Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.14d27527513660.0
Scas_627.17d27527512910.0
YKL062W (MSN4)630511134e-06
KLLA0F26961g694481091e-05
Scas_649.28730511082e-05
Scas_717.60d167651022e-05
CAGL0M13189g541481062e-05
YJR127C (ZMS1)1380491063e-05
YER169W (RPH1)796581045e-05
AGR117C799821037e-05
Scas_703.231341481037e-05
CAGL0L11880g980551011e-04
KLLA0C17072g474631001e-04
Scas_602.9547631001e-04
Kwal_56.23453828621001e-04
YDR096W (GIS1)894531001e-04
Scas_681.19864551002e-04
ACL057W52063992e-04
Scas_709.3282251992e-04
AER159C119149992e-04
Sklu_2443.2221349953e-04
KLLA0C17710g82153974e-04
KLLA0B04477g133249965e-04
Sklu_2181.141063955e-04
Kwal_26.835169848948e-04
CAGL0H04213g132146949e-04
Scas_719.68135048949e-04
KLLA0E10989g47450930.001
CAGL0G08107g62556920.001
ABR089C57148920.002
CAGL0K02145g31763910.002
Kwal_47.1724140363910.002
YER130C44367910.002
YML081W125148910.003
Kwal_47.16621117849900.003
CAGL0M00594g102049900.003
CAGL0F05995g59761890.004
YMR037C (MSN2)70448870.007
YDR216W (ADR1)132359870.007
CAGL0K09372g39649860.008
Kwal_14.227846349850.009
CAGL0L06072g30049840.010
Sklu_2351.654847850.012
Kwal_27.1182419954820.014
KLLA0D11902g28954830.014
Scas_717.1752552820.023
Scas_575.345549820.024
AGL246W22774810.024
KLLA0D16456g85446820.026
KLLA0E18645g43147810.027
YMR070W (MOT3)49047810.031
Sklu_2389.276758810.032
CAGL0A01628g42448800.035
AGR172W105775800.043
AFR471C38949800.043
KLLA0F13046g137947800.047
Scas_568.519950770.055
YGL035C (MIG1)50449780.068
Scas_687.3328849770.082
CAGL0K03003g64751770.097
Scas_670.243548760.14
YNL027W (CRZ1)67855750.19
Scas_378.120847730.22
Scas_712.42*29049730.24
CAGL0E04884g148947740.25
YPR022C113381740.26
Scas_627.6120771740.27
Kwal_26.801119063720.27
YGL209W (MIG2)38252730.28
Scas_721.92115249730.34
Sklu_1527.120572710.34
YPL038W (MET31)17747700.38
Kwal_47.1788878648710.64
CAGL0K04697g51548700.76
AEL174W66145700.77
AFR580C83833700.77
CAGL0K04257g54733700.77
KLLA0F23782g78248700.78
CAGL0K12078g46347700.79
Sklu_2398.228848690.80
Scas_707.3128946690.89
Sklu_2206.235848690.98
Scas_569.229333681.0
Scas_720.3331644681.0
AGL071C39645681.1
Kwal_47.1904526649681.2
Scas_683.3047850681.2
KLLA0F18524g35750681.2
Kwal_26.802150745681.3
ACR264W76947681.4
CAGL0C02519g31851671.5
CAGL0B02651g18948661.6
AFL136W40944671.6
Scas_695.257149671.8
KLLA0E13519g23063661.8
KLLA0E08679g59649671.9
Scas_683.2587930671.9
CAGL0M06831g64550671.9
YOR113W (AZF1)91453672.0
KLLA0F01463g78159662.1
YDL048C (STP4)49048662.1
CAGL0K04631g101329662.2
YDR463W (STP1)51934662.3
KLLA0B07909g92233662.5
Kwal_56.2392574553662.5
Kwal_27.1146053149652.9
YGR067C79430652.9
KLLA0A02629g55933653.2
ADL198W54758653.4
Scas_660.1236736643.5
YMR182C (RGM1)21147633.7
YDL030W (PRP9)53062644.0
Scas_718.4426641625.0
Scas_500.457351635.1
Kwal_14.254371165635.1
Scas_697.3583946635.4
YLR131C (ACE2)77052635.7
YDR043C (NRG1)23126616.5
YJL056C (ZAP1)88047626.6
CAGL0E06116g61352627.3
Scas_713.2251854618.1
Sklu_2357.715750598.9
YLR375W34348619.3
CAGL0L03916g64254619.5
YJR054W49778619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.14d
         (275 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.14d                                                          530   0.0  
Scas_627.17d                                                          501   0.0  
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    48   4e-06
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    47   1e-05
Scas_649.28                                                            46   2e-05
Scas_717.60d                                                           44   2e-05
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    45   2e-05
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    45   3e-05
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    45   5e-05
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    44   7e-05
Scas_703.23                                                            44   7e-05
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    44   1e-04
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    43   1e-04
Scas_602.9                                                             43   1e-04
Kwal_56.23453                                                          43   1e-04
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    43   1e-04
Scas_681.19                                                            43   2e-04
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    43   2e-04
Scas_709.32                                                            43   2e-04
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    43   2e-04
Sklu_2443.22 , Contig c2443 45390-46027                                41   3e-04
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    42   4e-04
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    42   5e-04
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            41   5e-04
Kwal_26.8351                                                           41   8e-04
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    41   9e-04
Scas_719.68                                                            41   9e-04
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    40   0.001
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    40   0.001
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    40   0.002
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    40   0.002
Kwal_47.17241                                                          40   0.002
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    40   0.002
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    40   0.003
Kwal_47.16621                                                          39   0.003
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    39   0.003
CAGL0F05995g complement(598819..600612) some similarities with s...    39   0.004
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    38   0.007
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    38   0.007
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    38   0.008
Kwal_14.2278                                                           37   0.009
CAGL0L06072g complement(679924..680826) some similarities with s...    37   0.010
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       37   0.012
Kwal_27.11824                                                          36   0.014
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    37   0.014
Scas_717.17                                                            36   0.023
Scas_575.3                                                             36   0.024
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    36   0.024
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    36   0.026
KLLA0E18645g complement(1648263..1649558) some similarities with...    36   0.027
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    36   0.031
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            36   0.032
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    35   0.035
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    35   0.043
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    35   0.043
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    35   0.047
Scas_568.5                                                             34   0.055
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    35   0.068
Scas_687.33                                                            34   0.082
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    34   0.097
Scas_670.2                                                             34   0.14 
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    33   0.19 
Scas_378.1                                                             33   0.22 
Scas_712.42*                                                           33   0.24 
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    33   0.25 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    33   0.26 
Scas_627.6                                                             33   0.27 
Kwal_26.8011                                                           32   0.27 
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    33   0.28 
Scas_721.92                                                            33   0.34 
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             32   0.34 
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    32   0.38 
Kwal_47.17888                                                          32   0.64 
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    32   0.76 
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    32   0.77 
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    32   0.77 
CAGL0K04257g complement(391287..392930) some similarities with s...    32   0.77 
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    32   0.78 
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    32   0.79 
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                31   0.80 
Scas_707.31                                                            31   0.89 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            31   0.98 
Scas_569.2                                                             31   1.0  
Scas_720.33                                                            31   1.0  
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    31   1.1  
Kwal_47.19045                                                          31   1.2  
Scas_683.30                                                            31   1.2  
KLLA0F18524g complement(1701498..1702571) some similarities with...    31   1.2  
Kwal_26.8021                                                           31   1.3  
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    31   1.4  
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    30   1.5  
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    30   1.6  
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    30   1.6  
Scas_695.2                                                             30   1.8  
KLLA0E13519g complement(1190615..1191307) some similarities with...    30   1.8  
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    30   1.9  
Scas_683.25                                                            30   1.9  
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    30   1.9  
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    30   2.0  
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    30   2.1  
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    30   2.1  
CAGL0K04631g complement(440721..443762) some similarities with s...    30   2.2  
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    30   2.3  
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    30   2.5  
Kwal_56.23925                                                          30   2.5  
Kwal_27.11460                                                          30   2.9  
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    30   2.9  
KLLA0A02629g complement(233822..235501) some similarities with s...    30   3.2  
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    30   3.4  
Scas_660.12                                                            29   3.5  
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    29   3.7  
YDL030W (PRP9) [832] chr4 (397534..399126) Pre-mRNA splicing fac...    29   4.0  
Scas_718.44                                                            28   5.0  
Scas_500.4                                                             29   5.1  
Kwal_14.2543                                                           29   5.1  
Scas_697.35                                                            29   5.4  
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    29   5.7  
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    28   6.5  
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    28   6.6  
CAGL0E06116g complement(604708..606549) some similarities with t...    28   7.3  
Scas_713.22                                                            28   8.1  
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        27   8.9  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    28   9.3  
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    28   9.5  
YJR054W (YJR054W) [2948] chr10 (535970..537463) Protein of unkno...    28   9.6  

