Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.15*1531538071e-112
YDR092W (UBC13)1531507261e-100
CAGL0G08063g1491497195e-99
KLLA0C17622g1591537066e-97
Sklu_1838.21631446753e-92
Kwal_56.234821491396673e-91
AGR121C1541496468e-88
YDR059C (UBC5)1481433775e-47
KLLA0E12595g1481483732e-46
CAGL0E04752g1471433706e-46
YBR082C (UBC4)1481433707e-46
AER173C1471433698e-46
Scas_635.14*1481433645e-45
Kwal_27.124012361343533e-42
YDR177W (UBC1)2151533314e-39
ADR169C2111483252e-38
Sklu_1817.22151483228e-38
Kwal_23.64852151483192e-37
CAGL0E00671g2131483157e-37
Scas_682.102141483097e-36
KLLA0C18656g2281453038e-35
CAGL0I00352g1671152805e-32
YGL058W (RAD6)1721152762e-31
KLLA0C05632g1641152752e-31
AAR156C1701152753e-31
Scas_563.81711152743e-31
YOR339C (UBC11)1561292631e-29
AEL045W2111502644e-29
Kwal_14.18281521032578e-29
Sklu_2410.41611422571e-28
Sklu_2299.51541032552e-28
CAGL0M03399g2141242541e-27
Kwal_26.70091611282492e-27
YEL012W (UBC8)2181522523e-27
KLLA0A11198g2021242494e-27
ABR059W1651552456e-27
Kwal_34.161742131232418e-26
CAGL0M07568g1651432371e-25
Scas_694.332311432411e-25
YMR022W (QRI8)1651252326e-25
Scas_709.491651512283e-24
Kwal_26.82241651412274e-24
Scas_621.41931112223e-23
AER056C1571512204e-23
Sklu_2411.72331412228e-23
KLLA0E04983g1571282161e-22
KLLA0E07711g1651252152e-22
CAGL0D00814g1571422143e-22
Kwal_23.42271221212088e-22
KLLA0C17248g1841272075e-21
YLR306W (UBC12)188952006e-20
YDL064W (UBC9)1571421978e-20
CAGL0D06468g187811962e-19
ADL035C200911842e-17
Sklu_1826.31611021804e-17
YDR054C (CDC34)2951361856e-17
Kwal_55.212461601011779e-17
CAGL0E04598g2951361812e-16
Scas_718.342581561802e-16
Kwal_27.104442781001802e-16
KLLA0E20493g2511201792e-16
Scas_635.182731361793e-16
Scas_712.591711091753e-16
KLLA0D09196g2921001803e-16
Sklu_2136.52721361767e-16
AGL203C2701361769e-16
YER100W (UBC6)2501141696e-15
Kwal_27.108372461471661e-14
CAGL0I10450g1621161622e-14
AGR372W2421141634e-14
Scas_599.162241141609e-14
AFR314W1551081551e-13
Sklu_2425.62511141601e-13
YGR133W (PEX4)1831361534e-13
CAGL0I05478g2461141549e-13
Scas_609.72401141477e-12
KLLA0E03916g1581051377e-11
Kwal_27.11182101871207e-09
Scas_551.9153871174e-08
KLLA0E19217g139851079e-07
CAGL0H03157g139941061e-06
Scas_720.10*134841052e-06
YGL087C (MMS2)137931033e-06
AFL064W13887991e-05
Kwal_27.12327157475700.27
YMR202W (ERG2)22255650.80
Kwal_23.4090205036632.1
AFR590W27918587.7
CAGL0I04290g42284579.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.15*
         (153 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.15*                                                          315   e-112
YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599) Ubiqu...   284   e-100
CAGL0G08063g 761662..762111 highly similar to sp|P52490 Saccharo...   281   5e-99
KLLA0C17622g join(1555873..1555902,1556004..1556453) highly simi...   276   6e-97
Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement        264   3e-92
Kwal_56.23482                                                         261   3e-91
AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH] (977487..9...   253   8e-88
YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..5697...   149   5e-47
KLLA0E12595g join(1117022..1117068,1117342..1117741) highly simi...   148   2e-46
CAGL0E04752g complement(455965..456408) highly similar to sp|P15...   147   6e-46
YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..4071...   147   7e-46
AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C (...   146   8e-46
Scas_635.14*                                                          144   5e-45
Kwal_27.12401                                                         140   3e-42
YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugatin...   132   4e-39
ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH] (1000736.....   129   2e-38
Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement         128   8e-38
Kwal_23.6485                                                          127   2e-37
CAGL0E00671g complement(61460..62101) highly similar to sp|P2173...   125   7e-37
Scas_682.10                                                           123   7e-36
KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces...   121   8e-35
CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomy...   112   5e-32
YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugatin...   110   2e-31
KLLA0C05632g complement(503484..503978) highly similar to sp|P06...   110   2e-31
AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH] (626372..626...   110   3e-31
Scas_563.8                                                            110   3e-31
YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein ...   105   1e-29
AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH] complement(...   106   4e-29
Kwal_14.1828                                                          103   8e-29
Sklu_2410.4 YOR339C, Contig c2410 15549-16034                         103   1e-28
Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement      102   2e-28
CAGL0M03399g complement(389650..390294) highly similar to sp|P28...   102   1e-27
Kwal_26.7009                                                          100   2e-27
YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551) Ubiqu...   101   3e-27
KLLA0A11198g join(complement(974525..974529),complement(973755.....   100   4e-27
ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH] complement(5...    99   6e-27
Kwal_34.16174                                                          97   8e-26
CAGL0M07568g complement(758110..758607) highly similar to sp|Q02...    96   1e-25
Scas_694.33                                                            97   1e-25
YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugati...    94   6e-25
Scas_709.49                                                            92   3e-24
Kwal_26.8224                                                           92   4e-24
Scas_621.4                                                             90   3e-23
AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH] (741224..74...    89   4e-23
Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement       90   8e-23
KLLA0E04983g 443446..443919 highly similar to sp|P50623 Saccharo...    88   1e-22
KLLA0E07711g complement(693694..694191) highly similar to sp|Q02...    87   2e-22
CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomy...    87   3e-22
Kwal_23.4227                                                           85   8e-22
KLLA0C17248g complement(1509885..1510439) similar to sp|P52491 S...    84   5e-21
YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853) Rub...    82   6e-20
YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070) Smt3p-...    80   8e-20
CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces c...    80   2e-19
ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH] (634059..6...    75   2e-17
Sklu_1826.3 YGR133W, Contig c1826 3548-4033                            74   4e-17
YDR054C (CDC34) [905] chr4 complement(561436..562323) Ubiquitin-...    76   6e-17
Kwal_55.21246                                                          73   9e-17
CAGL0E04598g complement(444288..445175) highly similar to sp|P14...    74   2e-16
Scas_718.34                                                            74   2e-16
Kwal_27.10444                                                          74   2e-16
KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces...    74   2e-16
Scas_635.18                                                            74   3e-16
Scas_712.59                                                            72   3e-16
KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces c...    74   3e-16
Sklu_2136.5 YDR054C, Contig c2136 7737-8555                            72   7e-16
AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH] (317749..3...    72   9e-16
YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugatin...    70   6e-15
Kwal_27.10837                                                          69   1e-14
CAGL0I10450g complement(1024541..1025029) similar to sp|P29340 S...    67   2e-14
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    67   4e-14
Scas_599.16                                                            66   9e-14
AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH] complement(...    64   1e-13
Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement         66   1e-13
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    64   4e-13
CAGL0I05478g complement(518933..519673) highly similar to sp|P33...    64   9e-13
Scas_609.7                                                             61   7e-12
KLLA0E03916g complement(365119..365595) similar to sp|P29340 Sac...    57   7e-11
Kwal_27.11182                                                          51   7e-09
Scas_551.9                                                             50   4e-08
KLLA0E19217g join(complement(1703226..1703236), highly similar t...    46   9e-07
CAGL0H03157g join(complement(297881..297891),complement(297272.....    45   1e-06
Scas_720.10*                                                           45   2e-06
YGL087C (MMS2) [1895] chr7 complement(346407..346809,346895..346...    44   3e-06
AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH] complement(...    43   1e-05
Kwal_27.12327                                                          32   0.27 
YMR202W (ERG2) [4158] chr13 (667536..668204) Sterol C8-C7 isomer...    30   0.80 
Kwal_23.4090                                                           29   2.1  
AFR590W [3782] [Homologous to ScYDL049C (KNH1) - SH] complement(...    27   7.7  
CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces c...    27   9.8  

