Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.1460860832390.0
YDR091C60860929200.0
CAGL0G08041g60760829010.0
KLLA0C17556g60760828210.0
AGR125W60760827920.0
Kwal_56.2342953954024920.0
YPL226W (NEW1)11963281481e-09
Kwal_0.16710441921444e-09
YNL014W (HEF3)10443061418e-09
CAGL0B03487g10453071419e-09
AFL131W11893191363e-08
Sklu_2442.2010441991363e-08
Scas_720.3611903311354e-08
Scas_703.1710461961346e-08
Scas_716.8115651991338e-08
KLLA0C16115g11833311339e-08
Sklu_2403.511793281311e-07
KLLA0F12210g10441851274e-07
CAGL0D03674g11863151274e-07
Scas_288.14942491255e-07
CAGL0M13739g7272161265e-07
Scas_618.37931901265e-07
AAL028W10441851265e-07
Sklu_2187.27521881257e-07
CAGL0K00363g12271751249e-07
Kwal_27.1271112462061241e-06
AEL032W7531881231e-06
Scas_712.296101891212e-06
Kwal_0.32710191821212e-06
CAGL0I08019g12852351212e-06
YLR249W (YEF3)10441941193e-06
Kwal_33.1556112971851193e-06
KLLA0D03432g14832151194e-06
CAGL0C02343g6101881176e-06
YOL075C12941791176e-06
Sklu_2152.56081921167e-06
YKL209C (STE6)12901831177e-06
Scas_566.14662221158e-06
YFR009W (GCN20)7521811168e-06
Kwal_34.162407521881151e-05
KLLA0A10857g7521931132e-05
Kwal_33.156235621991132e-05
KLLA0D04554g10223001132e-05
KLLA0A01452g6071891113e-05
YMR301C (ATM1)6901881113e-05
AGR047W14921851104e-05
YER036C6101891104e-05
ABR125C14881871105e-05
Scas_695.2412881731096e-05
CAGL0K10472g7521811096e-05
YDR011W (SNQ2)15012131096e-05
Scas_710.506021831087e-05
AER190W10111561087e-05
AFR432W12842121087e-05
Kwal_47.191166071661061e-04
CAGL0I04862g15072151061e-04
Scas_108.13351311032e-04
AFR232C6071881033e-04
KLLA0C04477g12532121033e-04
Kwal_26.94807191261023e-04
Scas_573.11689731023e-04
Kwal_56.2384414942391024e-04
Sklu_2316.113101901024e-04
AFR683C6772011005e-04
Scas_40.1203161966e-04
KLLA0A10131g7201761006e-04
Scas_574.87022491006e-04
Kwal_14.2052523230980.001
AGL335W691214980.001
KLLA0C01991g706204970.002
KLLA0F08833g273221940.002
AGL142C1497197960.002
YCR011C (ADP1)1049247960.002
KLLA0D02156g52184950.002
Kwal_23.51611489169950.003
Scas_628.131060185940.003
CAGL0L07744g1055181940.003
CAGL0M07293g1515192940.003
CAGL0E00385g608210930.004
KLLA0C14234g1454253940.004
ABR126W1512213930.004
YLR188W (MDL1)695227930.004
Kwal_56.227471538219910.008
KLLA0F20075g1516180900.011
KLLA0D03476g1560198900.011
YPL058C (PDR12)1511194890.013
KLLA0B09702g1518223890.015
KLLA0A00286g128053880.016
CAGL0E03355g1535180880.017
KLLA0D00748g789200880.017
Scas_567.1810182880.018
CAGL0M01760g1499165870.023
KLLA0D04059g1568208870.026
Scas_468.169177860.028
KLLA0B14256g1271116860.034
CAGL0L06402g1535164850.039
Scas_711.39122776850.040
Kwal_14.2435124780840.048
YOR011W (AUS1)139474840.053
Kwal_27.96661474193840.056
ACR022W754198830.059
Scas_587.8715186830.060
Sklu_2343.3774287830.065
Scas_643.11289180830.065
Scas_714.421520165830.074
KLLA0F21692g1525221820.11
Kwal_56.2232977673810.12
YJL074C (SMC3)123053810.13
KLLA0E00462g1650218810.13
Kwal_27.1114732360790.14
Scas_472.1*39389790.14
AAL182W123180800.17
Scas_693.421512242790.20
YDR406W (PDR15)1529197790.22
YNR070W133383790.22
Scas_717.6*140044790.23
CAGL0F01419g1398171790.23
Scas_612.11*1506197780.26
YOR328W (PDR10)1564209780.31
CAGL0G05093g54472770.31
CAGL0H02805g121953770.32
YIL013C (PDR11)1411173770.36
CAGL0C03289g1648203770.39
Scas_455.1925199760.42
CAGL0F02717g1542197760.43
KLLA0E19074g326115750.44
YPL270W (MDL2)77364760.48
Scas_716.82675160750.51
YGR281W (YOR1)1477172760.53
Scas_627.1853368750.54
Scas_707.829432740.58
YGL091C (NBP35)328111730.68
YLL015W (BPT1)1559169750.69
Scas_622.91657197750.70
Scas_586.31531159740.73
YOR153W (PDR5)1511165740.83
YDR135C (YCF1)1515131740.86
CAGL0A01133g80164730.89
Kwal_34.1595671488730.92
ACL072C1627110731.1
Sklu_2062.2328133721.2
Scas_552.4720199721.3
CAGL0D00946g416115711.5
YLR106C (MDN1)491045721.5
AGL346W1400138711.7
CAGL0E03982g165981711.8
Kwal_14.124226920701.8
Sklu_1870.326520701.8
AFR152C27020692.1
YFL028C (CAF16)28920692.2
Scas_167.1*279160682.6
Kwal_34.157701436229702.7
KLLA0F14575g85184693.0
YHR074W (QNS1)71488693.0
CAGL0K12474g29420683.1
CAGL0G00242g147774684.5
YKR104W (NFT1)306239665.0
Kwal_26.670261784675.4
Scas_720.733261656.7
AER091W80137666.7
Kwal_23.404576172667.3
Kwal_33.1330870673667.4
CAGL0H03091g33443649.0
Kwal_56.23638492244659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.14
         (608 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.14                                                          1252   0.0  
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...  1129   0.0  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...  1122   0.0  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...  1091   0.0  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...  1080   0.0  
Kwal_56.23429                                                         964   0.0  
YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the non-t...    62   1e-09
Kwal_0.167                                                             60   4e-09
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    59   8e-09
CAGL0B03487g complement(345399..348536) highly similar to sp|P16...    59   9e-09
AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH] complement(...    57   3e-08
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      57   3e-08
Scas_720.36                                                            57   4e-08
Scas_703.17                                                            56   6e-08
Scas_716.81                                                            56   8e-08
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    56   9e-08
Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement       55   1e-07
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    54   4e-07
CAGL0D03674g 370066..373626 highly similar to tr|Q08972 Saccharo...    54   4e-07
Scas_288.1                                                             53   5e-07
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    53   5e-07
Scas_618.3                                                             53   5e-07
AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W (H...    53   5e-07
Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement         53   7e-07
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    52   9e-07
Kwal_27.12711                                                          52   1e-06
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    52   1e-06
Scas_712.29                                                            51   2e-06
Kwal_0.327                                                             51   2e-06
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    51   2e-06
YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongat...    50   3e-06
Kwal_33.15561                                                          50   3e-06
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    50   4e-06
CAGL0C02343g 236840..238672 highly similar to sp|P40024 Saccharo...    50   6e-06
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...    50   6e-06
Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement         49   7e-06
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    50   7e-06
Scas_566.1                                                             49   8e-06
YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a prot...    49   8e-06
Kwal_34.16240                                                          49   1e-05
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    48   2e-05
Kwal_33.15623                                                          48   2e-05
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    48   2e-05
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    47   3e-05
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    47   3e-05
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    47   4e-05
YER036C (YER036C) [1461] chr5 complement(223366..225198) Member ...    47   4e-05
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...    47   5e-05
Scas_695.24                                                            47   6e-05
CAGL0K10472g 1020016..1022274 highly similar to sp|P43535 Saccha...    47   6e-05
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...    47   6e-05
Scas_710.50                                                            46   7e-05
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...    46   7e-05
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    46   7e-05