>Scas_636.14d
          Length = 275

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/275 (92%), Positives = 255/275 (92%)

Query: 1   MSQFPFSFGNQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQ 60
           MSQFPFSFGNQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQ
Sbjct: 1   MSQFPFSFGNQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQ 60

Query: 61  RCARVLDDYNKERSDLPYDYEDSSMDDHGYRLPCNYEDKFNLSYNNEDNSNGSFEYNLSY 120
           RCARVLDDYNKERSDLPYDYEDSSMDDHGYRLPCNYEDKFNLSYNNEDNSNGSFEYNLSY
Sbjct: 61  RCARVLDDYNKERSDLPYDYEDSSMDDHGYRLPCNYEDKFNLSYNNEDNSNGSFEYNLSY 120

Query: 121 GNEPTSSPKERYIDPHLLTLPIVDRLNLEENADVKYPMNEPFVDSEFSLIGEANSXXXXX 180
           GNEPTSSPKERYIDPHLLTLPIVDRLNLEENADVKYPMNEPFVDSEFSLIGEANS     
Sbjct: 121 GNEPTSSPKERYIDPHLLTLPIVDRLNLEENADVKYPMNEPFVDSEFSLIGEANSTEAIA 180

Query: 181 XXXXXXXXXXXXXXXSTEPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVE 240
                          STEPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVE
Sbjct: 181 TTGTIENTGITEAIGSTEPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVE 240

Query: 241 RKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQKS 275
           RKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQKS
Sbjct: 241 RKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQKS 275