>Scas_636.15*
          Length = 153

 Score =  315 bits (807), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD
Sbjct: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKKVEN 153
           LANDVAEEWIQNEAGAKATAREWTQKYAKKVEN
Sbjct: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKKVEN 153

>YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599)
           Ubiquitin-conjugating (E2) enzyme involved in
           Rad6-dependent post-replicative repair pathway, required
           for non-proteolytic multi-ubiquitination of Pol30p
           (PCNA) [462 bp, 153 aa]
          Length = 153

 Score =  284 bits (726), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           MASLPKRIIKETE+L+SDPVPGITAEPH+DNLRYF VT+EGP  SPYE+GIF+LELYLPD
Sbjct: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKK 150
           LANDVAE+WI+NE GAKA AREWT+ YAKK
Sbjct: 121 LANDVAEDWIKNEQGAKAKAREWTKLYAKK 150

>CAGL0G08063g 761662..762111 highly similar to sp|P52490
           Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 149

 Score =  281 bits (719), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 132/149 (88%), Positives = 144/149 (96%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           MASLPKRIIKETERL+SDPVPGITAEPHEDNLRYF+VT+EGP+ SPYE GIF+LELYLP+
Sbjct: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYAK 149
           LANDVAE+WI++EA AK TA+EWT +YAK
Sbjct: 121 LANDVAEDWIKDEAKAKQTAKEWTAQYAK 149

>KLLA0C17622g join(1555873..1555902,1556004..1556453) highly similar
           to sp|P52490 Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 159

 Score =  276 bits (706), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 131/153 (85%), Positives = 142/153 (92%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           MA+LPKRIIKETERL+SDPVPGITAEPHEDNLRYF VT+EGP  SPYENG+FQLEL+LPD
Sbjct: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLSVQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKKVEN 153
           LANDVAEEWI++E  A A A+EWT+ YAK  ++
Sbjct: 121 LANDVAEEWIKHEDTAIAKAKEWTKLYAKPTQD 153

>Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement
          Length = 163

 Score =  264 bits (675), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 137/144 (95%)

Query: 9   IKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPK 68
           ++ETERL+SDPVPGI+AEPH+DNLRYF VT+EGP  SPYENG+F+LEL+LP+DYPMEAPK
Sbjct: 19  LQETERLVSDPVPGISAEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPK 78

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEE 128
           VRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLASPNPNDPLANDVAE+
Sbjct: 79  VRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAED 138

Query: 129 WIQNEAGAKATAREWTQKYAKKVE 152
           WI+NE GA ATA+EWT+KYAKK +
Sbjct: 139 WIKNEEGAIATAKEWTEKYAKKSQ 162

>Kwal_56.23482
          Length = 149

 Score =  261 bits (667), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (94%)

Query: 10  KETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKV 69
           +ETERL+SDPVPGITAEPHE+NLRYF VT+EGP  SPYENG+F+LEL+LPDDYPMEAPKV
Sbjct: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE+W
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129

Query: 130 IQNEAGAKATAREWTQKYA 148
           I+NE GA A AREWTQ YA
Sbjct: 130 IKNEDGAIAKAREWTQLYA 148

>AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH]
           (977487..977921,977971..978000) [465 bp, 154 aa]
          Length = 154

 Score =  253 bits (646), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 123/149 (82%), Positives = 138/149 (92%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           M  LPKRIIKETERL+SDPVPGI+AEPHEDNLRYF+V++EGP  SPYE+G+F+LEL+LPD
Sbjct: 1   MVPLPKRIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           +YPME PKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLA+PNPNDP
Sbjct: 61  EYPMEPPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPNDP 120

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYAK 149
           LANDVA++WI +EA A A AREWT  YAK
Sbjct: 121 LANDVAKDWIADEAAATAKAREWTALYAK 149

>YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..569766)
           Ubiquitin-conjugating enzyme that with Ubc4p is
           responsible for most of ubiquitin-dependent protein
           degradation of short-lived and abnormal proteins [447
           bp, 148 aa]
          Length = 148

 Score =  149 bits (377), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 96/143 (67%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++  ++ GP+ SPY  G+F L ++ P DYP +
Sbjct: 5   KRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PKV F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 65  PPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEEWIQNEAGAKATAREWTQKYA 148
           A+ +  ++A  +ATA+EWT+KYA
Sbjct: 125 AQIYKTDKAKYEATAKEWTKKYA 147

>KLLA0E12595g join(1117022..1117068,1117342..1117741) highly similar
           to sp|P15731 Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 148

 Score =  148 bits (373), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (65%), Gaps = 1/148 (0%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           M+SL KRI KE   L  DP    +A P  D++ ++  ++ GP  SPY  G+F L ++ P 
Sbjct: 1   MSSL-KRITKELNDLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           DYP + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLS+ +LL   NP+DP
Sbjct: 60  DYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDP 119

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYA 148
           L  ++A  +  + A  +ATAREWT+KYA
Sbjct: 120 LVPEIAHLYKTDRAKYEATAREWTKKYA 147

>CAGL0E04752g complement(455965..456408) highly similar to sp|P15731
           Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 147

 Score =  147 bits (370), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 93/143 (65%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++  ++ GP  SPY  G+F L ++ P DYP +
Sbjct: 4   KRIAKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEEWIQNEAGAKATAREWTQKYA 148
           A  +  + A  +ATAREWT+KYA
Sbjct: 124 AHIYKTDRAKYEATAREWTKKYA 146

>YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..407126)
           Ubiquitin-conjugating (E2) enzyme, together with Ubc5p
           is responsible for the majority of ubiquitin-dependent
           protein degradation of short-lived and abnormal proteins
           [447 bp, 148 aa]
          Length = 148