Kwal_47.19116                                                          45   1e-04
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    45   1e-04
Scas_108.1                                                             44   2e-04
AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH] (859615..8...    44   3e-04
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...    44   3e-04
Kwal_26.9480                                                           44   3e-04
Scas_573.11                                                            44   3e-04
Kwal_56.23844                                                          44   4e-04
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           44   4e-04
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    43   5e-04
Scas_40.1                                                              42   6e-04
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    43   6e-04
Scas_574.8                                                             43   6e-04
Kwal_14.2052                                                           42   0.001
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    42   0.001
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    42   0.002
KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces c...    41   0.002
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    42   0.002
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    42   0.002
KLLA0D02156g complement(184520..186085) similar to sgd|S0002468 ...    41   0.002
Kwal_23.5161                                                           41   0.003
Scas_628.13                                                            41   0.003
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...    41   0.003
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    41   0.003
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    40   0.004
KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces...    41   0.004
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...    40   0.004
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    40   0.004
Kwal_56.22747                                                          40   0.008
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    39   0.011
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...    39   0.011
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    39   0.013
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...    39   0.015
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...    39   0.016
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    39   0.017
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    39   0.017
Scas_567.1                                                             39   0.018
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...    38   0.023
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    38   0.026
Scas_468.1                                                             38   0.028
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    38   0.034
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    37   0.039
Scas_711.39                                                            37   0.040
Kwal_14.2435                                                           37   0.048
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    37   0.053
Kwal_27.9666                                                           37   0.056
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    37   0.059
Scas_587.8                                                             37   0.060
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            37   0.065
Scas_643.1                                                             37   0.065
Scas_714.42                                                            37   0.074
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    36   0.11 
Kwal_56.22329                                                          36   0.12 
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...    36   0.13 
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    36   0.13 
Kwal_27.11147                                                          35   0.14 
Scas_472.1*                                                            35   0.14 
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...    35   0.17 
Scas_693.42                                                            35   0.20 
YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-bin...    35   0.22 
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...    35   0.22 
Scas_717.6*                                                            35   0.23 
CAGL0F01419g complement(142623..146819) highly similar to tr|Q08...    35   0.23 
Scas_612.11*                                                           35   0.26 
YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-bind...    35   0.31 
CAGL0G05093g complement(483230..484864) similar to sp|Q12298 Sac...    34   0.31 
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...    34   0.32 
YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane ...    34   0.36 
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    34   0.39 
Scas_455.1                                                             34   0.42 
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...    34   0.43 
KLLA0E19074g complement(1691643..1692623) highly similar to sp|P...    33   0.44 
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    34   0.48 
Scas_716.82                                                            33   0.51 
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    34   0.53 
Scas_627.18                                                            33   0.54 
Scas_707.8                                                             33   0.58 
YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative ...    33   0.68 
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    33   0.69 
Scas_622.9                                                             33   0.70 
Scas_586.3                                                             33   0.73 
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...    33   0.83 
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    33   0.86 
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    33   0.89 
Kwal_34.15956                                                          33   0.92 
ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - ...    33   1.1  
Sklu_2062.2 YGL091C, Contig c2062 3197-4183                            32   1.2  
Scas_552.4                                                             32   1.3  
CAGL0D00946g complement(114552..115802) similar to tr|Q0670 Sacc...    32   1.5  
YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear p...    32   1.5  
AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH] complement(...    32   1.7  
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    32   1.8  
Kwal_14.1242                                                           32   1.8  
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            32   1.8  
AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH] (710017..7...    31   2.1  
YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein tha...    31   2.2  
Scas_167.1*                                                            31   2.6  
Kwal_34.15770                                                          32   2.7  
KLLA0F14575g complement(1351796..1354351) some similarities with...    31   3.0  
YHR074W (QNS1) [2363] chr8 (246194..248338) Member of the eukary...    31   3.0  
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    31   3.1  
CAGL0G00242g complement(20428..24861) highly similar to sp|P5304...    31   4.5  
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    30   5.0  
Kwal_26.6702                                                           30   5.4  
Scas_720.7                                                             30   6.7  
AER091W [2596] [Homologous to ScYKL188C (PXA2) - SH] complement(...    30   6.7  
Kwal_23.4045                                                           30   7.3  
Kwal_33.13308                                                          30   7.4  
CAGL0H03091g complement(292976..293980) highly similar to sp|P52...    29   9.0  
Kwal_56.23638                                                          30   9.4  