>Scas_627.17d
          Length = 275

 Score =  501 bits (1291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/275 (88%), Positives = 246/275 (89%)

Query: 1   MSQFPFSFGNQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQ 60
           MSQFPFSFGNQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQ
Sbjct: 1   MSQFPFSFGNQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQ 60

Query: 61  RCARVLDDYNKERSDLPYDYEDSSMDDHGYRLPCNYEDKFNLSYNNEDNSNGSFEYNLSY 120
           RCARVLDDYNKERSDLPY YEDSSMDDHGYRLPCNYEDKFNLSY+NEDNSNGSFE NLS 
Sbjct: 61  RCARVLDDYNKERSDLPYGYEDSSMDDHGYRLPCNYEDKFNLSYDNEDNSNGSFECNLSC 120

Query: 121 GNEPTSSPKERYIDPHLLTLPIVDRLNLEENADVKYPMNEPFVDSEFSLIGEANSXXXXX 180
           GNEPTSSPKERYIDP LLTLPIVDRLNLEE ADVKYPMNEP V+SEFSLIGEAN      
Sbjct: 121 GNEPTSSPKERYIDPRLLTLPIVDRLNLEEGADVKYPMNEPLVESEFSLIGEANFTEAIA 180

Query: 181 XXXXXXXXXXXXXXXSTEPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVE 240
                          STEPTQAAQPTEAL+INP FPCPHCQKTY TEAQQKKHLKDVHVE
Sbjct: 181 TTGTIENTGITEAIGSTEPTQAAQPTEALKINPGFPCPHCQKTYLTEAQQKKHLKDVHVE 240

Query: 241 RKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQKS 275
           RKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQKS
Sbjct: 241 RKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQKS 275

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           N  F C  C+K +R     K+H++ VH  ER   C+FC + F R D++ +H
Sbjct: 570 NKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQH 620

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           F C  C KT+R     K+H++ VH  ER   C FC + F R D++ +H
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQH 668

>Scas_649.28
          Length = 730

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           N  F C  C K +R     K+H++ VH  ER   C+FC + F R D++ +H
Sbjct: 670 NKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQH 720

>Scas_717.60d
          Length = 167

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 198 EPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF-CSRWFKRKD 256
           E   A    E L  N  F C  C K + T  + KKH KD H +R   C + C + FKRKD
Sbjct: 82  EGQSADSSCEILTSNELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKD 141

Query: 257 HMIKH 261
               H
Sbjct: 142 QRKSH 146

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           F C  C K +R     K+H++ VH  ER   C+FC + F R D++ +H
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQH 531

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F CP C + +  +   K+H      E+ ++C+FC R F R+D +++HQ+
Sbjct: 151 FLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQ 199

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268
           N  + C  CQ+ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 706 NKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 763

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 9/82 (10%)

Query: 196 STEPTQAAQPTEALRI--------NPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCL 246
           +  P +A  PT  +             + C  CQ+ + +     +H K VH  E+ H C 
Sbjct: 705 AGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP 764

Query: 247 FCSRWFKRKDHMIKHQEGGSPC 268
            C + FKR+DH+++H     PC
Sbjct: 765 KCGKKFKRRDHVLQHLNKKIPC 786

>Scas_703.23
          Length = 1341

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           F CP C + +  +   K+H +    E+  +C+FC R F R+D +++HQ
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQ 119

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKIPC 956

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 200 TQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHM 258
           T+  +P+  L  +  F C +C + ++ +   K+H++ +H+ E+ + C  C + F R D++
Sbjct: 403 TRGRKPSPILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNL 462

Query: 259 IKH 261
            +H
Sbjct: 463 SQH 465

>Scas_602.9
          Length = 547

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 200 TQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHM 258
           T+  +P+       +F C +C++ ++ +   K+H++ +H+ E+ + C  C++ F R D++
Sbjct: 480 TRGRKPSLLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNL 539

Query: 259 IKH 261
            +H
Sbjct: 540 TQH 542

>Kwal_56.23453
          Length = 828

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQ 273
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC     
Sbjct: 735 YVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPCTAEGG 794

Query: 274 KS 275
           +S
Sbjct: 795 QS 796

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268
           C  C + + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 830 CRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKKIPC 882

>Scas_681.19
          Length = 864

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268
           + C  C++ + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 765 YVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 819

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 200 TQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHM 258
           T+  +P+ AL     F C +C++ ++ +   K+H++ +H+ E+ + C  C + F R D++
Sbjct: 445 TRGRKPSPALDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNL 504

Query: 259 IKH 261
            +H
Sbjct: 505 NQH 507

>Scas_709.32
          Length = 822

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           N  F C  C K +R     K+H++ VH  ER   C  C + F R D++ +H
Sbjct: 762 NKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQH 812

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F CP C + +  +   K+H +    E+  +C FC R F R+D +++HQ+
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQ 128

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F CP C + +  +   K+H +    E+  +C FC R F R+D +++HQ+
Sbjct: 48  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQ 96

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQEGGSPC 268
           C  C + + +     +H K VH  E+ H C  C + FKR+DH+++H     PC
Sbjct: 757 CQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIPC 809

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F CP C + +  +   ++H +    E+  +C FC R F R+D +++HQ+
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQ 131

