPQDLHLTPNPSRSSRGTSDAPDNIK-TSFDLIQFIQHNPNTLF 695

Query: 743 QKRCQHFMLALALCHSVLVEPDKND-----PNKLELTAQSPDETALVTTARDMGFSFIGK 797
            K+ + F+L+LALCH+ L  P K++      + +E  + SPDE ALVT ARD+G+  + K
Sbjct: 696 AKKAKFFILSLALCHTCL--PKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNK 753

Query: 798 TKQGLLV-------EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEP-RALLIC 849
               L +       E + I +++QILN ++FNS RKRMS +VK P     DEP + LLIC
Sbjct: 754 NADVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTP-----DEPNKVLLIC 808

Query: 850 KGADSVIYSRL 860
           KGAD++I  RL
Sbjct: 809 KGADNMILERL 819

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 58/138 (42%), Gaps = 13/138 (9%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N I +++YT  +FFPK +  QF+  AN+YF ++ IL     +  T            
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHILQG-------PENPNVP----IDNVSSWRKF 276
                     +D RR  LD E NN    IL         P++  +P    IDN+S+    
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 277 KKANTKLMLKFFQFINER 294
              NTK     F F+ ER
Sbjct: 260 DYLNTK--FNNFPFLEER 275

>Scas_505.4
          Length = 1025

 Score =  229 bits (583), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 204/370 (55%), Gaps = 19/370 (5%)

Query: 1036 AKKDHSPPQGE---FAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV 1092
            A K+H   Q E    A++IDG++L  AL  D ++   L L K CKAV+CCRVSP QKA V
Sbjct: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALESD-LEDYLLALGKICKAVVCCRVSPLQKALV 602

Query: 1093 VKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1152
            VK+VK     + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D A+GQFR++ +L+
Sbjct: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662

Query: 1153 LVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLP 1212
            LVHG W Y+R++  I   FYKN    +  FW+   N F G  + E   +++YN+ FT  P
Sbjct: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722

Query: 1213 VIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYR 1272
               +G+ DQ VS+ +    PQLY+ G   + ++   F  ++ +G Y S + Y    L YR
Sbjct: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782

Query: 1273 KTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQY-----RWDWFTTFF---AFLS 1324
                +  +G   DH  +      GIAV + +  +++ +      +W  FT F    +F+ 
Sbjct: 783  YGMALNMHGEVADHWSW------GIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIF 836

Query: 1325 TIVYFG-WTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLY 1383
             +++F  +  ++  +  S E++      YG+ +FW    V  +F ++  F +  + +   
Sbjct: 837  WMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYE 896

Query: 1384 PSDVEIIREM 1393
            P    +++EM
Sbjct: 897  PESYHLVQEM 906

 Score =  152 bits (383), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 124/209 (59%), Gaps = 11/209 (5%)

Query: 343 LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402
           ++++N D    N +  +         N  F    W ++R GD++R+ + + IPAD+I++S
Sbjct: 309 IKRANSDKELNNSKTEIYSEE-----NGDFIERRWIDIRAGDVIRVKSEEAIPADLIVIS 363

Query: 403 TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462
           +S+ +G CY+ET NLDGE+NLK++Q+   T  + +SR +   K  V SE P+++LY Y+G
Sbjct: 364 SSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLYTYEG 423

Query: 463 NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522
            L++           P++   M+LRG TLRNT W  G+V+FTG +TK M NA  TP K++
Sbjct: 424 TLEF------NNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRT 477

Query: 523 RISRELNFSVLINFVFLFILCLIAGVANG 551
            + R +N  ++  F  L +L LI+ + N 
Sbjct: 478 AVERVINLQIVALFGVLIVLVLISSLGNA 506

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 38/89 (42%)

Query: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGXXXXXXXXX 227
           Y  N I TTKY   TF PK +  +F+ +AN++FL    +        TN           
Sbjct: 237 YGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVV 296

Query: 228 XXXXXXXXXXEDSRRTLLDMEVNNTRTHI 256
                     ED +R   D E+NN++T I
Sbjct: 297 LIVSAFKESIEDIKRANSDKELNNSKTEI 325

>Scas_89.1
          Length = 271

 Score =  157 bits (397), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 158/286 (55%), Gaps = 34/286 (11%)

Query: 902  YQEWNEKYNIAAASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEA 960
            Y ++ ++Y+ A+ S+   +E +  V    +E +L LLG T +ED+LQ+ V  SI LL  A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 961  GIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYL 1020
            G+K+W+LTGDKVETA  +  S  L++    +  +             P   +NAL  +YL
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSR--------PEGALNAL--EYL 111

Query: 1021 MEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVL 1080
              K N +                     ++IDGE+L + LT    K++F  +  +  AV+
Sbjct: 112  --KINKSS-------------------CLLIDGESLGMFLT--YYKQEFFDIVVDLPAVI 148

Query: 1081 CCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDY 1140
             CR +P QKA V  L+++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D+
Sbjct: 149  ACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADF 208

Query: 1141 AIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGV 1186
            ++ QF ++T+L+L HG+  YKR A++     ++ +I ++    Y V
Sbjct: 209  SVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSV 254

>Kwal_47.17547
          Length = 1240

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 149/655 (22%), Positives = 247/655 (37%), Gaps = 133/655 (20%)

Query: 379 NVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNS 438
           ++ VGDI+ +   D +PAD IL     + G C  +   L GES    + ++         
Sbjct: 203 DILVGDILSLQTGDVVPADCIL-----VKGSCECDESALTGESATIKKAAI--------- 248

Query: 439 RDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAM 498
            D+C  K+   S    A      G  K  D         P+ I+   L     R    ++
Sbjct: 249 -DVCYEKYKQLSATDAAIDIGTPGAEKVPD---------PMLISGSKLLSGLGRAVVTSV 298

Query: 499 GIVVFTGDDTKTM-INAGVTPTKKSRISRELNFSV------LINFVFLFILCLIAGVANG 551
           G+    G     + + A  TP ++   S   + SV      L+ F  LF+  L      G
Sbjct: 299 GVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGG 358

Query: 552 AYYRKKPRSRDFFEFGTIAGNPTTNGF-VSFWVAVILYQSLVPISLYISVEIIKTAQAIF 610
             +   P  +         G+   N F V   V V+     +P+++ +++    T  A  
Sbjct: 359 ELHDLTPAQK---------GSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKD 409

Query: 611 IYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 670
             L       R+   C        + +G    + SDKTGTLT+N M   K  +    +  
Sbjct: 410 GNL------VRVLRAC--------ETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDE 455

Query: 671 AYTEALAGLRKRQGIDTEKEGRIEREGIAQD--REIMIDDLRKISNNSQFYPEELTFVSK 728
           A  E++        +D           IA +   E+  D L  I+ NS        F +K
Sbjct: 456 A--ESVGPSDSETDVDL---------AIANECSEELKKDVLTNITLNST------AFENK 498

Query: 729 EFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTAR 788
           E  +D + N     + R   F  +            +N+ +K   TA+   E A     +
Sbjct: 499 ENEEDKVSNENPFHKPRKSLFPWS------------RNNKSKKPATAKELVENAAADQPK 546

Query: 789 DMGFSFIG-KTKQGLLVEVQ------------------GIQKEFQILNILEFNSSRKRMS 829
           +    F+G KT+  LL   Q                  GI+K   I+ I+ F SSRK   
Sbjct: 547 E---PFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEK---IVQIIPFESSRKWGG 600

Query: 830 CIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLL------EKTALHLEQYA 883
            +VK      +         KGA  ++  R  +K   + +  L      ++ +  +   A
Sbjct: 601 IVVKYKNGLHR------FYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLA 654

Query: 884 TEGLRTLCVGQREI----SW--SEYQEWNEKYNIAAASLAG----REEELDHVADLIERD 933
            E LR + +  R+     +W  SE Q+  E    +   L G    R + +   A  +   
Sbjct: 655 AEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSP 714

Query: 934 LVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTD 988
           +VL G   I+D L+ GV  S+    +AG+ + ++TGD + TA  I   C++L+ +
Sbjct: 715 MVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEE 769