>Scas_636.14
          Length = 608

 Score = 1252 bits (3239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/608 (100%), Positives = 608/608 (100%)

Query: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
Sbjct: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240
           KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA
Sbjct: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360
           YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360

Query: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420
           TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ
Sbjct: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480
           TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540
           ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540

Query: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGNY 600
           FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGNY
Sbjct: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGNY 600

Query: 601 FFLDNTGV 608
           FFLDNTGV
Sbjct: 601 FFLDNTGV 608

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
           ortholog of human Rnase L inhibitor (RLI) of the
           interferon-regulated 2-5A pathway, putative ortholog of
           C. elegans Y39E4B.1, member of the non-transporter group
           in the ATP-binding cassette (ABC) superfamily [1827 bp,
           608 aa]
          Length = 608

 Score = 1129 bits (2920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/609 (89%), Positives = 576/609 (94%), Gaps = 2/609 (0%)

Query: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS+KNSRIAIVSAD+CKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
Sbjct: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE HVTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240
           KGPVQKVGELLKLRMEK  E VK YIK LQLE+VL R+I KLSGGELQRFAIG+SCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAQIIR LL PTKYVI VEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGE-ANKTFEYPAMK 359
           YGVVTLP+SVREGINIFLDGHIPAEN+RFR+EALQFR+ DATED + + A++ F YP++K
Sbjct: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360

Query: 360 RTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKP 419
           +TQGDF L VE G+FSDSEILVMMGENGTGKTTLIKLLAG ++ DE  + + KLNVSMKP
Sbjct: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQD-IPKLNVSMKP 419

Query: 420 QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479
           Q IAPKFPGTVRQLFFKKIRGQFL+PQFQTDVVKPL+IDDIIDQEVQHLSGGELQRVAIV
Sbjct: 420 QKIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIV 479

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVI 539
           LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 539

Query: 540 VFEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGN 599
           VFEG PSK+A+ARAPESLLTGCNRFLKNLNVTFRRD  SFRPRINKLDSQMD+EQK SGN
Sbjct: 540 VFEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGN 599

Query: 600 YFFLDNTGV 608
           YFFLDNTG+
Sbjct: 600 YFFLDNTGI 608

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 1122 bits (2901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/608 (88%), Positives = 573/608 (94%), Gaps = 1/608 (0%)

Query: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS+K SRIA+V+ADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISE+LCIGCGI
Sbjct: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAITIINLPTNLE HVTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED+IKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240
           KGPVQKVGELLKLRMEK  +TVK YIKTLQL+H+LNREIG LSGGELQRFAI +SCVQDA
Sbjct: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIR LL P+KYVIAVEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360
           YGVVTLPSSVREGINIFLDGHIP+EN+RFR+EALQFR+ D+  D   +A + + YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRIADSAADIIVDATRAYSYPDMKR 360

Query: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420
           TQGDF+L V+SG+FSDSEILVMMGENGTGKTTLIKLLAG I +D+ +  V KLNVSMKPQ
Sbjct: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTS-VPKLNVSMKPQ 419

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480
           TIAPKFPGTVRQLFFKKIR QFL+PQFQTDVVKPLKIDDIIDQEV+HLSGGELQRVAIVL
Sbjct: 420 TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540
           +LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVIV
Sbjct: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539

Query: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGNY 600
           F+GTPS++  A APESLLTGCNRFLKNLNVTFRRD  SFRPRINKLDSQMD+EQKLSGNY
Sbjct: 540 FDGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGNY 599

Query: 601 FFLDNTGV 608
           FFLD+ GV
Sbjct: 600 FFLDSNGV 607

>KLLA0C17556g complement(1544404..1546227) highly similar to
           sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1,
           start by similarity
          Length = 607

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/608 (86%), Positives = 563/608 (92%), Gaps = 1/608 (0%)

Query: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS KN+RIAIVS D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSKIAFISE LCIGCGI
Sbjct: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNL+  VTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRF+DPPEWQEIIKYFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240
           KGPVQKVGELLKLR+EK  +  K YI  LQL++VLNRE+  LSGGELQRFAIG+SCVQ+A
Sbjct: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIR LL PT YVI VEHDLSVLDYLSDFVCIIYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360
           YGVVTLPSSVREGINIFLDGHIP+EN+RFR+EALQFR+ DA ++ + +A++ F YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360

Query: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420
           TQGDFSLTVE+G+FSDS+ILVMMGENGTGKTTLIKLLAG I +D+  + + KLNVSMKPQ
Sbjct: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQD-IPKLNVSMKPQ 419

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480
            IAPKF GTVRQLFFK+IR QFL+PQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 420 KIAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 479

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540
           +LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVIV
Sbjct: 480 SLGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539

Query: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGNY 600
           F+G PSK A ARAPESLLTGCN+FLKNLNVTFRRD TSFRPRINKLDSQMD+EQK SGNY
Sbjct: 540 FDGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGNY 599

Query: 601 FFLDNTGV 608
           FFLD+ GV
Sbjct: 600 FFLDHNGV 607

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
           complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/608 (85%), Positives = 557/608 (91%), Gaps = 1/608 (0%)

Query: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS+KN+RIAIVS D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISE LCIGCGI
Sbjct: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AITIINLPTNL+  VTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEW +IIKYFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240
           KGP+QKVGELLK RMEK    VK YIK L+L++VL R++  LSGGELQRFAIG+SCVQ A
Sbjct: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAA IIR LL PT YVI VEHDLSVLDYLSDF+CI+YGVPSV
Sbjct: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360
           YGVVTLPSSVREGINIFLDGHIP+EN+RFR+EALQFRL +A E+   +A + F+YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360

Query: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420
           TQGDF L VE G+FSDSEILVMMGENGTGKTTLIKLLAG I +D+  + + KLNVSMKPQ
Sbjct: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTLIKLLAGAIAADDGKD-IPKLNVSMKPQ 419

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480
            IAPKFPGTVRQLFFK+IR QFL+PQFQTDV KPL+IDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 420 KIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVL 479

Query: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540
           ALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVIV
Sbjct: 480 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539