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 200 TQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHM 258
           T+  +P+  L  + +F C  C + ++ +   K+H++ +H+ E+ + C  C + F R D++
Sbjct: 339 TRGRKPSPILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNL 398

Query: 259 IKH 261
            +H
Sbjct: 399 NQH 401

>Kwal_26.8351
          Length = 698

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           F C  C K +R     K+H++ VH  ER   C +C + F R D++ +H
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQH 688

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           CP C + +      K+H +    E+  +C+FC R F R+D +++HQ
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQ 80

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 11/49 (22%)

Query: 216 PCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQEG 264
           P P   +T +T+             R H+C  C+R F R +H+ +HQ  
Sbjct: 17  PIPKKSRTIKTDK-----------PRPHLCPICTRGFVRLEHLKRHQRA 54

>Scas_719.68
          Length = 1350

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           F CP C +T   +  Q+ H +    E+  +C+FC R F R+D ++++Q
Sbjct: 41  FLCPICTRTEHLKRHQRSHTR----EKPFVCVFCGRCFARRDLVLRYQ 84

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQ 262
           + CP CQ+ +     Q +H++    ER H C F  CS+ F R D + +H+
Sbjct: 26  YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR 75

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKHQEGGSPCK 269
           F C  C   + +     +H   VH  E+ + C  CS+ FKRKDH+ +H +  +PC+
Sbjct: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKTPCR 617

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           F C  C K +R     K+H++ VH  +R   C +C + F R D++ +H
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQH 551

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 200 TQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHM 258
           T+  +P+    ++ +F C  C + ++ +   K+H++ +H+ E+ + C  C++ F R D++
Sbjct: 249 TRGRKPSLVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNL 308

Query: 259 IKH 261
            +H
Sbjct: 309 NQH 311

>Kwal_47.17241
          Length = 403

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 200 TQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHM 258
           T+  +P+  L  + +F C  C + ++ +   K+H++ +H+ E+   C  C + F R D++
Sbjct: 331 TRGRKPSPILDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNL 390

Query: 259 IKH 261
            +H
Sbjct: 391 NQH 393

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 196 STEPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKR 254
           S + T+  +P+     + +F C  C + ++ +   K+H++ +H+ E+   C  C++ F R
Sbjct: 370 SMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSR 429

Query: 255 KDHMIKH 261
            D++ +H
Sbjct: 430 SDNLNQH 436

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           F C  C + +  +   K+H +    E+  +C+FC R F R+D +++HQ
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQ 108

>Kwal_47.16621
          Length = 1178

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F C  C + +  +   K+H +    E+  +C FC R F R+D +++HQ+
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQ 126

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F CP C + +  +   K+H      E+  +CL C + F RKD +++H +
Sbjct: 27  FLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQ 75

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 241 RKHMCLFCSRWFKRKDHMIKHQ 262
           R  +C  CSR F R++H+ +HQ
Sbjct: 25  RPFLCPICSRGFVRQEHLKRHQ 46

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 211 INPEFPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKD----HMIKHQEGG 265
           I+  F C  C K ++     K+H++ VH  +R   C  C + F R D    H+  H++ G
Sbjct: 531 IDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIKTHKKSG 590

Query: 266 S 266
           S
Sbjct: 591 S 591

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKH 261
           F C  C K+++     K+H++ VH  ER   C  C + F R D++ +H
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQH 694

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 205 PTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           P+  LR    F C  C + +  +   K+H +    E+ + C  C+R F R+D +I+H +
Sbjct: 97  PSGKLR---SFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQ 152

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           F C HC + +     +K+H++    E+ H C F  C + F R D + +H
Sbjct: 17  FKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRH 65

>Kwal_14.2278
          Length = 463

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQE 263
           CP C + +     Q +H++    E+ H C F  C++ F R D + +H+ 
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKR 73

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMCLFCSRWFKRKDHMIKHQ 262
           F C  C++ ++ +   K+H+  +H+ ER + C  C + F R D++ +H+
Sbjct: 218 FKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHK 266

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           CP C + +     Q +H++    E+ H C F  C + F R D + +H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRH 82

>Kwal_27.11824
          Length = 199

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 12/54 (22%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHM------CLFCSRWFKRKDHMIKH 261
           +FPC  C+  +R  +  ++H      ER H+      C  C + F RKD + +H
Sbjct: 118 KFPCAKCELVFRRSSDLRRH------ERAHLPILPNICSLCGKGFARKDALKRH 165

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 12/54 (22%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHM------CLFCSRWFKRKDHMIKH 261
            FPC  C   +R  +  ++H      ER+H+      C  C + F RKD + +H
Sbjct: 203 RFPCEKCHMVFRRSSDLRRH------ERQHLPILPNICTLCGKGFARKDALKRH 250

>Scas_717.17
          Length = 525

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           N  + C  C K ++  +  K+HL     ER + C +C    KR+D++++H +
Sbjct: 385 NAVYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMK 436

>Scas_575.3
          Length = 455

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQE 263
           CP CQ+ +     Q +H++    E+ H C F  C + F R D + +H+ 
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKR 118

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 19/41 (46%)

Query: 221 QKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           Q T +    + +  KD    R H+C  C R F R +H  +H
Sbjct: 46  QTTVKKPRPRSRANKDGDAPRPHVCPICQRAFHRLEHQTRH 86