 Score =  147 bits (370), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 93/143 (65%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++  ++ GPA SPY  G+F L ++ P DYP +
Sbjct: 5   KRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEEWIQNEAGAKATAREWTQKYA 148
           A  +  +    +ATAREWT+KYA
Sbjct: 125 AHIYKTDRPKYEATAREWTKKYA 147

>AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C
           (UBC5) - SH] (960420..960863) [444 bp, 147 aa]
          Length = 147

 Score =  146 bits (369), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 70/143 (48%), Positives = 93/143 (65%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KRI KE   L  DP    +A P  D+L ++  ++ GP  SPY  G+F L ++ P DYP +
Sbjct: 4   KRITKELNDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLS+ +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEEWIQNEAGAKATAREWTQKYA 148
           A  +  + A  +ATA+EWT+KYA
Sbjct: 124 AHIYKTDRAKYEATAKEWTKKYA 146

>Scas_635.14*
          Length = 148

 Score =  144 bits (364), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 92/143 (64%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KRI KE   +  DP    +A P  D+L ++  ++ GP  SPY  G+F L ++ P DYP +
Sbjct: 5   KRITKELSDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLS+ +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEEWIQNEAGAKATAREWTQKYA 148
           A  +  +    +ATAREWT+KYA
Sbjct: 125 AHIYKTDRPKYEATAREWTKKYA 147

>Kwal_27.12401
          Length = 236

 Score =  140 bits (353), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 88/134 (65%)

Query: 15  LISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTK 74
            + DP    +A P  D+L ++  ++ GP  SPY  G+F L ++ P DYP + PK+ F TK
Sbjct: 102 CLRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTK 161

Query: 75  IYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEA 134
           IYHPNI+  G ICLD+LK  WSPAL I  VLLS+ +LL   NP+DPL  ++A  +  + A
Sbjct: 162 IYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRA 221

Query: 135 GAKATAREWTQKYA 148
             +ATA+EWT+KYA
Sbjct: 222 KYEATAKEWTKKYA 235

>YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugating
           enzyme (E2) that plays a role early in spore
           germination, in degradation of mis-folded proteins in
           the ER, and degradation of Gal2p at the plasma membrane
           [648 bp, 215 aa]
          Length = 215

 Score =  132 bits (331), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 2/153 (1%)

Query: 3   SLPKRIIKETERLISDPVPGITAE-PHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S  KRI+KE + +  DP   IT E   E ++ +   T  GP G+PYE G F +++ +P +
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYAKKVEN 153
              +VA+ ++++      TA  WT+ YA +  N
Sbjct: 122 QDAEVAQHYLRDRESFNKTAALWTRLYASETSN 154

>ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH]
           (1000736..1001371) [636 bp, 211 aa]
          Length = 211

 Score =  129 bits (325), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 95/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETERLISDPVPGIT-AEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S  KR++KE + +  DP   I+ A   E ++ +   T  GP G+PY  G F +++ +P +
Sbjct: 2   SRAKRLMKEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLE 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK +WSP L ++T L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDP 121

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYA 148
              +VA+ ++ + A    TA  WT+ YA
Sbjct: 122 QDAEVAKHYLSDRASFDRTAALWTKTYA 149

>Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement
          Length = 215

 Score =  128 bits (322), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 96/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETERLISDPVPGIT-AEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S  KRIIKE +    DP   IT +   E ++ +   +  GP G+PYE G F +++ +P +
Sbjct: 2   SRAKRIIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLE 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYA 148
              +VA+ +I++++    TA  WT+ YA
Sbjct: 122 QDAEVAQHFIRDKSSFDKTAALWTKLYA 149

>Kwal_23.6485
          Length = 215

 Score =  127 bits (319), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 60/148 (40%), Positives = 98/148 (66%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETERLISDPVPGITAE-PHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S  KR++KE + +  DP   +  +  +E+++     +  GP G+PYENG + +++ +P +
Sbjct: 2   SRAKRVMKELQAIKDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           YP + PK++F TK+YHPN+  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMKFQTKVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYA 148
              +VA+ +I+++A    TA  WT+ YA
Sbjct: 122 QDAEVAQHYIRDKASFDKTAAFWTKTYA 149

>CAGL0E00671g complement(61460..62101) highly similar to sp|P21734
           Saccharomyces cerevisiae YDR177w E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 213

 Score =  125 bits (315), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 95/148 (64%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETERLISDPVPGITAE-PHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S  KRI+KE + +  DP   I+ E   E ++ +   +  GP G+PYE G F +++ +P +
Sbjct: 2   SRAKRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           YP + PK++F +K+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMKFDSKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYA 148
              +VA+ ++++      TA  WT+ YA
Sbjct: 122 QDAEVAQHYLRDRQSFDKTAALWTKLYA 149

>Scas_682.10
          Length = 214

 Score =  123 bits (309), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 94/148 (63%), Gaps = 2/148 (1%)

Query: 3   SLPKRIIKETERLISDPVPGITAE-PHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S  KRI+KE + +  DP   I  E  +E ++ +   +  GP G+PYE G F +++ +P +
Sbjct: 2   SRAKRIMKELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           YP + P ++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPMMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEEWIQNEAGAKATAREWTQKYA 148
              +VA+ ++++      TA  WT+ YA
Sbjct: 122 QDAEVAQHYLKDRESFNKTAALWTKLYA 149

>KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces
           cerevisiae YDR177w UBC1 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 228

 Score =  121 bits (303), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 94/145 (64%), Gaps = 2/145 (1%)

Query: 6   KRIIKETERLISDPVPGITAE-PHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KRI+KE + +  DP   I  +  +E ++ +   +  GP+G+PYE G F +++ +P +YP 
Sbjct: 5   KRILKEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPY 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLAN 123
           + P+++F TK+YHPN+  + G ICLD+LK  W+P + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPQMKFDTKVYHPNVSSVTGAICLDILKNAWTPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEEWIQNEAGAKATAREWTQKYA 148
            VA+ ++ ++     TA  WT+ YA
Sbjct: 125 QVAKHYLTDKKSFDETAALWTRTYA 149

>CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomyces
           cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating, start
           by similarity
          Length = 167

 Score =  112 bits (280), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 77/115 (66%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   +DYP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121

>YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugating
           (E2) enzyme involved in error-prone and error-free
           DNA-damage recovery pathways, in the N-end rule protein
           degradation pathway, mediates methylation of histone H3
           lysines 4 and 79 by ubiquitination of histone H2B [519
           bp, 172 aa]
          Length = 172

 Score =  110 bits (276), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 77/115 (66%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121

>KLLA0C05632g complement(503484..503978) highly similar to sp|P06104
           Saccharomyces cerevisiae YGL058w RAD6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 164

 Score =  110 bits (275), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 77/115 (66%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121

>AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH]
           (626372..626884) [513 bp, 170 aa]
          Length = 170

 Score =  110 bits (275), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 77/115 (66%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121

>Scas_563.8
          Length = 171

 Score =  110 bits (274), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 77/115 (66%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           +R++++ +R+  D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   ++YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121

>YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein
           with similarity to ubiquitin-conjugating enzymes [471
           bp, 156 aa]
          Length = 156

 Score =  105 bits (263), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 75/129 (58%), Gaps = 1/129 (0%)