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1080 LCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVG--VGIAGEE-GRQA-- 1134
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GIAG E  R+A  
Sbjct: 800  VLARSSPEDKRILVETLKKMGDVVAVT-GDGTNDAPALKLADVGFSMGIAGTEVAREASD 858

Query: 1135 --VMCSDYA 1141
              +M  D++
Sbjct: 859  IILMTDDFS 867

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 134/324 (41%), Gaps = 51/324 (15%)

Query: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874
            I+   EF S  +RMS IVK       +E       KGA  VI          N  TL   
Sbjct: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDIC------NPATLPSD 964

Query: 875  TALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDL 934
                L  Y   G R +    + +            N    S   R EE       +E ++
Sbjct: 965  YDDILNFYTHSGYRVIACAGKTL----------PKNTWLYSQKVRREE-------VESNM 1007

Query: 935  VLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVI 994
              LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  D   +  
Sbjct: 1008 EFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPT 1067

Query: 995  KTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIIDGE 1054
                +   +      EI NA   +++++ F +   +        D+S   G + + I GE
Sbjct: 1068 VAYSDMTVQPVIHWNEISNA---EHILDTFTLQPID--------DYS---GPYTLAITGE 1113

Query: 1055 ALKIALTG-DTMKRKF---LLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDG 1110
              +I  +  D    ++   +LL    K  +  R+SP +K  +V+ ++  +D      GDG
Sbjct: 1114 VFRIIFSNQDNYSEEYVNEILL----KGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDG 1168

Query: 1111 SNDVAMIQSADVGVGIAGEEGRQA 1134
            +ND   +++ADVG+ ++  E   A
Sbjct: 1169 ANDCGALKAADVGISLSEAEASVA 1192

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 142/322 (44%), Gaps = 46/322 (14%)

Query: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL-LE 873
            I+   EF S+ +RMS IVK  P +E      +   KGA  VI+   S+      +TL L+
Sbjct: 912  IVRSFEFLSNLRRMSVIVK--PFSEN---VFMSFTKGAPEVIFELCSK------QTLPLD 960

Query: 874  KTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERD 933
              AL L  Y   G R +    ++++    Q W     ++      REE        IE +
Sbjct: 961  YEAL-LHHYTHNGYRVIACAGKKLT---RQSWLYSQKVS------REE--------IESN 1002

Query: 934  LVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLV 993
            L  LG    E++L+    +++  L  A I+  + TGD V TAI++G    L+ +   + V
Sbjct: 1003 LEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESP-RVFV 1061

Query: 994  IKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEEL-AAAKKDHSPPQGEFAIIID 1052
                  D  + GD             ++   N+  S + L +   +  S    ++ + + 
Sbjct: 1062 SVINDIDTSQEGD-------------IITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVT 1108

Query: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSN 1112
            GE  ++    D  + + ++     K  +  R+SP +K  +V+ ++ ++       GDG+N
Sbjct: 1109 GEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGAN 1167

Query: 1113 DVAMIQSADVGVGIAGEEGRQA 1134
            D   +++AD+G+ ++  E   A
Sbjct: 1168 DCGALKAADIGISLSEAEASVA 1189

>Scas_665.30
          Length = 1439

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/327 (25%), Positives = 135/327 (41%), Gaps = 55/327 (16%)

Query: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874
            I+   EF S  +RMS IVK       +E       KGA  VI          N  TL   
Sbjct: 704  IIRSFEFLSELRRMSVIVK-----PSNEDVYWAFTKGAPEVITQIC------NKATLPAN 752

Query: 875  TALHLEQYATEGLRTLCVGQREI---SWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                L  Y  +G R +    R +   +W   Q+              REE        +E
Sbjct: 753  FEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQK------------VSREE--------VE 792

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDM-- 989
             ++  LG    E++L+     ++  L EA I+  + TGD V TAI++G  CNL+ +    
Sbjct: 793  SNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVY 852

Query: 990  --ELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEF 1047
               L  I +TG+       D   + + L S+ L+   N + +   LA          G+ 
Sbjct: 853  VPSLEEIDSTGQ-TSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAIT--------GDI 903

Query: 1048 AIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAI 1107
              II G+    +++ D +    L      K  +  R+SP +K  +++ ++  L+      
Sbjct: 904  FRIIFGDENN-SISEDYINTVLL------KGTIYARMSPDEKHELMEQLQ-RLNYTVGFC 955

Query: 1108 GDGSNDVAMIQSADVGVGIAGEEGRQA 1134
            GDG+ND   +++ADVG+ ++  E   A
Sbjct: 956  GDGANDCGALKAADVGISLSEAEASVA 982

>Kwal_26.9207
          Length = 1469

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 89/345 (25%), Positives = 137/345 (39%), Gaps = 94/345 (27%)

Query: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874
            ++   EF S  +RMS IVK        E       KGA  VI          N  TL   
Sbjct: 934  VIRSFEFVSELRRMSVIVK-----PYGENVFWGFTKGAPEVISEIC------NKSTLPAN 982

Query: 875  TALHLEQYATEGLRTL-CVGQR--EISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                L+QY   G R + C G+   + +W   Q+              REE        +E
Sbjct: 983  YEQILQQYTHNGYRVIACAGKTLPKRTWRFAQK------------VSREE--------VE 1022

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991
             ++  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    L+ T+  +
Sbjct: 1023 SNMEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLI-TESHV 1081

Query: 992  LVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIII 1051
             V +                             NM  +E+ +     D      +  +I+
Sbjct: 1082 FVPQIND--------------------------NMDPNEDLIIWRDVD------DCDLIL 1109

Query: 1052 DGEALK---------IALTGDTMKRKFLLLCKN-------------CKAVLCCRVSPAQK 1089
            DG  L+         IA+TGD     F LL KN              K+ +  R+SP +K
Sbjct: 1110 DGVTLEPMNGSSDYTIAVTGDV----FRLLFKNNEVLPESYINMVLLKSSIYARMSPDEK 1165

Query: 1090 AAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQA 1134
              +V  ++  LD +    GDG+ND   +++ADVGV ++  E   A
Sbjct: 1166 HELVGQLQG-LDYVVGFCGDGANDCGALKAADVGVSLSEAEASVA 1209

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 134/324 (41%), Gaps = 51/324 (15%)

Query: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874
            ++   EF S  +RMS IVK        E       KGA  VI          N  T+ + 
Sbjct: 903  VIRSFEFLSELRRMSVIVK-----GFKENTYWSFTKGAPEVIADIC------NPATIPKD 951

Query: 875  TALHLEQYATEGLRTL-CVGQR--EISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                L  Y   G R + C G+   + SW   Q+              REE        +E
Sbjct: 952  FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK------------VSREE--------VE 991

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991
             +L  LG    E++L+     ++  L  A I+  + TGD V TA+++G    L+++  E 
Sbjct: 992  DNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISS--ER 1049

Query: 992  LVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEEL-AAAKKDHSPPQGEFAII 1050
            + I    ++++E             S++L+   ++      L A   K  + P+  + + 
Sbjct: 1050 VFIPFLNDNLEE-------------SRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTLA 1096

Query: 1051 IDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDG 1110
            I G+  +I    D +     +     K  +  R+SP +K  +V+ ++  LD      GDG
Sbjct: 1097 ITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-LDYNVGFCGDG 1155

Query: 1111 SNDVAMIQSADVGVGIAGEEGRQA 1134
            +ND   +++A++G+ ++  E   A
Sbjct: 1156 ANDCGALKAANIGISLSEAEASVA 1179

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 134/328 (40%), Gaps = 60/328 (18%)

Query: 812  EFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL 871
            +  IL   +F+S+ KR S +          + +     KGA   I  RL   P   DE  
Sbjct: 571  QVTILRRFQFSSALKRSSSVAT-------HDGKLYSAVKGAPETIRERLFTIPANYDEIY 623

Query: 872  LEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                    + +   G R L +  +++         EK + +    A RE          E
Sbjct: 624  --------KSFTRSGSRVLALASKKL---------EKMSQSQIEDADREH--------FE 658

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991
            RDL   G       L+    ++I +L E+  +  ++TGD   TA+++     ++  +  +
Sbjct: 659  RDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLI 718