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 35.8 bits (81), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 202 AAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVE-RKHMCLFCSRWFKRKDHMIK 260
           +  P E +     F C  C+  +R     ++H K VH+    ++C  C + F RKD + +
Sbjct: 134 SGGPEETVNDGKRFHCTKCELVFRRSGDLRRHEK-VHLPILPNICSLCGKGFARKDALKR 192

Query: 261 HQEGGSPCKGANQK 274
           H  G   CK   QK
Sbjct: 193 HF-GTLTCKRNRQK 205

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 218 PHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           P CQK +       +H K  H+E+ + C  C + F  +D ++KHQE
Sbjct: 728 PGCQKAFVRNHDLLRH-KKSHLEKGYSCAGCGKKFHSEDSLVKHQE 772

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           + C  C+K +R ++  K+HL      +K  C +CS   KRKD++++H
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           C  C+K+++ ++  K+HL     +R  +C +C    KRKD++++H +
Sbjct: 348 CQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMK 394

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 35.8 bits (81), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHM---IKHQEGGSPCK 269
           F CPHC K + TE   ++H++    ER   C +C++ F     +   I+   G  P K
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLK 715

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 22/47 (46%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           F C +C K + T +  + H++    E+   C  C + F    ++ KH
Sbjct: 686 FKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKH 732

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 35.4 bits (80), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQ 262
           CP C + +     Q +H++    E+ H C F  C + F R D + +H+
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHR 92

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 11/75 (14%)

Query: 203 AQPTEALRINPE--------FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKR 254
           AQ  E LR+N          F C  C + +  +    +H +    E+ ++C  C R F R
Sbjct: 29  AQLPENLRLNGVTPSGKPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSR 88

Query: 255 KDHMIKHQ---EGGS 266
           +D +++H     GGS
Sbjct: 89  RDLLLRHAHKLHGGS 103

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQE 263
           CP C + +     Q +H++    E+ H C F  C + F R+D + +H+ 
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRR 72

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           F C  C + +  +    +H +    E+ ++C  C R F R+D +I+H
Sbjct: 125 FVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRH 171

>Scas_568.5
          Length = 199

 Score = 34.3 bits (77), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 25/50 (50%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           N  +PC  C+  +   +  ++H K   +   H+C  C + F RKD + +H
Sbjct: 115 NKRYPCSKCELIFLRSSDLRRHEKAHLLVLPHICSQCGKGFARKDALKRH 164

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQE 263
           CP C + +     Q +H++    E+ H C F  C + F R D + +H+ 
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRR 88

>Scas_687.33
          Length = 288

 Score = 34.3 bits (77), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           F CP C + +     +K+H++    E+ H C F  C + F R D + +H
Sbjct: 17  FRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRH 65

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 34.3 bits (77), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 215 FP--CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           FP  C  C K ++ ++  K+HL     +R  +C +C+   KR+D++++H +
Sbjct: 532 FPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMK 582

>Scas_670.2
          Length = 435

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 217 CPHCQKTYRTEAQQKK-HLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           CP C   Y      K  HL  V  +R H C  C R F R + +I+HQ+
Sbjct: 254 CPICSGYYANLTTHKATHL--VPEDRPHKCPICQRGFGRNNDLIRHQK 299

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 210 RINP-EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           R NP  F C  C K +      K HL+    ER  +C  C + F R+    +H++
Sbjct: 563 RKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHED 617

>Scas_378.1
          Length = 208

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           + C  C K++R  +  K+HL     +R + C  C    KRKD++++H
Sbjct: 84  YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQH 130

>Scas_712.42*
          Length = 290

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           F C  C + +     +K+H++    E+ H C F  C + F R D + +H
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRH 66

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 23/47 (48%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           F C  C + +  +    +H +    E+ + C  C R F R+D +++H
Sbjct: 30  FVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 16/81 (19%)

Query: 199 PTQAAQPTEALRINPEFPCPH--CQKTYRTEAQQKKHLKDVHVERKHMCLF--------C 248
           P  ++ P E  R      CPH  C KT+  +    +H  +   +  ++C +        C
Sbjct: 21  PNSSSSPAERFR------CPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPC 74

Query: 249 SRWFKRKDHMIKHQEGGSPCK 269
           ++ F RKD +I+H++  S  K
Sbjct: 75  NKTFVRKDLLIRHEKRHSKVK 95

>Scas_627.6
          Length = 1207

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 10/71 (14%)

Query: 203 AQPTEALRINPEFPCPH--CQKTYRTEAQQKKHLKDVHVERKHMCLF--------CSRWF 252
            Q +  L +   + CPH  C K++  +    +H  +   +   +C F        C++ F
Sbjct: 30  VQKSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTF 89

Query: 253 KRKDHMIKHQE 263
            RKD +I+HQ+
Sbjct: 90  VRKDLLIRHQK 100

>Kwal_26.8011
          Length = 190

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 201 QAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHM 258
           Q AQP     ++P++ C  C K +   +  + HL      R   C F  CS+ F  K +M
Sbjct: 118 QHAQPA----VHPKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNM 173

Query: 259 IKH 261
           ++H
Sbjct: 174 VRH 176

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 212 NPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           N  F C  C + +     +K+HL+    E+ H C F  C + F R D + +H
Sbjct: 14  NRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRH 65