Query: 2   ASLPKRIIKETERLISDPVPGITAEPHEDN-LRYFNVTVEGPAGSPYENGIFQLELYLPD 60
             + KR+  E  +L+S     I+A P +DN L Y+   + GP  +PY    F++ L  P 
Sbjct: 7   GCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQ 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           +YP   P ++FL+ ++HPN+D+ G ICLD+LK  WS    + T+LLS+Q+LL  PN   P
Sbjct: 67  NYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSP 126

Query: 121 LANDVAEEW 129
           L    AE W
Sbjct: 127 LNAVAAELW 135

>AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH]
           complement(549376..549380,549444..550074) [636 bp, 211
           aa]
          Length = 211

 Score =  106 bits (264), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 89/150 (59%), Gaps = 5/150 (3%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           M+S  +RI  +  +L+   +     E  +DN++ F+V   GP G+PYE G+++L + LPD
Sbjct: 1   MSSSKRRIETDVMKLL---MSDHDVELVDDNMQEFHVKFHGPKGTPYERGVWRLHVELPD 57

Query: 61  DYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSVQALLASPNPN 118
           +YP ++P + F+ KI+HPNID   G ICLDV+ + WSP   +  ++   +  LL  PN +
Sbjct: 58  NYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGS 117

Query: 119 DPLANDVAEEWIQNEAGAKATAREWTQKYA 148
           DPL N+ A   ++N    +   +E+  KYA
Sbjct: 118 DPLNNEAATLQLKNPQMYEEKIQEYIDKYA 147

>Kwal_14.1828
          Length = 152

 Score =  103 bits (257), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 68/103 (66%)

Query: 18  DPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   ++YP + P V+FL++I+H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           PN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 106

>Sklu_2410.4 YOR339C, Contig c2410 15549-16034
          Length = 161

 Score =  103 bits (257), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 88/142 (61%), Gaps = 3/142 (2%)

Query: 3   SLPKRIIKETERLISDPVPGITAEP-HEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S+ KR+  E  +L+  P PG++A P +ED+L  ++  + GP G+PYE   F++ L  P  
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQS 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPL 121
           YP  AP+V F++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPRVTFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEEWIQN--EAGAKATAR 141
               AE W +N  E   K  AR
Sbjct: 134 NAVAAELWDKNMEEYKRKLMAR 155

>Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement
          Length = 154

 Score =  102 bits (255), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 68/103 (66%)

Query: 18  DPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  +N  + GPA +PYE+G F+L L   ++YP + P V+FL++++H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120
           PN+   G ICLD+L+  W+P   + ++L S+Q+L   PNP  P
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 106

>CAGL0M03399g complement(389650..390294) highly similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, hypothetical start
          Length = 214

 Score =  102 bits (254), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 78/124 (62%), Gaps = 2/124 (1%)

Query: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRIC 87
           ED+++ F+V   GP  +PYE G+++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIQNEAGAKATAREWTQK 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   ++++   +   RE+  K
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDK 146

Query: 147 YAKK 150
           YA K
Sbjct: 147 YATK 150

>Kwal_26.7009
          Length = 161

 Score =  100 bits (249), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 80/128 (62%), Gaps = 1/128 (0%)

Query: 3   SLPKRIIKETERLISDPVPGITAEPH-EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD 61
           S+ KR+  E  +L+  P PG++A P  ED+L  +   + GP G+PYE   F++ L     
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQT 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPL 121
           YP  APKVRF++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPKVRFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEEW 129
               AE W
Sbjct: 134 NAVAAELW 141

>YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551)
           Ubiquitin-conjugating enzyme involved in the catabolite
           degradation of fructose-1,6-bisphosphate [657 bp, 218
           aa]
          Length = 218

 Score =  101 bits (252), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 89/152 (58%), Gaps = 5/152 (3%)

Query: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           M+S  +RI  +  +L+   +     +   D+++ F+V   GP  +PYENG+++L + LPD
Sbjct: 1   MSSSKRRIETDVMKLL---MSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPD 57

Query: 61  DYPMEAPKVRFLTKIYHPNID-RLGRICLDVLKTNWSPALQ-IRTVLLSVQALLASPNPN 118
           +YP ++P + F+ KI+HPNID   G ICLDV+ + WSP    I  V   +  LL  PN +
Sbjct: 58  NYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGS 117

Query: 119 DPLANDVAEEWIQNEAGAKATAREWTQKYAKK 150
           DPL N+ A   ++++   +   +E+  KYA K
Sbjct: 118 DPLNNEAATLQLRDKKLYEEKIKEYIDKYATK 149

>KLLA0A11198g
           join(complement(974525..974529),
           complement(973755..974358)) similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 202

 Score =  100 bits (249), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 76/124 (61%), Gaps = 2/124 (1%)

Query: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           ED ++ F++   GP  +PYE G+++L + LPD+YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIQNEAGAKATAREWTQK 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   ++++   +    E+  K
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINK 146

Query: 147 YAKK 150
           YA K
Sbjct: 147 YATK 150

>ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH]
           complement(503223..503720) [498 bp, 165 aa]
          Length = 165

 Score = 99.0 bits (245), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 78/155 (50%), Gaps = 14/155 (9%)

Query: 6   KRIIKETERLISDPVPGITAEP-HEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KR++KE ++L+ D   GI A P  EDNL  ++  +EGPA SPYE G+F   L  P DYP+
Sbjct: 7   KRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPN+   G +C+ +L                WSP   +  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEEWIQNEAGAKATAREWTQK 146
           L+ PN       D    W  N A  +   +E  ++
Sbjct: 127 LSEPNVESGANIDACILWRDNRADFERQVQESVRR 161

>Kwal_34.16174
          Length = 213

 Score = 97.4 bits (241), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 77/123 (62%), Gaps = 2/123 (1%)

Query: 30  DNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRL-GRICL 88
           DN++ F+V   GP  +PYE G+++L + LPD+YP ++P + F+ KI+HPNID   G ICL
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICL 74

Query: 89  DVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIQNEAGAKATAREWTQKY 147
           DV+ + WSP   +  +L   +  LL  PN +DPL N+ A   ++++   +   RE+  ++
Sbjct: 75  DVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYERKIREFIDQF 134

Query: 148 AKK 150
           A +
Sbjct: 135 ATE 137

>CAGL0M07568g complement(758110..758607) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 95.9 bits (237), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 14/143 (9%)

Query: 6   KRIIKETERLISDPVPGITAEP-HEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KR+ KE ++LI D  PGI A P  +DNL  ++  ++GP  +PY  G+F  +L  P DYP+
Sbjct: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEEWIQNEA 134
           L+ PN       D    W  N A
Sbjct: 127 LSEPNIESGANIDACILWRDNRA 149

>Scas_694.33
          Length = 231

 Score = 97.4 bits (241), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 83/143 (58%), Gaps = 7/143 (4%)

Query: 13  ERLISDPVPGITAEPHE-----DNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAP 67
           +R I   V  +    HE     ++++ F++   GP  +PYE G+++L + LPD+YP ++P
Sbjct: 28  KRRIETDVMKLLMSDHEVELVNNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSP 87