Query: 992  LVIKTTGEDVKEFGDDPTEIVNA--LVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAI 1049
            + +   G D K    +  E ++   +VSK   EK+ +                   ++ +
Sbjct: 719  VDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFD-----------------KYDL 761

Query: 1050 IIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGD 1109
             + G AL+ AL G    +  +       A +  RVSPAQK  ++  +KD +   TL  GD
Sbjct: 762  AVTGHALE-ALKGHHQLQDLIR-----HAWIYARVSPAQKEFILNNLKD-MGYQTLMCGD 814

Query: 1110 GSNDVAMIQSADVGVGI--AGEEGRQAV 1135
            G+NDV  ++ A VGV +    EEG + V
Sbjct: 815  GTNDVGALKQAHVGVALLNGTEEGLKKV 842

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 382 VGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLR 430
           V  +VR   +  +P D+IL     +DG C V    L GES   +++S+R
Sbjct: 275 VVSVVRTAEDSALPCDLIL-----VDGTCIVNEAMLSGESTPLLKESIR 318

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 139/324 (42%), Gaps = 60/324 (18%)

Query: 812  EFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL 871
            +  IL   +F+S+ KR S I        K    A+   KGA   I  RLS+ P   D+  
Sbjct: 574  DISILRRFQFSSALKRSSTIA----VHNKQHYSAV---KGAPETIRERLSQVPTDYDQVY 626

Query: 872  LEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                    + +   G R L +  +++     ++                E+L+  A  +E
Sbjct: 627  --------KSFTRAGSRVLALASKKLPSMSIKQI---------------EKLEREA--VE 661

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991
             DL   G       L+D   ++I +L E+  +  ++TGD   TA+++     ++  +  +
Sbjct: 662  SDLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLI 721

Query: 992  LVIKTTGEDVKEFGDDPTE-IVNALVSKYLMEKF-NMTGSEEELAAAKKDHSPPQGEFAI 1049
            L             D+P +   +ALV + + E   N    E++      +HS    ++ I
Sbjct: 722  L-------------DEPIDGSSHALVFRNIEETIVNPFNPEKD----TFEHSKLFAKYDI 764

Query: 1050 IIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGD 1109
             + G AL++ L+G +   + +         +  RVSPAQK  ++  +KD +   TL  GD
Sbjct: 765  AVTGHALQL-LSGHSQLNELIR-----HTWVYARVSPAQKEFIMNSLKD-MGYQTLMCGD 817

Query: 1110 GSNDVAMIQSADVGVGI--AGEEG 1131
            G+NDV  ++ A VG+ +    EEG
Sbjct: 818  GTNDVGALKQAHVGIALLNGTEEG 841

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 149/665 (22%), Positives = 253/665 (38%), Gaps = 158/665 (23%)

Query: 379 NVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNS 438
           N+ VGD++++   D +PAD +L     + G C  +   L GE           +N I+  
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVL-----VRGECETDESALTGE-----------SNTIKKL 217

Query: 439 RDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAM 498
                         P A+   Y       D  D          ++     C L +     
Sbjct: 218 --------------PLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLIS----- 258

Query: 499 GIVVFTGDDTKTMINAGV-----------------TPTKKSRISRELNFSV------LIN 535
           G  V +G  +  + N GV                 TP +        N SV      +  
Sbjct: 259 GSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITL 318

Query: 536 FVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPIS 595
           FV LF   L   + +G  Y   P +    +F  I           F  A+ +    VP  
Sbjct: 319 FVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDI-----------FITAITVIVVAVPEG 367

Query: 596 LYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNV 655
           L ++V +        +  D  L   R+   C        + +G    + SDKTGTLT+N+
Sbjct: 368 LPLAVTLALAFATTRMTKDGNLV--RVLRSC--------ETMGSATAVCSDKTGTLTENI 417

Query: 656 MEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQ-DREIMIDDLRKISN 714
           M   + T+     GRA  + +       G D  K   + ++  +   R ++ D++  + N
Sbjct: 418 MTVVRGTL-----GRAGFDDI-------GADPSKSNLVFKKKCSDLLRTVIYDNI--VLN 463

Query: 715 NSQF----YPEELTFVSKEFSQD--LLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDP 768
           ++ F    Y +   + S + SQ   L+    +  QK+                +PD ++ 
Sbjct: 464 STAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKK----------------KPD-DEE 506

Query: 769 NKLELTAQ--------SPDETALVTTAR-DMGFSFIGKTKQGLLVEVQGIQKEF----QI 815
           N L   A+        S  ETAL++ AR   G  F      G L   +G  ++      I
Sbjct: 507 NLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKF------GALQSFRGHPEKLPTVETI 560

Query: 816 LNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYND--ETLLE 873
           + I+ F SSRK  + +VKL    E +  +  L  KGA  ++    + K   N+    + +
Sbjct: 561 VQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQ 620

Query: 874 KTALHLEQ----YATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVA-D 928
           K+   +E+     A + LR + +   +    +  EW  K       LA  E   + +A  
Sbjct: 621 KSKDDIEEQIFSLAKDALRAISLAHMDF---DVNEWPPK------ELADPENSHEALAVK 671

Query: 929 LIE------RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSC 982
           LI+        L L     I+D L++ V +S+A   +AG+ + ++TGD + TA  I  +C
Sbjct: 672 LIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNC 731

Query: 983 NLLNT 987
            +L++
Sbjct: 732 GILSS 736

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 88/188 (46%), Gaps = 24/188 (12%)

Query: 814 QILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLE 873
           +++  + F SSRK    +VK      K +P      KGA  ++    S K   +D+TL E
Sbjct: 608 KVVQTIPFESSRKWAGLVVKYKEGKNK-KPFYRFFIKGAAEIVSKNCSYKRN-SDDTLEE 665

Query: 874 -------KTALHLEQYATEGLRTLCVGQREI----SWSEYQEWNEKY-NIAAASLAGREE 921
                  +T   ++  A++ LR + V  ++     SW   Q  ++   NIAA  L    +
Sbjct: 666 INEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNSQ 725

Query: 922 ELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFS 981
                     + L+L G   I+D L+ GV +S+     AG+ + ++TGD + TA  I  +
Sbjct: 726 ----------KGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARN 775

Query: 982 CNLLNTDM 989
           C +L+TD+
Sbjct: 776 CAILSTDI 783

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 118/303 (38%), Gaps = 81/303 (26%)

Query: 379 NVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNS 438
           +V VGD++ +   D +PAD +++S     G C  +  ++ GESN    Q     N++R  
Sbjct: 209 HVLVGDVISLQTGDVVPADCVMIS-----GKCEADESSITGESN--TIQKFPVDNSLR-- 259

Query: 439 RDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINN-----------MLLR 487
                                   + K  +S+D   H++P+ I +           ML+ 
Sbjct: 260 ------------------------DFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLIS 295

Query: 488 GCTL-----RNTKWAMGIVVFTGDDTKTMINA--GVTPTKKSRISRELNFSV------LI 534
           G  +     R    ++GI    G  T T +NA    TP +        N SV      +I
Sbjct: 296 GSRILSGLGRGVITSVGINSVYG-QTMTSLNAEPESTPLQLHLSQLADNISVYGCVSAII 354

Query: 535 NFVFLFILCLIAGVA-NGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVP 593
            F+ LF   L   +  +G ++   P  +         G+   N F++    +++    VP
Sbjct: 355 LFLVLFTRYLFYIIPEDGRFHDLDPAQK---------GSKFMNIFITSITVIVVA---VP 402

Query: 594 ISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQ 653
             L ++V +        +  D  L   R+   C        + +G    + SDKTGTLT+
Sbjct: 403 EGLPLAVTLALAFATTRMTKDGNLV--RVLRSC--------ETMGSATAVCSDKTGTLTE 452

Query: 654 NVM 656
           NVM
Sbjct: 453 NVM 455

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (57%), Gaps = 8/69 (11%)

Query: 1080 LCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVG--VGIAGEE-GRQA-- 1134
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GI+G E  R+A  
Sbjct: 813  VLARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 871

Query: 1135 --VMCSDYA 1141
              +M  D++
Sbjct: 872  IILMTDDFS 880

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 160/371 (43%), Gaps = 55/371 (14%)