>Scas_721.92
          Length = 1152

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/49 (22%), Positives = 25/49 (51%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F C  C + +  +    +H +    E+ + C  C++ F R+D +++H +
Sbjct: 78  FVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQ 126

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 32.0 bits (71), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 12/72 (16%)

Query: 196 STEPTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHM------CLFCS 249
           S+    + +  + L  + ++ C  C+  +R  +  ++H      ER H+      C  C 
Sbjct: 106 SSTEADSVEDVQQLNEDKKYQCDKCELVFRRSSDLRRH------ERAHLPILPNICSLCG 159

Query: 250 RWFKRKDHMIKH 261
           + F RKD + +H
Sbjct: 160 KGFARKDALKRH 171

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 31.6 bits (70), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           + C  CQ  +   +  ++H K   +   H+C  C + F RKD + +H
Sbjct: 95  YSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRH 141

>Kwal_47.17888
          Length = 786

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 23/48 (47%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           F C +C K +      + H++    E+ + C  C R F RK ++  H+
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAHR 578

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 217 CPHCQKTYRTEAQQKK-HLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           CP C K +   +  K  HL     +R H C+ C   F R + +I+H++
Sbjct: 326 CPICHKYFANLSTHKSTHLTSQ--DRPHKCIICQSGFARNNDLIRHRK 371

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           CPHC KT+ T+    +H++    ER   C +C + F     +  H
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVH 590

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKR 254
             C  C K +   +   KH+K +H ERK+MC  C R F R
Sbjct: 600 LSCTVCGKRFNESSNLSKHMK-IH-ERKYMCKLCKRSFDR 637

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 24/49 (48%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F C +C+K + T +  + H++    E+   C  C + F    ++ KH +
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMK 620

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 31.6 bits (70), Expect = 0.77,   Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 237 VHVERKHMCLFCSRWFKRKDHMIKHQEGGSPCK 269
           V  +RK++C FC++ F R +H  +H+   +  K
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVK 34

>CAGL0K04257g complement(391287..392930) some similarities with
           sp|P32338 Saccharomyces cerevisiae YGR044c, hypothetical
           start
          Length = 547

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF 247
           + C HC  T+    +   HL +  VERKH C F
Sbjct: 406 YRCAHCPSTFNNIFEYASHLDEYEVERKHKCPF 438

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 22/48 (45%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           F C  C K +      + H++    E+ + C  C R F RK ++  H+
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAHK 598

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 12/54 (22%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHM------CLFCSRWFKRKDHMIKH 261
           +F CP+C K +     Q  HL +VHV R H+      C FC + F +  ++  H
Sbjct: 522 QFQCPYCHKYF----TQSTHL-EVHV-RSHIGYKPFSCEFCGKRFTQGGNLRTH 569

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 31.6 bits (70), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 222 KTYRTEAQQKKHL-------KDVHVERKHMCLFCSRWFKRKDHMIKH 261
           ++ +++ QQKKH         D+ + RK++C  C + F    H+ +H
Sbjct: 374 QSRKSKLQQKKHSISSLCNSDDIELRRKYLCKVCGKGFTTSGHLARH 420

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           ++ C  C K + T     +H +    E++H+C +  C + F R D+ ++H
Sbjct: 401 KYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQH 450

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERK-HMCLF--CSRWFKRKDHMIKH 261
           CP C K++R  +  K H   +HV R  + C +  CS+ F  K ++++H
Sbjct: 220 CPECGKSFRRPSALKTH-SIIHVGRSPYACTWNGCSKRFNVKGNLLRH 266

>Scas_707.31
          Length = 289

 Score = 31.2 bits (69), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVE-RKHMCLFCSRWFKRKDHMIKH 261
           C  C+K ++     K+H + +H+  R   C  C + F R D++ +H
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQH 270

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 31.2 bits (69), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 217 CPHCQKTYRTEAQQKK-HLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           CP C   Y   +  K  HL     +R H C  CSR F R + +++H++
Sbjct: 163 CPVCHNFYANLSTHKSTHLTPE--DRPHKCSVCSRGFARSNDLLRHKK 208

>Scas_569.2
          Length = 293

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 21/33 (63%)

Query: 229 QQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           +++KH +++   RK++C  CS+ F    H+ +H
Sbjct: 214 KKRKHEEELEKRRKYICKVCSKGFTTSGHLARH 246

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           ++ C  C K + T     +H +    E+KH C +  C   F R D+ ++H
Sbjct: 227 KYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>Scas_720.33
          Length = 316

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 23/44 (52%)

Query: 220 CQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           C  T+  E    +H++    E+   C  C R+F R D++ +H++
Sbjct: 23  CHMTFTREEHLARHIRKHTGEKPFQCYICFRFFSRMDNLKQHRD 66

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           C  C+K ++ ++  K+HL      + + C +C    KRKD++ +H
Sbjct: 187 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 231

>Kwal_47.19045
          Length = 266

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           F C  C K +     +++H++    E+ H C F  C + F R D + +H
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRH 62

>Scas_683.30
          Length = 478

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHV---ERKHMCLFCSRWFKRKDHMIKHQE 263
           CP C   Y   A    H K  H+   +R H C  C R F R + +I+H++
Sbjct: 289 CPTCLNYY---ANLSTH-KSTHLTPEDRPHKCPICERGFARNNDLIRHKK 334