Query: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGNY 600
           FEGTPSK+A AR PESLLTGCN+FLKNLNVTFRRD  SFRPRINKLDSQMD+EQKLSGNY
Sbjct: 540 FEGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGNY 599

Query: 601 FFLDNTGV 608
           FFLD   V
Sbjct: 600 FFLDTASV 607

>Kwal_56.23429
          Length = 539

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/540 (85%), Positives = 498/540 (92%), Gaps = 2/540 (0%)

Query: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60
           MS KN+RIAIV+ D+CKPKKCRQECKRSCPVVKTGKLCIEVTPT+KIAFISE LCIGCGI
Sbjct: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE  VTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEWQ+II+YFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240
           KGPVQKVGELLKLR+E+  +  K  IK L L+HVL R++G LSGGELQRFAIG+SCVQ+A
Sbjct: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA +IR LL  T YVI+VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGE-ANKTFEYPAMK 359
           YGVVTLPSSVREGINIFL+GHIP+EN+RFR EALQFR+ DA E  + E A ++F YP+MK
Sbjct: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360

Query: 360 RTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKP 419
           RTQGDF L VESG FSDSEILVMMGENGTGKTTLIKLLAG +  D+  +KV KLNVSMKP
Sbjct: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDD-GQKVPKLNVSMKP 419

Query: 420 QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479
           Q IAPKFPGTVRQLFFK+IRGQFL+PQFQTDVVKPLKI+ IIDQEVQHLSGGELQRVAIV
Sbjct: 420 QKIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIV 479

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVI 539
           LALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 480 LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMATYLADKVI 539

 Score =  100 bits (248), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 117/240 (48%), Gaps = 43/240 (17%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKK 437
           ++L ++G NG GK+T +K+LAG     +    + + +   + Q I   F G+  Q +F K
Sbjct: 104 QVLGLVGTNGIGKSTALKILAG-----KQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTK 158

Query: 438 IR----GQFLSPQF--------------------------QTD---VVKPLKIDDIIDQE 464
           +        + PQ+                          Q D   V+K L +  ++ ++
Sbjct: 159 MLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRD 218

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVV 524
           V  LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VIR  +L+       V
Sbjct: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRS-LLNATTYVISV 277

Query: 525 EHDFIMATYLADKVIVFEGTPSKHANARAPESLLTGCNRFLK----NLNVTFRRDTTSFR 580
           EHD  +  YL+D V +  G PS +     P S+  G N FL+    + N+ FR++   FR
Sbjct: 278 EHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFR 337

>YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the
           non-transporter group of the ATP-binding cassette (ABC)
           superfamily, also a prion responsible for the [NU+]
           determinant [3591 bp, 1196 aa]
          Length = 1196

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 126/328 (38%), Gaps = 70/328 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +  D
Sbjct: 597 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGEEGDL--D 648

Query: 163 NIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK 221
            +  I   + + +  R  I   ++ VG       E+ ++TV                 G 
Sbjct: 649 LVSFIALDEELQSTSREEIAAALESVG----FDEERRAQTV-----------------GS 687

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV-IAVEHD 280
           LSGG   +  +  + +Q AD+ + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 688 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLEEYLLEHTDITSLIVSHD 744

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPA 324
              LD                Y  +    +   P      TL  S  +            
Sbjct: 745 SGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDSNAQ------------ 792

Query: 325 ENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMG 384
             +RF    +   +   T       + TF YP  ++     SL+  S   S S  +  +G
Sbjct: 793 --MRFPPPGILTGVKSNTRAVAKMTDVTFSYPGAQKP----SLSHVSCSLSLSSRVACLG 846

Query: 385 ENGTGKTTLIKLLAGVIQSDENSEKVQK 412
            NG GK+TLIKLL G +  +E   KV+K
Sbjct: 847 PNGAGKSTLIKLLTGELVPNEG--KVEK 872

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 683 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLEEYLLEHTDITS 738

Query: 522 FVVEHDFIMATYLADKVIVFE 542
            +V HD      +   +I +E
Sbjct: 739 LIVSHDSGFLDTVCTDIIHYE 759

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
            +G LSGG+L +  I  +   +  + + DEP++YLD       A  IRD    +  V+ + 
Sbjct: 1030 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW---SGGVVMIS 1086

Query: 279  HD 280
            H+
Sbjct: 1087 HN 1088

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 109 VGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           +G NG GKST +K+L G+  PN G+ +  P
Sbjct: 845 LGPNGAGKSTLIKLLTGELVPNEGKVEKHP 874

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1033 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW 1078

>Kwal_0.167
          Length = 1044

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 87/192 (45%), Gaps = 13/192 (6%)

Query: 212 EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPT 271
           + ++N  I  LSGG   + A+  + +++AD+ + DEP+++LD    +N A ++  L T  
Sbjct: 534 DEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCG 590

Query: 272 KYVIAVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRS 331
              I V HD   LD ++ ++    G+        +   V++         + A  + FR 
Sbjct: 591 ITSIIVSHDSGFLDNVTQYIIHYEGLKLRKYKGNMSEFVKKCPTAKSYYELGASELEFRF 650

Query: 332 EALQFRLHDATEDTKG---EANKTFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENG 387
               F L       K     +N TF+YP   + Q  D S        S S  + ++G NG
Sbjct: 651 PEPGF-LEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISFQC-----SLSSRIAVIGPNG 704

Query: 388 TGKTTLIKLLAG 399
            GK+TLI +L G
Sbjct: 705 AGKSTLINVLTG 716

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 76/163 (46%), Gaps = 9/163 (5%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A   Q D    + +   V ++          +V    F+   G 
Sbjct: 461 LCGPNGAGKSTLMRAIANG-QVDGFPTQDECRTVYVEHDIDGTHSDTSVLDFVFQ---GD 516

Query: 442 FLSPQFQTDVVKPLKI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
             + +  TD ++     D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTKEAITDKLREFGFSDEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEG 543
               +    +  ++     T+ +V HD      +   +I +EG
Sbjct: 577 ----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVTQYIIHYEG 615

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 124/306 (40%), Gaps = 54/306 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P   E    +   ++ N  + M   
Sbjct: 456 GRRYGLCGPNGAGKSTLMRSIAN------GQVDGFPTQDECRTVYVEHDIDNTHSDM--- 506