Query: 635 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIE 694
           + +G    I SDKTGTLT+N M      + G +    + +      K       K   + 
Sbjct: 474 ETMGSATAICSDKTGTLTENRM----TVVKGFAGNLGFDDTTHAENKEI-----KSAVVL 524

Query: 695 REGIAQDREIMIDDLRKIS-NNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLAL 753
           R     D  ++ D L  IS N++ F  +E     K+  ++         + R   F  + 
Sbjct: 525 RSNC--DASLLTDILSNISLNSTAFENKESQHKDKDVDEN------PYHKSRKSLFPWSR 576

Query: 754 ALCHSVLVEPDKNDPNKLELTAQSPDETALVTTA-RDMGFSFIGK--TKQGLLVEVQGIQ 810
               S L+     + ++  L +++  ETAL+  A + +G   + K  TK   L    GI 
Sbjct: 577 NNRTSQLIADAMKENDEQFLGSKT--ETALLAFAQKSLGMKDVHKLRTKPSDL----GID 630

Query: 811 KEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYND-- 868
           K   ++ ++ F SSRK  +  V+L      D        KGA  ++    S +   ++  
Sbjct: 631 K---VVQVIPFESSRKWGAIAVQL-----ADNKGYRFYAKGAAEILLKVCSNQRNSDNSI 682

Query: 869 ----ETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKY-------NIAAASLA 917
               + L +++   ++  A+  LRT+ +  R+     ++EW  K        +IA+  L 
Sbjct: 683 VPMNQDLYDESFKKIQDMASHALRTISLVHRD-----FKEWPPKEFADSTDPSIASPDLV 737

Query: 918 GREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAIN 977
               ELDH  +L    + L     ++D L++GV +S+     AG+ + ++TGD + TA  
Sbjct: 738 -MGHELDH-KNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARA 795

Query: 978 IGFSCNLLNTD 988
           I  +CN+L+ +
Sbjct: 796 ISRNCNILSEE 806

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 4/61 (6%)

Query: 1077 KAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVG--VGIAGEE-GRQ 1133
            K  +  R SP  K  +V+ +K   +V+ +  GDG+ND   ++ ADVG  +GI+G E  R+
Sbjct: 834  KLRVLARSSPEDKRILVETLKKMGEVVAVT-GDGTNDAPALKLADVGFSMGISGTEVARE 892

Query: 1134 A 1134
            A
Sbjct: 893  A 893

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 382 VGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLR 430
           VGD++ +   D +PAD +L+S     G C  +   L GES+   + +L+
Sbjct: 259 VGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALK 302

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 135/325 (41%), Gaps = 62/325 (19%)

Query: 812  EFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL 871
            +  I+   +F+S+ KR + I     A+  D   A +  KGA   I  RLS  P   DE  
Sbjct: 573  KLDIIRRFQFSSALKRSASI-----ASHNDALFAAV--KGAPETIRERLSDIPKNYDEIY 625

Query: 872  LEKTALHLEQYATEGLRTLCVGQR---EISWSEYQEWNEKYNIAAASLAGREEELDHVAD 928
                    + +   G R L +  +   ++S S+  + N                     D
Sbjct: 626  --------KSFTRSGSRVLALASKSLPKMSQSKIDDLNR--------------------D 657

Query: 929  LIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTD 988
             +E +L   G       L+D   ++I +L E+  +  ++TGD   TA+++     ++   
Sbjct: 658  DVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFG- 716

Query: 989  MELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFA 1048
             E L++   G+      DD     N L+ + + E  ++     +      DHS     + 
Sbjct: 717  -ETLILDRAGKS-----DD-----NQLLFRDVEETVSIPFDPSK---DTFDHSKLFDRYD 762

Query: 1049 IIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIG 1108
            I + G AL  AL G +  R  L         +  RVSP+QK  ++  +KD +   TL  G
Sbjct: 763  IAVTGYALN-ALEGHSQLRDLLR-----HTWVYARVSPSQKEFLLNTLKD-MGYQTLMCG 815

Query: 1109 DGSNDVAMIQSADVGVGI--AGEEG 1131
            DG+NDV  ++ A VG+ +    EEG
Sbjct: 816  DGTNDVGALKQAHVGIALLNGTEEG 840

>Scas_583.14*
          Length = 875

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 133/315 (42%), Gaps = 54/315 (17%)

Query: 812  EFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETL 871
            + QIL   +F+S+ KR S +     A+ KD  +     KGA   I  RL+  P   DE  
Sbjct: 227  KLQILRRFQFSSALKRSSSV-----ASHKD--KLFTAVKGAPETIRERLAVVPKNYDEIY 279

Query: 872  LEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                    + +   G R L +  + +            N+++  L    ++LD   D IE
Sbjct: 280  --------KSFTRSGSRVLALASKSLP-----------NLSSKQL----DDLDR--DEIE 314

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMEL 991
              L   G       L+    ++I +L E+  +  ++TGD   TA+++     ++  +  +
Sbjct: 315  TGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLI 374

Query: 992  LVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIII 1051
            L      +  +  GD      N  V + +   F+        A+ K DH     ++ I +
Sbjct: 375  L------DKSETVGDGKLLFFN--VEETIKIPFDP-------ASDKFDHRELFDKYDIAV 419

Query: 1052 DGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGS 1111
             G AL   L  D  + K L+      A    RVSP+QK  ++  +K+ +   TL  GDG+
Sbjct: 420  TGYALN--LLEDHSQLKDLIRHTWVYA----RVSPSQKEFILNNLKE-MGYQTLMCGDGT 472

Query: 1112 NDVAMIQSADVGVGI 1126
            NDV  ++ A VGV +
Sbjct: 473  NDVGALKQAHVGVAL 487

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 137/649 (21%), Positives = 244/649 (37%), Gaps = 139/649 (21%)

Query: 382 VGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDI 441
           VGD++ +   D +P D IL     ++G C  +   + GES+   + SL        S  +
Sbjct: 203 VGDLLSLQTGDVVPVDCIL-----VEGKCECDESGITGESDTIKKVSLAM------SLQV 251

Query: 442 CRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHN-EPITINNMLLRGCTLRNTKWAMGI 500
            RT   V ++ P A++              G + N   +  + ML+ G  L  +     +
Sbjct: 252 YRT---VAADNPSADI--------------GSSDNGHSLVPDPMLISGSKLL-SGIGHAV 293

Query: 501 VVFTGDDT---KTMINAGVTP----------TKKSRISRELNFSVLINFVFLFILCLIAG 547
           V   G  +   K M+     P          T    IS   + +  + FV LF L  ++ 
Sbjct: 294 VTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLF-LRFLSY 352

Query: 548 VANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQ 607
           +  G  Y   P +R    F  I           F  AV +    VP  L ++V +     
Sbjct: 353 LPKGRLYHDLPSARKGSRFMDI-----------FITAVTVIVVAVPEGLPLAVTLALAFA 401

Query: 608 AIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVS 667
              +  D  L   R+   C        + +G    + SDKTGTLTQN M   K  +    
Sbjct: 402 TTRMTKDGNLV--RVLRAC--------ETMGSATTVCSDKTGTLTQNKMVVVKGFL---- 447

Query: 668 YGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQD--REIMIDDLRKISNNSQFYPEELTF 725
            G ++ + +          +E     + + + QD  +  + D L  I+ NS        F
Sbjct: 448 -GSSHFDDI----------SEDSNCAQSDALRQDMSQHTLNDILANIALNST------AF 490

Query: 726 VSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVT 785
            +K+ +  ++  N   + +R              L    +N+  K      S  ++A   
Sbjct: 491 ENKQVADPVITENPYHKPRRS-------------LFPWSRNNKPKYPAPKDSSVQSAEFF 537

Query: 786 TARDMGFSFIGKTKQGLLVE-VQGIQKE------FQILNILEFNSSRKRMSCIVKLPPAT 838
                  + +   K  L +E +Q ++ +        I+ ++ F SSRK    +V+L    
Sbjct: 538 IGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQMIPFESSRKWAGLVVRLVDGN 597

Query: 839 EKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTALHLEQY------ATEGLRTLCV 892
            +         KGA   I+         ND+ +      H E +      A++ LRT+ +
Sbjct: 598 YR------FFIKGASETIFKSCHYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISL 651