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
           ++ C  C + + T     +H +    E++H C F  C++ F R D+ I+H
Sbjct: 283 KYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332

>Kwal_26.8021
          Length = 507

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 24/45 (53%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           C  C K+++  +  K+HL      + + C +C    KR+D++ +H
Sbjct: 391 CSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQH 435

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 22/47 (46%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           F C +C K +      + H++    ER + C  C + F RK ++  H
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAH 561

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQE 263
           F C  C + +     +K+H +    E+ H C F  C + F R D + +H  
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSR 70

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKH 261
           +PC  C  +Y      +KH +  H  +++++C+ C + F RKD + +H
Sbjct: 120 YPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRH 167

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 24/44 (54%)

Query: 220 CQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           C +++       +H++    E+   C  C+R+F R D++ +H+E
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQCEVCNRFFSRIDNLKQHRE 71

>Scas_695.2
          Length = 571

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           + C  C KT+      K HL+    E   +C  C + F R+    +H++
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVCNICGKAFARQHDRKRHED 500

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 10/63 (15%)

Query: 210 RINPEFPCPH--CQKTYRTEAQQKKHLKDVHVERKHMC--------LFCSRWFKRKDHMI 259
           ++   + CPH  C+KT+      ++H  +   ++   C        + C+R F RKD ++
Sbjct: 13  KVGGRYVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLV 72

Query: 260 KHQ 262
           +HQ
Sbjct: 73  RHQ 75

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           + C  C K +      K HL+    ER ++C  C + F R     +H++
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHED 517

>Scas_683.25
          Length = 879

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/30 (30%), Positives = 19/30 (63%)

Query: 240 ERKHMCLFCSRWFKRKDHMIKHQEGGSPCK 269
           +++ +C FC++ F R +H I+H+   +  K
Sbjct: 12  QKRFICSFCAKGFSRAEHKIRHERSHTGLK 41

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 23/50 (46%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           ++ C  C K +      K HL+    E+ + C  C + F R+    +H++
Sbjct: 520 DYVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFARQHDKKRHED 569

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKD----HMIKHQE 263
           F C +C K +      + H +    E+ + C  C + F RK     H++ HQ+
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQK 673

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 206 TEALRINPE---FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           T+ LR++     F C  C K+Y T +  + H++    E+   C  C++ F    ++ KH
Sbjct: 708 TQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKH 766

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 217 CPHCQKTYRTEAQQKK-HLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           CP C   Y   +  K  HL     +R H C  C R F R + +I+H++
Sbjct: 279 CPICHNFYANLSTHKSTHLTPE--DRPHKCPICQRGFARNNDLIRHKK 324

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 17/29 (58%)

Query: 241 RKHMCLFCSRWFKRKDHMIKHQEGGSPCK 269
           ++H C FC++ F R +H  +H+   +  K
Sbjct: 10  KRHFCSFCNKAFSRSEHKTRHERSHAGVK 38

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF 247
           EF C +C  T+R      +H+K   +E+ + C F
Sbjct: 159 EFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPF 192

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 237 VHVERKHMCLFCSRWFKRKDHMIKHQEGGSPCK 269
           V  +RK++C FC++ F R +H  +H+   +  K
Sbjct: 2   VASQRKYICSFCAKPFSRSEHKARHERSHTGSK 34

>Kwal_56.23925
          Length = 745

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 215 FPC--PHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQE 263
           F C  P C KT+R     + H++    +R + C F  C + F R   +I+H++
Sbjct: 585 FECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKK 637

>Kwal_27.11460
          Length = 531

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 21/49 (42%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           + C  C K +      K HL+    ER   C  C + F R+    +H++
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHED 461

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 240 ERKHMCLFCSRWFKRKDHMIKHQEGGSPCK 269
           ++K++C FC + F R +H I+H+   +  K
Sbjct: 5   QKKYICSFCLKPFSRSEHKIRHERSHAGVK 34

>KLLA0A02629g complement(233822..235501) some similarities with
           sp|P32338 Saccharomyces cerevisiae YGR044c RME1
           zinc-finger transcription factor singleton, hypothetical
           start
          Length = 559

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF 247
           + C HC + + T  +  KH+ +  VERK+ C F
Sbjct: 413 YKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPF 445

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 207 EALRINPE-FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           ++L+ NP  + C  C K +      K HL+    ER   C  C + F R+    +H++
Sbjct: 417 KSLQKNPAIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHED 474

>Scas_660.12
          Length = 367

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 20/36 (55%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCS 249
           E+ C +CQ  +R +    +H+K   VE+ + C F S
Sbjct: 95  EYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFS 130

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 22/47 (46%)

Query: 218 PHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQEG 264
           P C  ++       +H++    E+   C  C ++F R D++ +HQ  
Sbjct: 25  PDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSS 71

>YDL030W (PRP9) [832] chr4 (397534..399126) Pre-mRNA splicing factor
           (snRNA-associated protein), required for addition of U2
           snRNA to prespliceosomes, has two C2H2-type zinc fingers
           [1593 bp, 530 aa]
          Length = 530

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 13/62 (20%)

Query: 203 AQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           A   E L I  +F   +C+ + R+EA      K ++      C FCSRWFK       H 
Sbjct: 253 AAAVENL-IKSDFEHSYCRGSLRSEA------KGIY------CPFCSRWFKTSSVFESHL 299