Query: 68  KVRFLTKIYHPNID-RLGRICLDVLKTNWSPALQIRTVL-LSVQALLASPNPNDPLANDV 125
            + F+ KI+HPNID   G ICLDV+ + WSP   +  ++   +  LL  PN +DPL N+ 
Sbjct: 88  SIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEA 147

Query: 126 AEEWIQNEAGAKATAREWTQKYA 148
           A   ++++   +   RE+  KYA
Sbjct: 148 ATLELRDKKLYEEKIREYIDKYA 170

>YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugating
           enzyme, associates with Ubc6p on the cytoplasmic side of
           endoplasmic reticulum [498 bp, 165 aa]
          Length = 165

 Score = 94.0 bits (232), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 71/125 (56%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLISDPVPGITAEPH-EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KR++KE ++LI D  PGI A P  E+N+  ++  ++GP  +PY +G+F  +L  P DYP+
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Scas_709.49
          Length = 165

 Score = 92.4 bits (228), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 75/151 (49%), Gaps = 14/151 (9%)

Query: 6   KRIIKETERLISDPVPGITAEP-HEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           +R++KE ++L  D  PGI A P +E+NL  ++  V+GP  + YE GIF   L  P DYP+
Sbjct: 7   RRLLKELQQLTKDSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   I  +LLSV ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEEWIQNEAGAKATARE 142
           L+ PN       D    W  N    +   R+
Sbjct: 127 LSEPNIESGANIDACILWRDNREEFERQVRQ 157

>Kwal_26.8224
          Length = 165

 Score = 92.0 bits (227), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 70/141 (49%), Gaps = 14/141 (9%)

Query: 6   KRIIKETERLISDPVPGITAEPH-EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KR+ KE ++L+ D   GI A P  EDNL  ++  + GP  SPY+ G+F   L  P DYP+
Sbjct: 7   KRLFKELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  SPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEEWIQN 132
           L+ PN       D    W  N
Sbjct: 127 LSEPNVESGANIDACILWRDN 147

>Scas_621.4
          Length = 193

 Score = 90.1 bits (222), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (57%)

Query: 38  TVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSP 97
            +  P    Y+NG F+  L   D+YPME PKV    +IYHPNID  G++CL++L+ +WSP
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQGKVCLNILREDWSP 132

Query: 98  ALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGAKATAREWTQKYA 148
           AL ++++++ +  L   PN  DPL  D A  + ++        R+  + Y+
Sbjct: 133 ALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFVRKTMEGYS 183

>AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH]
           (741224..741659,741718..741755) [474 bp, 157 aa]
          Length = 157

 Score = 89.4 bits (220), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 7/151 (4%)

Query: 6   KRIIKETERLISDPVPGITAEP--HED---NLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
           +R+ +E ++   D   G  A+P   ED   NL+ +   + G  G+ +++G++ + +  PD
Sbjct: 7   QRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPD 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALLASPNPN 118
           DYP + P+V+F    YHPNI   G +CL +L    +W PA+ ++ +LL VQ LL SPNPN
Sbjct: 67  DYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPN 126

Query: 119 DPLANDVAEEWIQNEAGAKATAREWTQKYAK 149
            P        + +N    +    E  ++YAK
Sbjct: 127 SPAQEPAWRAYAKNLQEYEKKVLEQARRYAK 157

>Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement
          Length = 233

 Score = 90.1 bits (222), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 70/141 (49%), Gaps = 14/141 (9%)

Query: 6   KRIIKETERLISDPVPGITAEP-HEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KR++KE ++L  D   GI A P  EDNL  ++  + GP  SPYE G+F   L  P DYP+
Sbjct: 75  KRLLKELQQLARDSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPL 134

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             P++ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 135 SPPRLTFTPSILHPNIYPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSM 194

Query: 112 LASPNPNDPLANDVAEEWIQN 132
           L+ PN       D    W  N
Sbjct: 195 LSEPNVESGANIDACILWRDN 215

>KLLA0E04983g 443446..443919 highly similar to sp|P50623
           Saccharomyces cerevisiae YDL064w UBC9 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 157

 Score = 87.8 bits (216), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 75/128 (58%), Gaps = 8/128 (6%)

Query: 1   MASLP-KRIIKETERLISDPVPGITAEPHED-----NLRYFNVTVEGPAGSPYENGIFQL 54
           M+SL  +R+ +E ++   D   G  A+P +      NL+ +   + G  G+ ++NG++ L
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPL 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALL 112
            +  PDDYP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ +LL VQ LL
Sbjct: 61  TIEYPDDYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQLLLGVQDLL 120

Query: 113 ASPNPNDP 120
            SPNPN P
Sbjct: 121 DSPNPNSP 128

>KLLA0E07711g complement(693694..694191) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w QRI8 E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 87.4 bits (215), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 66/125 (52%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLISDPVPGITAEPHED-NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           KR++KE E+L  D   GI A P +D NL  ++  + GP  S YE G+F   L  P DYP+
Sbjct: 7   KRLLKELEKLTKDSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSVQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLSV ++
Sbjct: 67  NPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSI 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomyces
           cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 157

 Score = 87.0 bits (214), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 80/142 (56%), Gaps = 8/142 (5%)

Query: 1   MASLP-KRIIKETERLISDPVPGITAEPHED-----NLRYFNVTVEGPAGSPYENGIFQL 54
           M+SL  +R+ +E ++   D   G  A+P +      NL+ +   + G  G+ +++G+F +
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPI 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALL 112
            +  PD+YP + PKV+F    YHPNI   G +CL +L    +W PA+ ++ ++L VQ LL
Sbjct: 61  TVEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEEWIQNEA 134
            SPNPN P        + +N+A
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNKA 142

>Kwal_23.4227
          Length = 122

 Score = 84.7 bits (208), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 65/121 (53%), Gaps = 2/121 (1%)

Query: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDV 90
           NL+ +   + G  G+ ++ G+F + +  PDDYP + PKV+F    YHPNI   G +CL +
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSI 61

Query: 91  LK--TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGAKATAREWTQKYA 148
           L    +W PA+ ++ + L VQ LL SPNPN P        + +N    +    E  +KY 
Sbjct: 62  LNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKVIEQAKKYT 121

Query: 149 K 149
           K
Sbjct: 122 K 122

>KLLA0C17248g complement(1509885..1510439) similar to sp|P52491
           Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 184

 Score = 84.3 bits (207), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 76/127 (59%), Gaps = 3/127 (2%)

Query: 7   RIIKETERL-ISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           R+ K+ E + +S+ +   T    E+ +R  N+ ++   G  Y  G +   +++ D YPME
Sbjct: 33  RLKKDLENIDLSEQICEYTTYLDENPMR-VNLAIKPDIGY-YAGGTYYFNVFIKDTYPME 90

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDV 125
            P V+ + +IYHPNID  G +CL++L+ +W+PAL I+++++ +  L   PN  DPL  D 
Sbjct: 91  PPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDIQSIIIGILFLFHEPNGRDPLNKDA 150

Query: 126 AEEWIQN 132
           A+  I++
Sbjct: 151 AKTLIED 157

>YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853)
           Rub1p-conjugating enzyme, with similarity to ubiquitin-
           and ubiquitin-like protein-conjugating enzymes [567 bp,
           188 aa]
          Length = 188