Query: 893 GQREI----SW--SEYQEWNEKYNIAAASLAGREEELDHVADLIER---------DLVLL 937
             ++     SW  +E ++ ++    +   L G E    +V    +R          L+L 
Sbjct: 652 AHKDFTDISSWPPAELRDASDPSTASPDLLLGDE----YVPTATDRPSIITNNNSGLILD 707

Query: 938 GGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN 986
           G   I D L+ GV +S+    ++G+ + ++TGD + T   I  +C +L+
Sbjct: 708 GVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILS 756

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 1077 KAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVG--VGIAG 1128
            K  +  R SP  K   V ++K   +V+ +  GDG+ND   +  ADVG  +GI+G
Sbjct: 786  KLKVLARSSPEDKRIFVDILKKMNEVVAVT-GDGTNDAPALTLADVGFSMGISG 838

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 137/322 (42%), Gaps = 72/322 (22%)

Query: 814  QILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLE 873
            +IL   +F+SS KR + I     A++ +  R     KGA   I  RL+  P   D+    
Sbjct: 573  RILRRFQFSSSLKRSASI-----ASQSN--RFFAAVKGAPETIRERLNSVPSDYDDIY-- 623

Query: 874  KTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHV-ADLIER 932
                  + +   G R L +         Y++  +  N           ++D++  D IE 
Sbjct: 624  ------KSFTRSGSRVLALA--------YKDLPKMSN----------SQIDNIDRDEIET 659

Query: 933  DLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELL 992
             L           L+D   ++I +L E+  +  ++TGD   TA+++     ++  D E L
Sbjct: 660  GLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV--DRETL 717

Query: 993  VIKTTGEDVKEFGDDPTE-----IVNALVSKYLMEKFNM---TGSEEELAAAKKDHSPPQ 1044
            ++           D+P +     +V   V++ +++ FN    T  E+E+           
Sbjct: 718  IL-----------DEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQ--------- 757

Query: 1045 GEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMT 1104
             ++ + + G ALK+ L G    R  +         +  RVSP+QK  ++  +KD +   T
Sbjct: 758  -KYDLAVTGHALKL-LQGHKQLRDVIR-----HTWIYARVSPSQKEFILITLKD-MGYQT 809

Query: 1105 LAIGDGSNDVAMIQSADVGVGI 1126
            L  GDG+NDV  ++ A VG+ +
Sbjct: 810  LMCGDGTNDVGALKQAHVGIAL 831

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 137/330 (41%), Gaps = 55/330 (16%)

Query: 815  ILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEK 874
            ++   EF S  +RMS IVK    T  D+       KGA  VI S +      N  TL   
Sbjct: 928  VVRSFEFLSELRRMSVIVK----TNNDD-VYWSFTKGAPEVI-SEIC-----NKSTLPAD 976

Query: 875  TALHLEQYATEGLRTL-CVGQR--EISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
                L  Y   G R + C G+   + +W   Q+              REE        +E
Sbjct: 977  FEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQK------------VSREE--------VE 1016

Query: 932  RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLN-TDME 990
             +L  LG    +++L+    +++  L +A I+  + TGD + TAI++G    L+  + + 
Sbjct: 1017 SNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVY 1076

Query: 991  LLVIKTT---GEDVKEFGD--DPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQG 1045
            +  I  T   GE V  + D  +P +I++    K +    N   S  E             
Sbjct: 1077 VPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLREC------------ 1124

Query: 1046 EFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAV-VKLVKDTLDVMT 1104
             + + + G+  ++    +    +  L      + +  R+SP +K  + ++L K  LD   
Sbjct: 1125 NYTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK--LDYTV 1182

Query: 1105 LAIGDGSNDVAMIQSADVGVGIAGEEGRQA 1134
               GDG+ND   +++ADVG+ ++  E   A
Sbjct: 1183 GFCGDGANDCGALKAADVGISLSEAEASVA 1212

>Kwal_14.1498
          Length = 939

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 114/283 (40%), Gaps = 74/283 (26%)

Query: 383 GDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDIC 442
           GD+VR    D IPAD+ ++   D+     +E  NL GE N  V +S    N         
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVDLS----IEESNLTGE-NEPVHKSTATVN--------- 212

Query: 443 RTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVV 502
             +F+ E+ G    +   +  + ++ +L  + H   I I        T +NT +     V
Sbjct: 213 -KEFYKENLGSIVPVS-ERSCIAFMGTLVREGHGRGIVIG-------TAKNTAFGK---V 260

Query: 503 FTGDDTKTMINAGVTP-----TKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKK 557
           F       M+NA   P     T   ++ ++L+F   ++F+ + I+CLI GV  G      
Sbjct: 261 F------EMMNAIEKPKTPLQTAMDKLGKDLSF---MSFIVIGIICLI-GVIQG------ 304

Query: 558 PRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLL 617
              R + E               F ++V L  + +P  L I V +        + L VL 
Sbjct: 305 ---RSWLEM--------------FQISVSLAVAAIPEGLPIIVTVT-------LALGVLR 340

Query: 618 YNERLDYPCTPKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKK 660
             +R       +     + LG +  I SDKTGTLT N M   K
Sbjct: 341 MAKR---RAIIRRLPSVETLGSVNVICSDKTGTLTANHMSVNK 380

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 84/199 (42%), Gaps = 43/199 (21%)

Query: 819  LEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGY--NDETLLEKTA 876
            + FNS RK M+  VK      +   + ++  KGA    Y ++  K  +  N E  + K  
Sbjct: 465  ISFNSKRKFMAVKVK------EANGKFVVHVKGA----YEKILEKSTHFINAENKVVKLD 514

Query: 877  LHLEQ--------YATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVAD 928
             +L Q         A++GLRTL   Q E+S    ++  E  +I   + AG          
Sbjct: 515  SNLRQAITDSADALASDGLRTLAFAQLELSNGNSKKLTED-DINGLTFAG---------- 563

Query: 929  LIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTD 988
                   LLG   + D  +  V  ++  L+E  + + ++TGD   TA++I     +   +
Sbjct: 564  -------LLG---MNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIARQIGIPVVN 613

Query: 989  MELLVIKTTGEDVKEFGDD 1007
             E  V+  TG+ +    +D
Sbjct: 614  PETAVL--TGDKLDHMSED 630

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 643  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 701

Query: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163
            +    + T L  +  GK  +  +
Sbjct: 702  LTDDDFSTILTAIEEGKGIFNNI 724

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 90/215 (41%), Gaps = 48/215 (22%)

Query: 805  EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKP 864
            E+  ++ E+  +  L FNS RK M+  +      + +E +  L  KGA   I   L +  
Sbjct: 464  ELADVRSEYTKVKELSFNSKRKMMATKI------QDNEKKTTLFIKGAFERI---LDKSS 514

Query: 865  GY-NDETLLEK-TALHLEQ-------YATEGLRTLCVGQREISWSEYQEWNEKYNIAAAS 915
             Y  ++  +EK TA H E         A+EGLR L   +R ++                 
Sbjct: 515  SYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT----------------- 557

Query: 916  LAGREEELDHVADLIE---RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 972
                    D  + L+E    DLV  G   + D  +  V  +I    + GI + ++TGD  
Sbjct: 558  --------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSE 609

Query: 973  ETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDD 1007
             TA+NI     +   D +L V+  +G+ + E  DD
Sbjct: 610  NTAVNIARQIGIPVIDPKLSVL--SGDKLNEMTDD 642

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIA 1127
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+GV + 
Sbjct: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 373 ANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESN 422
           +N    N+  GD+VR    D IPAD+ ++  +D+     ++  NL GE++
Sbjct: 170 SNVLATNLVPGDLVRFRIGDRIPADIRIIECNDL----TIDESNLTGETD 215

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 164/424 (38%), Gaps = 83/424 (19%)

Query: 584 AVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEYI 643
           A+ +  S++P SL + + I  +A A  +    ++   +LD           + LG +  I
Sbjct: 317 AICVALSMIPSSLVVVLTITMSAGAKVMATRHVII-RKLDS---------LEALGAVNDI 366