Query: 263 EG 264
            G
Sbjct: 300 VG 301

>Scas_718.44
          Length = 266

 Score = 28.5 bits (62), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 7/41 (17%)

Query: 241 RKHMCLFCSRWFKRKDHMIKH-------QEGGSPCKGANQK 274
           RKH+C  CS  F    H+ +H       +    P +G NQK
Sbjct: 208 RKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQK 248

>Scas_500.4
          Length = 573

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 29  LDQLDEDL-IYLRDCQKKSNTHPFQ-EQDDDMYQRCARVLDDYNKERSDLP 77
           L  +D D+ I+L+D         ++ E DD+M+    RV+D     RSD P
Sbjct: 283 LKSMDSDIDIHLKDVHNDKILEIYKGELDDEMFACIMRVMDSRISSRSDFP 333

>Kwal_14.2543
          Length = 711

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 200 TQAAQPTEALRINPEFP---CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKD 256
           TQ  +    LR++  +    C HC KT+ T+   ++H++    E+ + C  C + F    
Sbjct: 588 TQRQKLLRHLRVHTRYKPCKCVHCLKTFSTQDILQQHMRTHSGEKPYKCSHCGKGFATSS 647

Query: 257 HMIKH 261
            +  H
Sbjct: 648 SLRIH 652

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/47 (25%), Positives = 22/47 (46%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKH 261
           + C HC K + T +  + H++    E+   C  C + F    ++ KH
Sbjct: 634 YKCSHCGKGFATSSSLRIHIRTHTGEKPLECKVCGKRFNESSNLSKH 680

>Scas_697.35
          Length = 839

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/46 (19%), Positives = 22/46 (47%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQ 262
           CP+C + +      + H++     + + C +C + F +  ++  HQ
Sbjct: 517 CPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQ 562

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 4/51 (7%)

Query: 217 CPHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKD----HMIKHQE 263
           C +C K +      + H +    E+ + C  C + F RK     H++ HQ+
Sbjct: 545 CGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHLLTHQK 595

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 215 FPC--PHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKHQ 262
           F C  P+C K ++     + H++    +R + C F  C++ F R   +I+H+
Sbjct: 603 FECLYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHK 654

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 236 DVHVERKHMCLFCSRWFKRKDHMIKH 261
           D+   RK++C  C+R F    H+ +H
Sbjct: 167 DLEQRRKYICKICARGFTTSGHLARH 192

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 220 CQKTYRTEAQQKKHLKDVHVER---KHMCLF--CSRWFKRKDHMIKH 261
           C K++ +  +   HL+ VH+ R   ++ CL+  C R F ++  +I+H
Sbjct: 712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRH 758

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 28.5 bits (62), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 215 FPC---PHCQKTYRTEAQQKKHLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           F C   P C+ ++       +H++    E+   C  C ++F R D++ +H++
Sbjct: 25  FKCTGYPGCEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKD 76

>Scas_713.22
          Length = 518

 Score = 28.1 bits (61), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 223 TYRTEAQQKKHLKD--VHVERKHMCLFCSRWFKRKDHMIKHQEGGSPCKGANQK 274
           T + E+Q  +++K+   H  +   C  C++WFK +   + H  G +  K   Q+
Sbjct: 255 TSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKNHIKNEKQR 308

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261
            + C  C + + T     +H +    E+ H+C F  C + F R D+ ++H
Sbjct: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 217 CPHCQKTYRTEAQQKK-HLKDVHVERKHMCLFCSRWFKRKDHMIKHQE 263
           CP C+  Y      K  HL     +R H C  C R F R + +++H++
Sbjct: 144 CPICRNFYANLTTHKATHLTPE--DRPHKCPICHRGFARNNDLLRHKK 189

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 12/54 (22%)

Query: 215 FPCPHCQKTYRTEAQQKKHLKDVHVERKHM------CLFCSRWFKRKDHMIKHQ 262
           + C +C K +     Q  HL DVH+ + HM      C FC + F +  ++  H+
Sbjct: 480 YQCAYCSKMF----SQSTHL-DVHI-KAHMGYKPFECEFCGKRFTQAGNLRTHR 527

>YJR054W (YJR054W) [2948] chr10 (535970..537463) Protein of unknown
           function [1494 bp, 497 aa]
          Length = 497

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 16/78 (20%)

Query: 10  NQEMFSPLDEYLIDTVSEKLDQLDEDLIYLRDCQKKSNTHPFQEQDDDMYQRC---ARVL 66
           N + +S L EY+  TVSE +D+L E        Q+K      +E DD +Y+     ++  
Sbjct: 248 NDQEYSGLREYICVTVSENVDELVER-------QRK------KENDDTIYKTGLLESQTF 294

Query: 67  DDYNKERSDLPYDYEDSS 84
           DD+ +  + +   + D+S
Sbjct: 295 DDFKEVENKIETSFNDTS 312

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,082,641
Number of extensions: 492301
Number of successful extensions: 1856
Number of sequences better than 10.0: 191
Number of HSP's gapped: 1793
Number of HSP's successfully gapped: 211
Length of query: 275
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 175
Effective length of database: 13,134,309
Effective search space: 2298504075
Effective search space used: 2298504075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 61 (28.1 bits)