 Score = 81.6 bits (200), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (56%)

Query: 47  YENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLL 106
           Y  G     L   + YP+E PKV  L KI+HPNID  G +CL++L+ +WSPAL +++++ 
Sbjct: 75  YNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIIT 134

Query: 107 SVQALLASPNPNDPLANDVAEEWIQNEAGAKATAR 141
            +  L   PNPNDPL  D A+   + E       R
Sbjct: 135 GLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVR 169

>YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070)
           Smt3p-conjugating enzyme required for G2/M transition,
           conjugates Smt3p to Pol30p (PCNA) in S phase, which may
           be antagonistic to non-proteolytic ubiquitination of
           Pol30p in the Rad6-dependent DNA repair pathway [474 bp,
           157 aa]
          Length = 157

 Score = 80.5 bits (197), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 78/142 (54%), Gaps = 8/142 (5%)

Query: 1   MASLP-KRIIKETERLISDPVPGITAEPHED-----NLRYFNVTVEGPAGSPYENGIFQL 54
           M+SL  +R+ +E ++   D   G  A+P +      +L+ +   + G  G+ +  G++ +
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 55  ELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSVQALL 112
            +  P++YP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ ++L VQ LL
Sbjct: 61  TVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEEWIQNEA 134
            SPNPN P        + +N+A
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKA 142

>CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces
           cerevisiae YLR306w UBC12 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 187

 Score = 80.1 bits (196), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%)

Query: 47  YENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLL 106
           Y+ G F+      + YP++ PKV    KI+HPNID  G+ICL++L+ +WSPAL ++ ++L
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPHGKICLNILREDWSPALDLQCIVL 135

Query: 107 SVQALLASPNPNDPLANDVAE 127
            + +L   PN NDPL  + AE
Sbjct: 136 GLLSLFQEPNGNDPLNKEAAE 156

>ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH]
           (634059..634610,634663..634713) [603 bp, 200 aa]
          Length = 200

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 54/91 (59%)

Query: 42  PAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P    Y  G F+  +   D YP+E P V+ L  IYHPNID  G ICL+VL+ +WSP + +
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDL 142

Query: 102 RTVLLSVQALLASPNPNDPLANDVAEEWIQN 132
           +TV+L +  L   PN +DPL    A+  +++
Sbjct: 143 QTVVLGLLFLFLEPNGSDPLNRQAADTMLRD 173

>Sklu_1826.3 YGR133W, Contig c1826 3548-4033
          Length = 161

 Score = 73.9 bits (180), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85
           N+ ++   + GP  +PY + +F L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95

Query: 86  ICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137

>YDR054C (CDC34) [905] chr4 complement(561436..562323)
           Ubiquitin-conjugating enzyme (E2); component of the SCF
           (Skp1p-Cdc53p-F-box) complexes which act with various
           F-box proteins to direct target proteins into the
           ubiquitin-dependent degradation pathway [888 bp, 295 aa]
          Length = 295

 Score = 75.9 bits (185), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 17/136 (12%)

Query: 14  RLISDP---VPGITAEPHED-NLRYFNVTVEG-PAGSPYENGIFQLELYLPDDYPMEAPK 68
           R ++DP   +P    E  +D N+  +N+ V      S Y  G F+ ++  P+D+P   P+
Sbjct: 17  RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQ 76

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTN------------WSPALQIRTVLLSVQALLASPN 116
            RF   IYHPN+ R GR+C+ +L  +            WSP   + +VL+S+ +LL  PN
Sbjct: 77  FRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPN 136

Query: 117 PNDPLANDVAEEWIQN 132
            N P   D A ++ +N
Sbjct: 137 INSPANVDAAVDYRKN 152

>Kwal_55.21246
          Length = 160

 Score = 72.8 bits (177), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRI 86
           +DNL  +   + GP+ +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92

Query: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126
           C+++L + +WSPA  +  ++ ++  LLA+P P+ PL  D+A
Sbjct: 93  CINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLA 133

>CAGL0E04598g complement(444288..445175) highly similar to sp|P14682
           Saccharomyces cerevisiae YDR054c CDC34 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 295

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 17/136 (12%)

Query: 14  RLISDP---VPGITAEPHED-NLRYFNVTVEG-PAGSPYENGIFQLELYLPDDYPMEAPK 68
           R ++DP   +P    E  +D N+  +N+ V      S Y  G F+ ++  PDD+P   P+
Sbjct: 17  RELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFPFSPPQ 76

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTN------------WSPALQIRTVLLSVQALLASPN 116
            RF   IYHPN+ R GR+C+ +L  +            WSP   + +VL+S+ +LL  PN
Sbjct: 77  FRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPN 136

Query: 117 PNDPLANDVAEEWIQN 132
            + P   D A ++ +N
Sbjct: 137 ISSPANVDAAVDFRKN 152

>Scas_718.34
          Length = 258

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 78/156 (50%), Gaps = 24/156 (15%)

Query: 14  RLISDP---VPGITAEPHED-NLRYFNVTVEG-PAGSPYENGIFQLELYLPDDYPMEAPK 68
           R ++DP   +P    E  +D N+  +N+ V      S Y  G FQ ++  P D+P   P+
Sbjct: 24  RELTDPKRAIPSFHIELEDDSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFPFSPPQ 83

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTN------------WSPALQIRTVLLSVQALLASPN 116
            +F+  IYHPN+ R G++C+ +L  +            WSP   + +VL+S+ +LL  PN
Sbjct: 84  FKFIPPIYHPNVYRDGKLCISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLLEDPN 143

Query: 117 PNDPLANDVAEEWIQNEAGAKATAREWTQKYAKKVE 152
            + P   D A E+ +N         E+ +K  ++VE
Sbjct: 144 VSSPANVDAAVEYRKN-------YNEYKKKVLQQVE 172

>Kwal_27.10444
          Length = 278

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 12/100 (12%)

Query: 45  SPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G F+ ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L T+          
Sbjct: 53  SIYHGGYFKAQMRFPEDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHTSGDPTSEEPDS 112

Query: 95  --WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQN 132
             WSP   + +VL+S+ +LL  PN + P   D A ++ +N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 251

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 11/120 (9%)

Query: 1   MASLP--KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYL 58
           MAS+   KR+ KE + ++++P P I A PHEDN+  ++  + GP  +PYENG +   L  
Sbjct: 1   MASIQANKRLTKEYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTF 60

Query: 59  PDDYPMEAPKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLA 113
           P DYP   P +R +T    PN       R+CL   D     W+PA  + T+L  + + + 
Sbjct: 61  PSDYPFNPPAIRMIT----PNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116

>Scas_635.18
          Length = 273

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 69/136 (50%), Gaps = 17/136 (12%)

Query: 14  RLISDP---VPGITAEPHED-NLRYFNVTVEG-PAGSPYENGIFQLELYLPDDYPMEAPK 68
           R ++DP   +P    E  +D NL  +N+ V      S Y  G F+ ++  P+D+P   P+
Sbjct: 17  RELTDPKKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQ 76