Query: 644 FSDKTGTLTQNVMEFKKC------TINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREG 697
            SDKTGTLTQ  M  K+       TIN  +    +   +  ++        +    + E 
Sbjct: 367 CSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYKHDDEED 426

Query: 698 IAQDREIMIDDLRKISNNSQFYPEELTFVSKE-FSQDLLGNNGEVQQKRCQHFMLALALC 756
           +      MI D +     S++Y +EL  ++   F+Q L              +   LA  
Sbjct: 427 VG-----MITDFK-----SKYYADELGPLNVSLFTQWL--------------YTATLANI 462

Query: 757 HSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFS---FIGKTKQGLLVEVQGIQKEF 813
            +V  +P+  D          P E A+   A  M        G+       + + I  + 
Sbjct: 463 ATVFRDPETQDWK----AHGDPTEIAIQVFATRMDLPRRVLTGEDND----DEKNIHNDI 514

Query: 814 QILNILE--FNSSRKRMSCIVKLPPATEKDEPRALL---ICKGADSVI-------YSRLS 861
              ++ E  F+SS KRMS I K       +EP+A +     KGA   +       Y+   
Sbjct: 515 TFEHVAEYPFDSSVKRMSAIYK-----NVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPD 569

Query: 862 RKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREE 921
             P    E  LE    +++  ++EGLR L   ++  + S++                 ++
Sbjct: 570 GSPQPLTEEDLETVQKNVDTLSSEGLRVLAFAKKTFNESQFTI--------------NKD 615

Query: 922 ELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFS 981
           +L    D +E +L  LG   I D  +     ++     AGI + +LTGD   TA +I   
Sbjct: 616 KLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQE 675

Query: 982 CNLL 985
             +L
Sbjct: 676 VGIL 679

>Kwal_23.3160
          Length = 1100

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 177/839 (21%), Positives = 307/839 (36%), Gaps = 182/839 (21%)

Query: 584  AVILYQSLVPISLYISVEIIKTAQA-IFIYLDVLLYNERLDYPCTPKSWSISDDLGQIEY 642
            A+ +  S++P SL + + I  +  A I    +V++   +LD           + LG +  
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVV--RKLDS---------LEALGAVND 371

Query: 643  IFSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIE 694
            + SDKTGTLTQ  M         F   T++  S     T+    L  R      K    E
Sbjct: 372  VCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTE 431

Query: 695  REGIAQD-REIMIDDLRKISNNSQFYPE--------ELTFVSKEFSQDLLGNNGEVQQKR 745
              GI    +    +D      NS+ +           +  V ++   +    +G+  +  
Sbjct: 432  DVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIA 491

Query: 746  CQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVE 805
             Q F   L +  + L   DK+D       ++S ++ AL            G+       +
Sbjct: 492  IQVFAHKLDMPRNALTAEDKSD-------SESDEDAAL------------GE-------K 525

Query: 806  VQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRA-LLICKGADSVIYSRLSR-- 862
               ++  ++ +    F+SS KRMS +         DE  A  +  KGA   +    ++  
Sbjct: 526  TSSVEPHYKHIAEFPFDSSIKRMSAVY-----VSLDEDNAHRVFTKGAFERVLDCCTKWL 580

Query: 863  KPGYND-------ETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAAS 915
              G N+       E   E+   ++E  ++EGLR L    +  S++E Q            
Sbjct: 581  PDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATK--SFTESQALK--------- 629

Query: 916  LAGREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETA 975
                 E+L    D +E DL+  G   I D  +     ++    +AGI + +LTGD   TA
Sbjct: 630  ---VSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTA 686

Query: 976  INIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAA 1035
              I     +L  ++                  P E+V+++V                + A
Sbjct: 687  KAIAQEVGILPRNLYHY---------------PKEVVDSMV----------------MTA 715

Query: 1036 AKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKL 1095
            A+ D                    LT + +    LL       ++  R +P  K  ++  
Sbjct: 716  AQFDQ-------------------LTDEEIDNLLLL------PLVIARCAPQTKVRMIDA 750

Query: 1096 V--KDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVL 1153
            +  ++    MT   GDG ND   ++ A+VG+ +       A   SD  +    + + L  
Sbjct: 751  LHRREKFCAMT---GDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNA 807

Query: 1154 V-HGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS- 1210
            V  G+     + + + Q   +NV   L L       D D   +F  + +   + +  TS 
Sbjct: 808  VEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSC 867

Query: 1211 LPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVICY-FFPYL 1269
             P + LG+  +  +  +    PQ  ++GI   E      L  +  G + +  C   F  +
Sbjct: 868  FPAMGLGL--EKSAPDIMEKEPQDSKAGIFTWEI----ILDMLIYGTWMAACCLACFITV 921

Query: 1270 IYRKTNIITQNGLGLDHRY-------YVGIPVTGIAVTSCNFYVLMEQYRWDWFTTFFAF 1322
            IY K N   + G+  ++ Y       Y G   T  ++T C   +  E    D   +FF  
Sbjct: 922  IYGKGN--GELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVI--DMRRSFFKM 977

Query: 1323 L--STIVYFGWTG-IWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVF 1378
               +   Y  W   IWS+    + FW   S ++G  S + V ++       P    DVF
Sbjct: 978  QPETDTPYTQWMKDIWSN---QFLFW---SVIFGFVSVFPVVYI-------PVINKDVF 1023

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 83/198 (41%), Gaps = 41/198 (20%)

Query: 819  LEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLS---------RKPGYNDE 869
            L FNS RK M+  V  P  + K     ++  KGA   I  R +          K   + +
Sbjct: 483  LTFNSKRKYMAVKVDSPANSGKH----IIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538

Query: 870  TLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADL 929
            +L+   A  L   A+EGLRTL   Q E S       N+  N                 D 
Sbjct: 539  SLINDCAKSL---ASEGLRTLAFAQLECST------NKPMN-----------------DS 572

Query: 930  IERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDM 989
              ++L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI     +   + 
Sbjct: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINP 632

Query: 990  ELLVIKTTGEDVKEFGDD 1007
            E+ V+  TG+ + +  DD
Sbjct: 633  EISVL--TGDRLDQMTDD 648

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 661  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVAMGHMGTDVAKEASDMV 719

Query: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163
            +    + T L  +  GK  +  +
Sbjct: 720  LTDDDFSTILTAIEEGKGIFNNI 742

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 27/182 (14%)

Query: 813 FQILNILEFNSSRKRMSCIVKLP--PATEKDEPRALLICKGADSVI-------YSRLSRK 863
           F+ +    F+SS KRMS I K    PAT    P   +  KGA   +       Y+    K
Sbjct: 516 FEHVAEFPFDSSVKRMSAIYKNTEDPAT----PIYEVFTKGAFERVLQCCDSWYTTPDGK 571

Query: 864 PGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEEL 923
           P    +  LE    +++  ++EGLR L   ++  + SE+                 +++L
Sbjct: 572 PSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFN--------------ANKDKL 617

Query: 924 DHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCN 983
               D +E  L  LG   I D  +     ++    +AGI + +LTGD   TA +I     
Sbjct: 618 LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVG 677

Query: 984 LL 985
           +L
Sbjct: 678 IL 679

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 97/439 (22%), Positives = 162/439 (36%), Gaps = 132/439 (30%)

Query: 581  FWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLGQI 640
            F +AV L  + +P  L I V +        + L VL   +R       +     + LG +
Sbjct: 311  FQIAVSLAVAAIPEGLPIIVTVT-------LALGVLRMAKR---KAIVRRLPSVETLGSV 360

Query: 641  EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGIAQ 700
              I SDKTGTLT N M   K    G    +    AL+ ++       E+  ++E++    
Sbjct: 361  NVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVK-------ERPIKMEQDVATT 413

Query: 701  DREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHSVL 760
             R      +  I NN  +  E L +         LGN                       
Sbjct: 414  LR------IGNICNNGTYSQEHLKY---------LGN----------------------- 435

Query: 761  VEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKEFQILNILE 820
                             P + A++ + +  G              +   +     +N + 
Sbjct: 436  -----------------PTDIAILESLQHFG--------------INDCRNSVNKINEIP 464