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQL-EHVLNREIGK 221
              +++   Y  N+                    KD  T K  +K     + ++   I  
Sbjct: 507 ---SVLDFVYSGNVGT------------------KDVITSK--LKEFGFSDEMIEMPIAS 543

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDL 281
           LSGG   + A+  + ++DAD+ + DEP+++LD    +N   ++  L T     + V HD 
Sbjct: 544 LSGGWKMKLALARAVLKDADILLLDEPTNHLDT---VNVEWLVNYLNTCGITSVIVSHDS 600

Query: 282 SVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDA 341
             LD +  ++    G+        L   V++         + A ++ F     QF     
Sbjct: 601 GFLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQSYYELGASDLEF-----QFPTPGY 655

Query: 342 TEDTKGE-------ANKTFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENGTGKTTL 393
            E  K +       +N TF+YP   + Q  D +        S S  + ++G NG GK+TL
Sbjct: 656 LEGVKTKQKAIVKVSNMTFQYPGTTKPQVSDVTFQC-----SLSSRIAVIGPNGAGKSTL 710

Query: 394 IKLLAG 399
           I +L G
Sbjct: 711 INVLTG 716

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +  + +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDT----VNVEWLVNYLNTC 589

Query: 518 KKTAFVVEHDFIMATYLADKVIVFEG 543
             T+ +V HD      +   +I +EG
Sbjct: 590 GITSVIVSHDSGFLDKVCQYIIHYEG 615

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L D+V   +    TPS H
Sbjct: 948 IITHSAEFTKNLTDEVWAVKDGKMTPSGH 976

>CAGL0B03487g complement(345399..348536) highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 or sp|P53978
           Saccharomyces cerevisiae YNL014w HEF3, start by
           similarity
          Length = 1045

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 126/307 (41%), Gaps = 56/307 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYF--TKML 160
           G+  GL G NG GKST ++ +A       G+ D  P  +E +  +   ++      T +L
Sbjct: 456 GRRYGLCGPNGAGKSTLMRAIAN------GQVDGFPTPEECMTVYVEHDIDGTHADTSVL 509

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIG 220
           +  + + +  +       AI   + + G                       E ++N  I 
Sbjct: 510 DFVVSSEVGTK------EAITAKLVEFG---------------------FTEEMINMPIS 542

Query: 221 KLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHD 280
            LSGG   + A+  + +++AD+ + DEP+++LD    +N A ++  L T     + V HD
Sbjct: 543 SLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSVIVSHD 599

Query: 281 LSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHD 340
              LD +  ++    G+        L   V++         + A ++ F+     F    
Sbjct: 600 SGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAQSYYELGASDLEFK-----FPEPG 654

Query: 341 ATEDTKGE-------ANKTFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENGTGKTT 392
             E  K +       +N TF+YP   + Q  D S        S S  + ++G NG GK+T
Sbjct: 655 YLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISFQC-----SLSSRIAVIGPNGAGKST 709

Query: 393 LIKLLAG 399
           LI +L G
Sbjct: 710 LINVLTG 716

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           +++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 EEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 518 KKTAFVVEHDFIMATYLADKVIVFEG 543
             T+ +V HD      +   +I +EG
Sbjct: 590 GITSVIVSHDSGFLDNVCQYIIHYEG 615

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACSWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L ++V   +    TPS H
Sbjct: 948 IITHSAEFTKNLTEEVWAVKDGKMTPSGH 976

>AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH]
           complement(186656..190225) [3570 bp, 1189 aa]
          Length = 1189

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/319 (25%), Positives = 124/319 (38%), Gaps = 76/319 (23%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ ++       G+ +  P   E+   F    L+     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSISN------GQLEGFPSQDELKTCFVERALEGEDGSV--D 641

Query: 163 NIKAIIKPQYVDNIPR-AIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK 221
            +  +     ++N PR  I   ++ VG       ++ ++TV                 G 
Sbjct: 642 IVSFLASAPSLENTPRKEIVAALESVG----FDADRRAQTV-----------------GS 680

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV-IAVEHD 280
           LSGG   +  +  + +Q AD+ + DEP+++LDV    N   +   LL  T+   + V HD
Sbjct: 681 LSGGWKMKLELTRAILQKADILLLDEPTNHLDVA---NVRWLEEYLLNNTEITSLIVSHD 737

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPA 324
              LD                Y  +    +   P      TL  S  +        H PA
Sbjct: 738 TGFLDKVCTDIIHYENKKLAYYKGNLHDFVEQKPEAKSYYTLTDSNAQ-------MHFPA 790

Query: 325 ENIRFRSEALQFRLHDATEDTKGEA---NKTFEYP-AMKRTQGDFSLTVESGDFSDSEIL 380
             I          L     +T+  A   + TF YP A K +  D S +      S S  +
Sbjct: 791 PGI----------LSGVKSNTRAVAKMTDVTFTYPGAPKPSMADVSCS-----LSLSSRV 835

Query: 381 VMMGENGTGKTTLIKLLAG 399
            ++G NG GK+TLIKLL G
Sbjct: 836 AIIGPNGAGKSTLIKLLTG 854

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK-TA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   + +  ++L+N + T+
Sbjct: 676 QTVGSLSGGWKMKLELTRAILQKADILLLDEPTNHLD----VANVRWLEEYLLNNTEITS 731

Query: 522 FVVEHDFIMATYLADKV 538
            +V HD    T   DKV
Sbjct: 732 LIVSHD----TGFLDKV 744

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 219  IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
            +G LSGG+L +  I  +   +  + + DEP++YLD       A  IR+    T  V+ + 
Sbjct: 1024 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMIS 1080

Query: 279  HDLSVLDYLSDFVCII-YGVPSVYGVVTLPSS 309
            H    +  L     I+  G     GVVT+  S
Sbjct: 1081 HSTEFVGALCPEQWIVENGTMVQKGVVTVDQS 1112

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF----ILHNKKTAFV 523
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +    ++ +  T FV
Sbjct: 1027 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFV 1086

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQN 154
           + ++G NG GKST +K+L G+  P  G+ +  P  +  I Y     LQ+
Sbjct: 835 VAIIGPNGAGKSTLIKLLTGELVPTSGKVEKHPNLR--IGYIAQHALQH 881