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTN------------WSPALQIRTVLLSVQALLASPN 116
            RF   IYHPN+ R GR+C+ +L               WSP   + +VL+S+ +LL  PN
Sbjct: 77  FRFTPAIYHPNVYRDGRLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPN 136

Query: 117 PNDPLANDVAEEWIQN 132
            + P   D A ++ +N
Sbjct: 137 ISSPANVDAAVDYRKN 152

>Scas_712.59
          Length = 171

 Score = 72.0 bits (175), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 3/109 (2%)

Query: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88
           +L ++   ++GP G+PY N  FQL++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103

Query: 89  DVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGA 136
           D+L K +W+PA  + T + ++  LL  P P+ PL  D+A     N+  A
Sbjct: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152

>KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 292

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 12/100 (12%)

Query: 45  SPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G F+ ++  PDD+P   P  RF   IYHPN+ R GR+C+ +L  +          
Sbjct: 52  SIYHGGYFKAQMKFPDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSGNPTSDEPDE 111

Query: 95  --WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQN 132
             WSP   + +VL+S+ +LL  PN + P   D A ++ +N
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKN 151

>Sklu_2136.5 YDR054C, Contig c2136 7737-8555
          Length = 272

 Score = 72.4 bits (176), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 69/136 (50%), Gaps = 17/136 (12%)

Query: 14  RLISDP---VPGITAEPHED-NLRYFNVTVEG-PAGSPYENGIFQLELYLPDDYPMEAPK 68
           R ++DP   +P    E  +D N+  +N+ V      S Y  G F+ ++  P+D+P   P 
Sbjct: 17  RELTDPKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPEDFPFSPPN 76

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTN------------WSPALQIRTVLLSVQALLASPN 116
            RF   IYHPN+ R GR+C+ +L  +            WSP   + +VL+S+ +LL  PN
Sbjct: 77  FRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPN 136

Query: 117 PNDPLANDVAEEWIQN 132
            + P   D A ++ +N
Sbjct: 137 ISSPANVDAAVDYRKN 152

>AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH]
           (317749..318561) [813 bp, 270 aa]
          Length = 270

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 69/136 (50%), Gaps = 17/136 (12%)

Query: 14  RLISDP---VPGITAEPHED-NLRYFNVTVEG-PAGSPYENGIFQLELYLPDDYPMEAPK 68
           R ++DP   +P    E  +D N+  +N+ V      S Y  G F+ ++  P+D+P   P 
Sbjct: 17  RELTDPKKAIPSFHIELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPS 76

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTN------------WSPALQIRTVLLSVQALLASPN 116
            RF   IYHPN+ R GR+C+ +L  +            WSP   + +VL+S+ +LL  PN
Sbjct: 77  FRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPN 136

Query: 117 PNDPLANDVAEEWIQN 132
            + P   D A ++ +N
Sbjct: 137 ISSPANVDAAVDYRKN 152

>YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugating
           enzyme, anchored in the ER membrane with the
           catalytically active domain in cytoplasm [753 bp, 250
           aa]
          Length = 250

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (53%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + ++ +P P I A P+EDN+  ++  + GPA +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLT--KIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
            P +R +T    + PN     R+CL   D     W+P   + T+L  + + + S
Sbjct: 68  PPAIRMITPNGRFKPNT----RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

>Kwal_27.10837
          Length = 246

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 70/147 (47%), Gaps = 20/147 (13%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + ++ +P P I A+P+EDN+  ++  + GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFK 67

Query: 66  APKVRFLTKIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLASPNPNDPLA 122
            P +R +T       D   R+CL   D     W+P+  + T+L  + + + S        
Sbjct: 68  PPAIRMVTPSGRFKED--TRLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTSE------- 118

Query: 123 NDVAEEWIQNEAGAKATAREWTQKYAK 149
                   +N  GA  T +E  +K A+
Sbjct: 119 --------ENTTGAIVTTQEHKRKMAR 137

>CAGL0I10450g complement(1024541..1025029) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w ubiquitin-conjugating
           enzyme - peroxin, hypothetical start
          Length = 162

 Score = 67.0 bits (162), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 10/116 (8%)

Query: 30  DNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIY-------HPNID- 81
           D  R+F V ++GPA +PY    F+L + +P  YPM  P ++F++          H N+D 
Sbjct: 33  DLSRWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDR 91

Query: 82  RLGRICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGA 136
           R G ICLD+LK   WSP   I  V+ ++  LL  P P+ PL  D+A     N+  A
Sbjct: 92  RTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSA 147

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 59/114 (51%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + +  +P P I A P EDN+  ++  + GP  +PYE+G +   L  P+DYP  
Sbjct: 8   KRLSKEYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFN 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
            P +R LT    PN       R+CL   D     W+P+  + T+L  + + + +
Sbjct: 68  PPAIRMLT----PNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTT 117

>Scas_599.16
          Length = 224

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 62/114 (54%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + ++ +P+P I A P+EDN+  ++  + GP  +PY++G +   L  P DYP +
Sbjct: 110 KRLTKEYKLMVENPLPYILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYK 169

Query: 66  APKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL +   +   W+P   + T+L  + +L+  
Sbjct: 170 PPAIRMIT----PNGRFKDNTRLCLSMSDYHPDLWNPGWSVNTILNGLLSLMTG 219

>AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH]
           complement(1006421..1006888) [468 bp, 155 aa]
          Length = 155

 Score = 64.3 bits (155), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88
           +L  +    +GP  +PY    F L + +P+ YP E PK  F    I HPNI    G +CL
Sbjct: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92

Query: 89  DVLKTN-WSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAG 135
           D+LK   WSP   +  V+ ++  LLA P  + PL  D++  +  + A 
Sbjct: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAA 140

>Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement
          Length = 251

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + +I +P   I A+P+EDN+  ++  + GP  +PY +G +   L  P DYP +
Sbjct: 8   KRLTKEYKAIIENPPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+C+   D     W+PA  + T+L+ + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMTG 117

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
           enzyme and peroxisomal biogenesis protein (peroxin) [552
           bp, 183 aa]
          Length = 183

 Score = 63.5 bits (153), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 6   KRIIKETERL---------ISDPVPGITAEPH---EDNLRYFNVTVEGPAGSPYENGIFQ 53
            RI+KE + +         I++P  GI    +   E +L  +   + GP+ +PYEN  F+
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 54  LELYLPDDYPMEAPKVRFL-TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSVQA 110
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + +V  
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 111 LLASPNPNDPLANDVA 126
           LL  P  + PL  D+ 
Sbjct: 140 LLREPVCDSPLDVDIG 155

>CAGL0I05478g complement(518933..519673) highly similar to sp|P33296
           Saccharomyces cerevisiae YER100w UBC6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 246

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + ++ +P P I A P+E+N+  ++  + GP  +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL   D     W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTG 117

>Scas_609.7
          Length = 240

 Score = 61.2 bits (147), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPME 65
           KR+ KE + +I +P P I A P+E+N+  ++  + GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKLIIENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSVQALLAS 114
            P +R +T    PN       R+CL +   +   W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMTG 117

>KLLA0E03916g complement(365119..365595) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w PAS2 E2
           ubiquitin-conjugating enzyme - peroxin, start by
           similarity
          Length = 158