Query: 821  FNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSR----LSR-------KPGYNDE 869
            FNS RK M+  VK   A +K     ++  KGA   I  +    + R       KP  ND+
Sbjct: 465  FNSKRKFMA--VKTIDANDK----VVVYVKGAFEKIVEKSINYIGRDGKVHKLKP--NDK 516

Query: 870  TLLEKTALHLEQYATEGLRTLCVGQREISWSEY-QEWNEKYNIAAASLAGREEELDHVAD 928
             ++   A+ L   A+EGLRTL   + E+S +   +E+NE                    D
Sbjct: 517  AIINDAAVAL---ASEGLRTLAFAELEVSATHGDKEFNE--------------------D 553

Query: 929  LIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTD 988
            ++E  L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I     +   +
Sbjct: 554  MVE-GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVIN 612

Query: 989  MELLVIKTTGEDVKEFGDD 1007
             E  V+  +G+ + +  DD
Sbjct: 613  PEYSVL--SGDKLDQMTDD 629

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141
             R +P  K  +V+ ++   D++ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 642  ARATPEHKLNIVRALQKRGDIVAMT-GDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 700

Query: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163
            +    + T L  +  GK  +  +
Sbjct: 701  LTDDDFSTILTAIEEGKGIFNNI 723

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 110/292 (37%), Gaps = 62/292 (21%)

Query: 931  ERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDME 990
            E DLV LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L T++ 
Sbjct: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY 695

Query: 991  LLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE-EELAAAKKDHSPPQGEFAI 1049
                               EIV+++V         MTGS+ + L+  + D  P       
Sbjct: 696  HY---------------SQEIVDSMV---------MTGSQFDGLSEEEVDDLP------- 724

Query: 1050 IIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGD 1109
                                         ++  R SP  K  +++ +       T+  GD
Sbjct: 725  --------------------------VLPLVIARCSPQTKVRMIEALHRRKKFCTMT-GD 757

Query: 1110 GSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLV-HGKWCYKRLAEMIP 1168
            G ND   ++ A+VG+ +       +   SD  +    + + L  V  G+     + + + 
Sbjct: 758  GVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVL 817

Query: 1169 QFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS-LPVIFLGI 1218
            Q   +NV   L L    V  D +G  +F  + +   + +  TS  P + LG+
Sbjct: 818  QLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 84/210 (40%), Gaps = 36/210 (17%)

Query: 805  EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIY---SRLS 861
            E+  I+   Q +  L FNS RK M+  + L P   K      +  KGA   I    +   
Sbjct: 461  EMPDIRNTVQKVQELPFNSKRKLMATKI-LNPVDNK----CTVYVKGAFERILEYSTSYL 515

Query: 862  RKPGYNDETLLEKTALHLEQ----YATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLA 917
            +  G   E L E     + +     A+EGLR                    +  A  +L+
Sbjct: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRV-------------------FGFAKLTLS 556

Query: 918  GREEELDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAIN 977
                 L    DLI +DL   G   + D  +  V  +I  L + G+ + ++TGD   TA+N
Sbjct: 557  DSSTPLTE--DLI-KDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613

Query: 978  IGFSCNLLNTDMELLVIKTTGEDVKEFGDD 1007
            I     +   D +L V+  +G+ + E  DD
Sbjct: 614  IAKQIGIPVIDPKLSVL--SGDKLDEMSDD 641

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ +D+GV +       A   SD  
Sbjct: 654  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712

Query: 1142 IGQFRYVTRLVLV-HGKWCYKRL 1163
            +    + T L  +  GK  +  +
Sbjct: 713  LTDDDFSTILTAIEEGKGIFNNI 735

>Scas_297.1
          Length = 800

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 8/67 (11%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVG--VGIAGEE-GRQA---- 1134
             R SP  K  +V+ +K   DV+ +  GDG+ND   ++ ADVG  +GI+G E  R+A    
Sbjct: 53   ARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASDII 111

Query: 1135 VMCSDYA 1141
            +M  D+A
Sbjct: 112  LMTDDFA 118

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 16/105 (15%)

Query: 339 YRPSLEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADV 398
           Y+  L+ + ++   EN +I V+        NS+       N+ VGDI+ +   D IPAD 
Sbjct: 582 YQKELQFARLNKKKENRKIIVI-------RNSQELLTSIHNLLVGDIITLQTGDVIPADG 634

Query: 399 ILLSTSDIDGGCYVETKNLDGESN----LKVRQSLRCTNAIRNSR 439
           +L     ++G C V+  ++ GES+    +KV  +L+  + I   +
Sbjct: 635 VL-----VEGQCEVDESSITGESDTIKKVKVFNALKTFDVINEGK 674

>Scas_710.41
          Length = 904

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D 
Sbjct: 351 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGLDA 408

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 111/294 (37%), Gaps = 66/294 (22%)

Query: 931  ERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDME 990
            E DLV LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L T++ 
Sbjct: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY 695

Query: 991  LLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE-EELAAAKKDHSPPQGEFAI 1049
                               EIV+++V         MTGS+ + L+  + D  P       
Sbjct: 696  HY---------------SQEIVDSMV---------MTGSQFDGLSEEEVDDLP------- 724

Query: 1050 IIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KDTLDVMTLAI 1107
                                         ++  R SP  K  +++ +  +     MT   
Sbjct: 725  --------------------------VLPLVIARCSPQTKVRMIEALHRRKKFCAMT--- 755

Query: 1108 GDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLV-HGKWCYKRLAEM 1166
            GDG ND   ++ A+VG+ +       +   SD  +    + + L  V  G+     + + 
Sbjct: 756  GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKF 815

Query: 1167 IPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS-LPVIFLGI 1218
            + Q   +NV   L L    V  D +G  +F  + +   + +  TS  P + LG+
Sbjct: 816  VLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 111/294 (37%), Gaps = 66/294 (22%)

Query: 931  ERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDME 990
            E DLV LG   I D  ++    ++    +AGI + +LTGD V TA  I     +L T++ 
Sbjct: 636  ESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLY 695

Query: 991  LLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE-EELAAAKKDHSPPQGEFAI 1049
                               EIV+++V         MTGS+ + L+  + D  P       
Sbjct: 696  HY---------------SQEIVDSMV---------MTGSQFDGLSEEEVDDLP------- 724

Query: 1050 IIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KDTLDVMTLAI 1107
                                         ++  R SP  K  +++ +  +     MT   
Sbjct: 725  --------------------------VLPLVIARCSPQTKVRMIEALHRRKKFCAMT--- 755

Query: 1108 GDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLV-HGKWCYKRLAEM 1166
            GDG ND   ++ A+VG+ +       +   SD  +    + + L  V  G+     + + 
Sbjct: 756  GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKF 815

Query: 1167 IPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS-LPVIFLGI 1218
            + Q   +NV   L L    V  D +G  +F  + +   + +  TS  P + LG+
Sbjct: 816  VLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGL 869

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D 
Sbjct: 348 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLDA 405

>Scas_688.1
          Length = 913

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D 
Sbjct: 359 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLDA 416

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D 
Sbjct: 393 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLDA 450

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D 
Sbjct: 364 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLDA 421

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D 
Sbjct: 345 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLDA 402

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 68/174 (39%), Gaps = 28/174 (16%)

Query: 821 FNSSRKRMSCI-VKLPPATEKDEPRALLICKGADSVIYSRLSR---KPGYN-----DETL 871
           F+SS KRMS + + L     +D+    +  KGA   +    +R    PG        E  
Sbjct: 531 FDSSIKRMSAVYINL-----RDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDD 585

Query: 872 LEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIE 931
           LE    +++  + EGLR L    + I   E +   E+              L    D +E
Sbjct: 586 LEIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLGER--------------LTKDRDFVE 631

Query: 932 RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLL 985
            DL+  G   I D  +     ++     AGI + +LTGD   TA  I     +L
Sbjct: 632 SDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGIL 685

>Scas_707.48*
          Length = 741

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 83/205 (40%), Gaps = 36/205 (17%)

Query: 809  IQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSR---KPG 865
            I+  F+ +  + FNS RK M+  VK+       E +  L  KGA   + S+ S    + G
Sbjct: 460  IRPTFKKVQEIPFNSKRKFMA--VKIV----NSEGKYSLCVKGAFEKVLSQCSHYLNQKG 513