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 90/199 (45%), Gaps = 27/199 (13%)

Query: 212 EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPT 271
           + ++   I  LSGG   + A+  + +++AD+ + DEP+++LD    +N A ++  L T  
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCG 590

Query: 272 KYVIAVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAEN-IRFR 330
              I V HD   LD +  ++    G+             R  ++ F+     A++     
Sbjct: 591 ITSIIVSHDSGFLDSVCQYIIHYEGLKL--------RKYRGNLSEFVKKCPTAKSYYELG 642

Query: 331 SEALQFRLHDATE----DTKGEA-----NKTFEYPAMKRTQ-GDFSLTVESGDFSDSEIL 380
           +  L+FR  +        TK +A     N TF+YP   + Q  D S        S S  +
Sbjct: 643 ASELEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISFQC-----SLSSRI 697

Query: 381 VMMGENGTGKTTLIKLLAG 399
            ++G NG GK+TLI +L G
Sbjct: 698 AVIGPNGAGKSTLINVLTG 716

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 77/163 (47%), Gaps = 9/163 (5%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A   Q D    + +   V ++          +V +  F+   G 
Sbjct: 461 LCGPNGAGKSTLMRAIANG-QVDGFPSQDECRTVYVEHDIDGTHSDTSVLEFVFQ---GD 516

Query: 442 FLSPQFQTDVVKPLKI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
             + +  ++ ++     D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTKETISEKLREFGFSDEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEG 543
               +    +  ++     T+ +V HD      +   +I +EG
Sbjct: 577 ----VNVAWLVNYLNTCGITSIIVSHDSGFLDSVCQYIIHYEG 615

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L ++V   +    TPS H
Sbjct: 948 IITHSAEFTKDLTEEVWAVKDGKMTPSGH 976

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG 132
           + ++G NG GKST + +L G+  P +G
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTIG 723

>Scas_720.36
          Length = 1190

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 85/331 (25%), Positives = 126/331 (38%), Gaps = 76/331 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +  D
Sbjct: 593 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGEEGDL--D 644

Query: 163 NIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK 221
            +  I   + +    R  I   ++ VG       E+ ++TV                 G 
Sbjct: 645 LVSFIALDEELQATSREEISNALEHVG----FDEERRAQTV-----------------GS 683

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV-IAVEHD 280
           LSGG   +  +  + +Q AD+ + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 684 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLQDYLLEHTDITSLIVSHD 740

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPA 324
              LD                Y  +    +   P      TL  S  +        H P 
Sbjct: 741 SGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKSYYTLSDSNAQ-------MHFPP 793

Query: 325 ENIRFRSEALQFRLHDATEDTKGEA---NKTFEYPAMKRTQGDFSLTVESGDFSDSEILV 381
             I          L     +T+  A   + TF YP   +     SL+  S   S S  + 
Sbjct: 794 PGI----------LTGVKSNTRAVAKMTDVTFSYPGADKP----SLSHVSCALSLSSRVA 839

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQK 412
           ++G NG GK+TLIKLL G +   E   KV+K
Sbjct: 840 VLGPNGAGKSTLIKLLTGELVPQEG--KVEK 868

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 679 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLQDYLLEHTDITS 734

Query: 522 FVVEHDFIMATYLADKVIVFE 542
            +V HD      +   +I +E
Sbjct: 735 LIVSHDSGFLDTVCTDIIHYE 755

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
            +G LSGG+L +  I  +   +  + + DEP++YLD       A  IRD    +  V+ + 
Sbjct: 1026 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW---SGGVVMIS 1082

Query: 279  HD 280
            H+
Sbjct: 1083 HN 1084

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1029 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW 1074

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 838 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 870

>Scas_703.17
          Length = 1046

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 87/196 (44%), Gaps = 21/196 (10%)

Query: 212 EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPT 271
           +  +N  I  LSGG   + A+  + +++AD+ + DEP+++LD    +N   ++  L T  
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT---INVKWLVDYLNTCG 591

Query: 272 KYVIAVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRS 331
              I V HD   LD +  ++    G+        L   +++  +      + A ++ F  
Sbjct: 592 ITSIIVSHDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFIKKCPSAKSYSELGASDLEF-- 649

Query: 332 EALQFRLHDATEDTKGE-------ANKTFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMM 383
              QF      E  K +       +N TF+YP   + Q  D S        S S  + ++
Sbjct: 650 ---QFPAPGYLEGVKTKQKAIVKVSNMTFQYPRTSKPQISDVSFQC-----SLSSRIAVI 701

Query: 384 GENGTGKTTLIKLLAG 399
           G NG GK+TLI +L G
Sbjct: 702 GPNGAGKSTLINVLTG 717

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D+ I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    I  K +  ++   
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT----INVKWLVDYLNTC 590

Query: 518 KKTAFVVEHDFIMATYLADKVIVFEG 543
             T+ +V HD      +   +I +EG
Sbjct: 591 GITSIIVSHDSGFLDNVCQYIIHYEG 616

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 464 EVQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTA 521
           +++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +   
Sbjct: 894 QIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGV 947

Query: 522 FVVEHDFIMATYLADKVI-VFEG--TPSKH 548
            ++ H       L ++V  V EG  TPS H
Sbjct: 948 IIITHSEEFTKNLTEEVWAVKEGKMTPSGH 977

>Scas_716.81
          Length = 1565

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 95/199 (47%), Gaps = 26/199 (13%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK--QKPNLGR----FDDPPEWQEI 143
           NS+ L      +PG+++ ++G  G G S+ LK++AG+  Q P   +    +D  P+ +E+
Sbjct: 236 NSYAL-----AKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQ-KEM 289

Query: 144 IKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVK 203
           +K+++   + N     L+ +   +   Q +D    A K P ++V  + +    K S  + 
Sbjct: 290 MKHYKSDVIYN---GELDVHFPHLTVQQTLD-FALACKTPAKRVNNISRDEYIKSSREL- 344

Query: 204 GYIKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRL 258
            Y     L H  N ++G      +SGGE +R +I  +   +  +Y +D  +  LD    L
Sbjct: 345 -YATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTAL 403

Query: 259 NAAQIIR---DLLTPTKYV 274
             A+ IR   +LL  T +V
Sbjct: 404 EYAKAIRIMTNLLGSTAFV 422

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 78/190 (41%), Gaps = 22/190 (11%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA + +  +   D             G  +   F +   
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGD---------MLVNGRPVDASFERR-- 988