 Score = 57.4 bits (137), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82
           +D+L  +    +GP+ SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88

Query: 83  LGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127
            G ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133

>Kwal_27.11182
          Length = 101

 Score = 50.8 bits (120), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 3/87 (3%)

Query: 32  LRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDV 90
           + Y+N T+ GP  S +EN I+ + L   + YP E PK++F++KI  P +++  G +  D 
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPCVNQTTGEVKRDQ 60

Query: 91  LKT--NWSPALQIRTVLLSVQALLASP 115
             T  +W  +  + T+LL ++  +A P
Sbjct: 61  FSTLRDWKRSYNMETLLLDLRKEMALP 87

>Scas_551.9
          Length = 153

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 10  KETERLISDPVPGITAEP--HED---NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPM 64
           K  ++   D   G  A+P  H D   NL+ +   + G  G+ +  G++ + +  P++YP 
Sbjct: 65  KNRKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPS 124

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVL 91
           + PKV+     YHPN+   G ICL +L
Sbjct: 125 KPPKVKLPANFYHPNVYPSGTICLSIL 151

>KLLA0E19217g join(complement(1703226..1703236), highly similar to
           sp|P53152 Saccharomyces cerevisiae YGL087c MMS2 part of
           the error-free postreplication repair pathway singleton,
           start by similarity
          Length = 139

 Score = 45.8 bits (107), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 3/85 (3%)

Query: 35  FNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT 93
           +N T+ GP  S +EN I+ + +     YP E PKV+F++KI  P ++   G +  +   T
Sbjct: 41  WNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPCVNSTTGEVVKEKFHT 100

Query: 94  --NWSPALQIRTVLLSVQALLASPN 116
              W  +  + TVLL ++  +A+P+
Sbjct: 101 LKEWKRSYTMETVLLELRKEMATPS 125

>CAGL0H03157g
           join(complement(297881..297891),
           complement(297272..297680)) highly similar to sp|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 45.4 bits (106), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 25  AEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNIDR-L 83
           A+  +  +  +N T+ GP  S +EN I+ + +     YP E P + F++KI  P +D+  
Sbjct: 31  ADADDITMTRWNGTILGPPHSNHENRIYSVSIECGPKYPDEPPTITFISKINLPCVDQST 90

Query: 84  GRICLDVLKT--NWSPALQIRTVLLSVQALLASP 115
           G +  +   T  +W     + T+LL ++  +ASP
Sbjct: 91  GEVNKEKFNTLKDWKRLYNMETILLDLRKEMASP 124

>Scas_720.10*
          Length = 134

 Score = 45.1 bits (105), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 3/84 (3%)

Query: 35  FNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLKT 93
           +N T+ GP  S +EN I+ + ++    YP   P ++F++KI  P +D + G +      T
Sbjct: 37  WNGTILGPPHSNHENRIYSVAIHCGPHYPDAPPTIKFVSKINLPCVDEKTGEVKQASFHT 96

Query: 94  --NWSPALQIRTVLLSVQALLASP 115
             +W  +  + T+LL ++  +ASP
Sbjct: 97  LRDWKRSYTMETLLLDLRKEMASP 120

>YGL087C (MMS2) [1895] chr7
           complement(346407..346809,346895..346905)
           Ubiquitin-conjugating enzyme variant (UEV) protein
           required for resistance to DNA damaging agents and
           non-proteolytic multi-ubiquitination of Pol30p (PCNA)
           [414 bp, 137 aa]
          Length = 137

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 2/93 (2%)

Query: 25  AEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNID-RL 83
           A+  +  +  +N T+ GP  S +EN I+ L +    +YP   PKV F++KI  P ++   
Sbjct: 31  ADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTT 90

Query: 84  GRICLDVLK-TNWSPALQIRTVLLSVQALLASP 115
           G +  D     +W  A  + T+LL ++  +A+P
Sbjct: 91  GEVQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

>AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH]
           complement(314210..314220,314273..314678) [417 bp, 138
           aa]
          Length = 138

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLTKIYHPNID-RLGRICLD 89
           ++ ++N T+ GP  S +EN I+ + +    +YP   PKVRF+++I  P +D   G +  +
Sbjct: 37  SMTHWNGTILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPE 96

Query: 90  VLKT--NWSPALQIRTVLLSVQALLAS 114
                 +W  +  + T+L  ++  +AS
Sbjct: 97  AFHALRDWKRSSNMETLLQDLRKEMAS 123

>Kwal_27.12327
          Length = 1574

 Score = 31.6 bits (70), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%)

Query: 1    MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60
            +  + K +I +  R I + V  +TA+     ++  NVT E  AG   +    ++ L LP 
Sbjct: 1400 ITHISKILIDQELREIGEKVKKLTAQDSSLTIKLNNVTNEIKAGYLVDEQRLEISLKLPL 1459

Query: 61   DYPMEAPKVRFLTKI 75
            +YP+   +V  ++++
Sbjct: 1460 NYPLNNIQVHGVSRV 1474

>YMR202W (ERG2) [4158] chr13 (667536..668204) Sterol C8-C7 isomerase
           (C-8 sterol isomerase), an enzyme of the ergosterol
           biosynthesis pathway [669 bp, 222 aa]
          Length = 222

 Score = 29.6 bits (65), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 83  LGRICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGA 136
           L  IC  V+ K N +  L    +L  V+  LAS   ++ +   V EEW+ N AG 
Sbjct: 36  LNEICNSVISKHNAAEGLSTEDLLQDVRDALASHYGDEYINRYVKEEWVFNNAGG 90

>Kwal_23.4090
          Length = 2050

 Score = 28.9 bits (63), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 4    LPKRIIKE---TERLISDPVPGITAEPHEDNLRYFN 36
            L K IIKE    +RLI   +P +TA+P E    YF 
Sbjct: 1992 LKKNIIKENVKADRLIGKYIPNLTAKPFEITKEYFQ 2027

>AFR590W [3782] [Homologous to ScYDL049C (KNH1) - SH]
           complement(1500189..1501028) [840 bp, 279 aa]
          Length = 279

 Score = 26.9 bits (58), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 130 IQNEAGAKATAREWTQKY 147
           +Q + G K TAR WT++Y
Sbjct: 178 MQTQPGTKVTARTWTRRY 195

>CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein,
           start by similarity
          Length = 422

 Score = 26.6 bits (57), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 7   RIIKETERLISDP---VPGITAEPHEDN-LRYFNVTVEGPAGSP---YENGIFQLELYLP 59
            II++TE  ++ P   V G+      DN +R        P+ +P   + + I QL   + 
Sbjct: 58  HIIRDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIY 117

Query: 60  DDYPMEAPKVRFLTKIYHPNIDRL 83
           +DY  +   +R + KIYHP I++L
Sbjct: 118 NDYE-DGDILRNIPKIYHPLIEKL 140

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.134    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,292,072
Number of extensions: 216661
Number of successful extensions: 538
Number of sequences better than 10.0: 94
Number of HSP's gapped: 481
Number of HSP's successfully gapped: 94
Length of query: 153
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 60
Effective length of database: 13,376,635
Effective search space: 802598100
Effective search space used: 802598100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 57 (26.6 bits)