Query: 866  YNDETLLEKTALHLE---QYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEE 922
              ++    +  + +E     A+EGLR L   +  +  S      E               
Sbjct: 514  KTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLPDSPTLLTEESVG------------ 561

Query: 923  LDHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSC 982
                      DL+  G   + D  +  V  +I  L + G+ + ++TGD   TA+NI    
Sbjct: 562  ----------DLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNIARQI 611

Query: 983  NLLNTDMELLVIKTTGEDVKEFGDD 1007
             +   D +L V+  +G+ + E  DD
Sbjct: 612  GIPVLDPKLSVL--SGDKLNEMSDD 634

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIA 1127
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+GV + 
Sbjct: 647  ARATPEHKLNIVRALRKRGDVVAMT-GDGVNDAPALKLADIGVSMG 691

>Kwal_47.17522
          Length = 899

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D 
Sbjct: 345 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLDA 402

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 632 SISDDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGIDT 687
           S  + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D 
Sbjct: 345 SAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLDA 402

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 58/129 (44%), Gaps = 16/129 (12%)

Query: 618 YNERLDYPCTPKSWSISD-DLGQIEYIFSDKTGTLTQNVMEF--KKCTINGVSYGRAYTE 674
           +N +L+  C   S S +D +    ++I   K   L +   +    KC I   +Y  AYT+
Sbjct: 333 HNAKLESECDSSSHSDADLEKHDTDFISPSKFRELVKTPQDLYDNKCLIKPHNYKLAYTK 392

Query: 675 ALAGLRKR--QGIDTEKEGRIEREGIAQ------DREIMIDDLRKISNNSQFYPEELTFV 726
            L  LRK+  +G + +K   ++ E   Q      D E++I  + +     ++ P  ++  
Sbjct: 393 LLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSILE-----RYAPIFISLT 447

Query: 727 SKEFSQDLL 735
           S    +DLL
Sbjct: 448 SNMIEEDLL 456

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 1077 KAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGV--GIAGEEGRQA 1134
            K  +  R +P  K  +VK ++   D++ +  GDG ND   ++ AD+G+  GI+G +  + 
Sbjct: 645  KVNIFARATPENKLNIVKALRKRGDIVAMT-GDGVNDAPALKLADIGIAMGISGTDVAKE 703

Query: 1135 V 1135
            V
Sbjct: 704  V 704

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 75/195 (38%), Gaps = 37/195 (18%)

Query: 819  LEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLS---RKPGYNDETLLEKT 875
            L FNS RK M+        + K+    +L  KGA   I  + S    K G   E      
Sbjct: 474  LSFNSKRKYMAI------KSSKESGEHVLYIKGAFERILDKSSYYLDKAGEVREFDEHSK 527

Query: 876  ALHLE---QYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIER 932
             + LE     A++GLRT+           ++  +    I+   + G              
Sbjct: 528  VMVLEAAHSCASDGLRTIACA--------FKPTDSDNVISEDDING-------------- 565

Query: 933  DLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELL 992
             L   G   + D  +  V  SI  L   G+ + ++TGD V TA++I     L   D E  
Sbjct: 566  -LTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESS 624

Query: 993  VIKTTGEDVKEFGDD 1007
            V+  TG+ V E  +D
Sbjct: 625  VM--TGDKVSELTED 637

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 1084 VSPAQKAAVVKLVKDT--LDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1141
            V P  KA  ++ +++T    V    +GDG ND   I +ADVG+ +A       + C    
Sbjct: 1065 VLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGSDLAMISCDFVL 1124

Query: 1142 IGQFRYVTRLVLV 1154
            + +   +T +V++
Sbjct: 1125 LSKKNPLTGIVVL 1137

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 85/411 (20%), Positives = 152/411 (36%), Gaps = 91/411 (22%)

Query: 821  FNSSRKRMSCIVKLPPATEKDEPRALLICKGA-DSVI------YSRLSRKPGYNDETLLE 873
            F+S+ KRMS + +      +D     +  KGA +SV+      Y R         +  ++
Sbjct: 532  FDSTIKRMSSVYE-----SRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVD 586

Query: 874  KTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERD 933
                +++  ++EGLR L    +    S+  E  EK            +++    D  E  
Sbjct: 587  TIKENIDSMSSEGLRVLAFANKSYPKSDVNE--EKL-----------QKILKERDYAETG 633

Query: 934  LVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLV 993
            L  LG   I D  ++    ++    +AGI + +LTGD   TA  I               
Sbjct: 634  LTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIA-------------- 679

Query: 994  IKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSE-EELAAAKKDHSPPQGEFAIIID 1052
                    +E G  PT + +   SK +++   MTG + + L+  + D+ P          
Sbjct: 680  --------QEVGILPTNLYH--YSKEVVDIMVMTGKQFDNLSEDEIDNLP---------- 719

Query: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KDTLDVMTLAIGDG 1110
                                      ++  R SP  K  +++ +  ++    MT   GDG
Sbjct: 720  -----------------------VLPLVIARCSPQTKVRMIEALHRREKFCAMT---GDG 753

Query: 1111 SNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLV-HGKWCYKRLAEMIPQ 1169
             ND   ++ A+VG+ +       A   SD  +    + + L  V  G+     + + + Q
Sbjct: 754  VNDSPSLKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 813

Query: 1170 FFYKNVIFTLALFWYGVHNDFDGSYLFEYTYL-TFYNLAFTS-LPVIFLGI 1218
               +NV   L L       D +G  +F    +   + +  TS  P + LG+
Sbjct: 814  LLAENVAQALYLIVGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGL 864

>YOR243C (PUS7) [5032] chr15 complement(790211..792241) Member of
           the uncharacterized protein family UPF0024, has moderate
           similarity to uncharacterized C. albicans Ca38f10.12cp
           [2031 bp, 676 aa]
          Length = 676

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 14  ENPLSPFDDSFQFEDKDKTNSFLKGDAVTVEDVEETKYDDSSSILPTP 61
           ++PL    D   F++  +   F++  AVT ED++  KY     +LP+P
Sbjct: 486 KSPLISGIDDEDFDEDVREAQFIRAKAVTQEDIDSVKYTMEDVVLPSP 533

>Scas_715.47d
          Length = 533

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 50/126 (39%), Gaps = 24/126 (19%)

Query: 472 GQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKSRISRELNFS 531
           G+  + P T  N+L  GC +    +A G  V+  D T  M      P   ++   ++ FS
Sbjct: 255 GEWTSGPTTAGNVLSFGCAIFG--FATGWTVYAADYTVYM------PRDTNKF--KIFFS 304

Query: 532 VLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSL 591
           ++    F    CLI G A+       P   D+++   + G              + Y  L
Sbjct: 305 LVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGG--------------VTYAIL 350

Query: 592 VPISLY 597
           VP SL+
Sbjct: 351 VPDSLH 356

>Scas_569.0d
          Length = 468

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 61/145 (42%), Gaps = 8/145 (5%)

Query: 1079 VLCCRVSPAQKAAVVKLV--KDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM 1136
            ++  R SP  K  +++ +  +D    MT   GDG ND   ++ A+VG+ +       A  
Sbjct: 103  LVIARCSPQTKVRMIEALHRRDKFCAMT---GDGVNDSPSLKMANVGIAMGINGSDVAKD 159

Query: 1137 CSDYAIGQFRYVTRL-VLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYL 1195
             SD  +    + + L  +  G+     + + + Q   +NV   L L       D +G  +
Sbjct: 160  ASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENVAQALYLICGLAFQDKEGKSV 219

Query: 1196 FEYTYL-TFYNLAFTS-LPVIFLGI 1218
            F    +   + +  TS  P + LG+
Sbjct: 220  FPLAPVEVLWIIVVTSCFPAMGLGL 244

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,693,250
Number of extensions: 2370052
Number of successful extensions: 7583
Number of sequences better than 10.0: 96
Number of HSP's gapped: 7574
Number of HSP's successfully gapped: 166
Length of query: 1554
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1439
Effective length of database: 12,615,039
Effective search space: 18153041121
Effective search space used: 18153041121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)