Query: 162  DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSET---VKGYIKTLQLEHVLNRE 218
                  ++ Q +      ++  +Q    + +     D E    V+  I+ L++E   +  
Sbjct: 989  ---TGYVQQQDIHIAELTVRESLQFSARMRRSEHVSDEEKLAYVEKIIRVLEMEEFADAL 1045

Query: 219  IGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPTKY 273
            +G +  G    + ++ +IG+  V   D+ +F DEP+S LD +      Q++R L    + 
Sbjct: 1046 VGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLAQAGQS 1105

Query: 274  VIAVEHDLSV 283
            ++   H  S 
Sbjct: 1106 ILCTIHQPSA 1115

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAFV
Sbjct: 364 VRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNLLGSTAFV 422

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 74/161 (45%), Gaps = 32/161 (19%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQKLNVSMKPQ 420
            +  +MGE+G GKTTL+  LA     GV+  D               +  VQ+ ++ +   
Sbjct: 943  LTALMGESGAGKTTLLNTLAKRNEIGVVTGDMLVNGRPVDASFERRTGYVQQQDIHIAEL 1002

Query: 421  TIAPKFPGTVRQLFFKKIRGQFLSPQ----FQTDVVKPLKIDDIIDQEVQHLSGG----E 472
            T+      + R       R + +S +    +   +++ L++++  D  V  +  G    +
Sbjct: 1003 TVRESLQFSARMR-----RSEHVSDEEKLAYVEKIIRVLEMEEFADALVGAIGCGLNVEQ 1057

Query: 473  LQRVAIVLALGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 512
             ++++I + L    D+ L +DEP++ LDS+      +++R+
Sbjct: 1058 RKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRK 1098

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 85/331 (25%), Positives = 127/331 (38%), Gaps = 76/331 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +  D
Sbjct: 583 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTCFVEHKLQGEEGDL--D 634

Query: 163 NIKAI-IKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK 221
            +  I + P   D     I   ++ VG                Y ++        + +G 
Sbjct: 635 LVSFIALDPILKDVSKEDISNALESVG-------------FDDYRRS--------QTVGS 673

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV-IAVEHD 280
           LSGG   +  +  + +Q ADV + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 674 LSGGWKMKLELARAMLQRADVLLLDEPTNHLDVA---NVKWLQDYLLEHTDITSLIVSHD 730

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPA 324
              LD                Y  +    +   P      TL +S  +        H P 
Sbjct: 731 SGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKAYYTLTNSNAQ-------MHFPP 783

Query: 325 ENIRFRSEALQFRLHDATEDTKGEA---NKTFEYPAMKRTQGDFSLTVESGDFSDSEILV 381
             I          L     +T+  A   + TF YP   +     SL+  S   S S  + 
Sbjct: 784 PGI----------LSGVKSNTRAVAKMTDVTFTYPGASKP----SLSNVSCALSLSSRVA 829

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQK 412
           ++G NG GK+TLIKLL G +  D  S KV+K
Sbjct: 830 ILGPNGAGKSTLIKLLNGELLPD--SGKVEK 858

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 95/208 (45%), Gaps = 21/208 (10%)

Query: 348 EANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMM--------GENGTGKTTLIKLLA- 398
           E  KT E   ++    DFSL   S    +   L ++        G NG GK+TL++ +A 
Sbjct: 546 ERKKTDEDEGIEIVNTDFSLAYGSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRSIAN 605

Query: 399 GVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRG--QFLSPQFQTDVVKPLK 456
           G ++   + + ++   V  K Q       G +  + F  +    + +S +  ++ ++ + 
Sbjct: 606 GQLEGFPDKDTLRTCFVEHKLQGEE----GDLDLVSFIALDPILKDVSKEDISNALESVG 661

Query: 457 IDDII-DQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
            DD    Q V  LSGG   ++ +  A+   AD+ L+DEP+ +LD    +   K ++ ++L
Sbjct: 662 FDDYRRSQTVGSLSGGWKMKLELARAMLQRADVLLLDEPTNHLD----VANVKWLQDYLL 717

Query: 516 -HNKKTAFVVEHDFIMATYLADKVIVFE 542
            H   T+ +V HD      +   +I +E
Sbjct: 718 EHTDITSLIVSHDSGFLDTVCTDIIHYE 745

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
            +G LSGG+L +  I  +   +  + + DEP++YLD       A  IR+    T  V+ + 
Sbjct: 1017 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMIS 1073

Query: 279  HD 280
            H+
Sbjct: 1074 HN 1075

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 4/105 (3%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHD 527
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +         +  ++
Sbjct: 1020 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMISHNN 1076

Query: 528  FIMATYLADKVIVFEGTPSKHANARAPESLLT-GCNRFLKNLNVT 571
              +     ++ IV  GT  +   A   +S    G N     LNVT
Sbjct: 1077 EFVGALCPEQWIVENGTMVQKGIAEIDQSRFEDGGNTNAVGLNVT 1121

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P+ G+ +  P
Sbjct: 828 VAILGPNGAGKSTLIKLLNGELLPDSGKVEKHP 860

>Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement
          Length = 1179

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 123/328 (37%), Gaps = 70/328 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +  D
Sbjct: 578 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTRFVEHKLQGEEGDL--D 629

Query: 163 NIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK 221
            +  I     +  + R  I   ++ VG        + S+TV                 G 
Sbjct: 630 LVSFIALDPELQGVSREDIANALESVG----FDDYRRSQTV-----------------GS 668

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV-IAVEHD 280
           LSGG   +  +  + +Q ADV + DEP+++LDV    N   +   LL  T+   + V HD
Sbjct: 669 LSGGWKMKLELARAMLQKADVLLLDEPTNHLDVA---NVKWLEDYLLEHTEITSLIVSHD 725

Query: 281 LSVLD----------------YLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPA 324
              LD                Y  +    +   P      TL  +  +            
Sbjct: 726 SGFLDAVCTEIIHYENKKLAYYKGNLAAFVEQKPEAKAYYTLTDTNAQ------------ 773

Query: 325 ENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMG 384
             +RF    +   +   T         +F YP   +     SLT  S   S S  + ++G
Sbjct: 774 --MRFPPPGILTGVKSNTRAVAKVTGVSFTYPGASQP----SLTDVSCSLSLSSRVAVLG 827

Query: 385 ENGTGKTTLIKLLAGVIQSDENSEKVQK 412
            NG GK+TLIKLL G +   E   KV+K
Sbjct: 828 PNGAGKSTLIKLLTGELVPQEG--KVEK 853

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 79/171 (46%), Gaps = 23/171 (13%)

Query: 382 MMGENGTGKTTLIKLLA-GVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRG 440
           + G NG GK+TL++ +A G ++   + +       +++ + +  K  G    L       
Sbjct: 583 LCGRNGAGKSTLMRSIANGQLEGFPDKD-------TLRTRFVEHKLQGEEGDLDLVSFIA 635

Query: 441 QFLSPQFQ-------TDVVKPLKIDDII-DQEVQHLSGGELQRVAIVLALGIPADIYLID 492
             L P+ Q        + ++ +  DD    Q V  LSGG   ++ +  A+   AD+ L+D
Sbjct: 636 --LDPELQGVSREDIANALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQKADVLLLD 693

Query: 493 EPSAYLDSEQRIICSKVIRRFIL-HNKKTAFVVEHDFIMATYLADKVIVFE 542
           EP+ +LD    +   K +  ++L H + T+ +V HD      +  ++I +E
Sbjct: 694 EPTNHLD----VANVKWLEDYLLEHTEITSLIVSHDSGFLDAVCTEIIHYE 740

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
            +G LSGG+L +  I  +   +  + + DEP++YLD       A  IRD    T  V+ + 
Sbjct: 1011 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW---TGGVVMIS 1067

Query: 279  HD 280
            H+
Sbjct: 1068 HN 1069

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1014 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW 1059

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 823 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 855

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 81/185 (43%), Gaps = 13/185 (7%)

Query: 219 IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
           I  LSGG   + A+  + +++AD+ + DEP+++LD    +N   ++  L T     I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVNWLVEYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRL 338
           HD   LD +  ++    G+        L   V++         + A  + FR     + L
Sbjct: 598 HDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASELEFRFPEPGY-L 656

Query: 339 HDATEDTKG---EANKTFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENGTGKTTLI 394
                  K     +N TF+YP   + Q  D S        S S  + ++G NG GK+TLI
Sbjct: 657 EGVKTKQKAIVKVSNMTFQYPGTAKPQISDISFQC-----SLSSRIAVIGPNGAGKSTLI 711

Query: 395 KLLAG 399
            +L G
Sbjct: 712 NVLTG 716

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 74/163 (45%), Gaps = 9/163 (5%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A   Q D    + +   V ++      +   +V    F    G 
Sbjct: 461 LCGPNGAGKSTLMRAIANG-QVDGFPTQEECRTVYVEHDIDGTQADTSVVDFVFS---GN 516

Query: 442 FLSPQFQTDVVKPLKI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
             +    TD ++     D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTKDVITDKLREFGFSDEMIAMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEG 543
               +    +  ++     T+ +V HD      +   +I +EG
Sbjct: 577 ----VNVNWLVEYLNTCGITSIIVSHDSGFLDKVCQYIIHYEG 615

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L ++V   +    TPS H
Sbjct: 948 IITHSAEFTKNLTEEVWAVKDGRMTPSGH 976

>CAGL0D03674g 370066..373626 highly similar to tr|Q08972
           Saccharomyces cerevisiae YPL226w NEW1, start by
           similarity
          Length = 1186

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 123/315 (39%), Gaps = 44/315 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSIAN------GQLDGFPDKDTLKTCFVEHKLQGEEGDL--D 641

Query: 163 NIKAIIKPQYVDNIPRA-IKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK 221
            +  I   + +    R  I   +  VG           ET +             + +G 
Sbjct: 642 LVSFIALDEQLQTTSRDDIANALASVGF---------DETRRA------------QTVGS 680

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV-IAVEHD 280
           LSGG   +  +  + +Q AD+ + DEP+++LDV    N   +   LL  T    + V HD
Sbjct: 681 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVA---NVKWLEEYLLEHTNITSLIVSHD 737

Query: 281 LSVLDYLSDFVCIIYGVPSVYGVVTLPSSVR---EGINIFLDGHIPAENIRFRSEALQFR 337
              LD +   +        +Y    L   V    E    +      A+ +RF    +   
Sbjct: 738 SGFLDAVCTDIIHYENKKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQ-MRFPPPGILTG 796

Query: 338 LHDATEDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLL 397
           +   T       + TF YP         SL+  S   S S  + ++G NG GK+TLIKLL
Sbjct: 797 VKSNTRAVAKVTDVTFTYPGASTP----SLSHVSCALSLSSRVAVLGPNGAGKSTLIKLL 852

Query: 398 AGVIQSDENSEKVQK 412
            G +   E   KV+K
Sbjct: 853 TGELVPQEG--KVEK 865

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 14/103 (13%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 521
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 676 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VANVKWLEEYLLEHTNITS 731

Query: 522 FVVEHD--FIMAT------YLADKVIVFEGTPSKHANARAPES 556
            +V HD  F+ A       Y   K+I ++G  +K    + PE+
Sbjct: 732 LIVSHDSGFLDAVCTDIIHYENKKLIYYKGNLAKFVEQK-PEA 773

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
            +G LSGG+L +  I  +   +  + + DEP++YLD       A  IRD    +  V+ + 
Sbjct: 1023 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW---SGGVVMIS 1079

Query: 279  HD 280
            H+
Sbjct: 1080 HN 1081

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 468  LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1026 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW 1071

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 835 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 867

>Scas_288.1
          Length = 494

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 109/249 (43%), Gaps = 30/249 (12%)

Query: 72  IINLPTNLEQHVTHRYSVNSFKLHRL-----PTPRPGQVLGLVGTNGIGKSTALKILAGK 126
           I+ LP  + + +  R    S K+ ++          G+++ ++G  G G S+ LK+ AG+
Sbjct: 40  ILCLPYTIYKGIKAR---KSMKMRKILQNVNALAEAGEMVLVLGRPGAGCSSFLKVTAGE 96

Query: 127 QKPNLG------RFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180
                G       +D  P+  E++K +R   + N     L+ +   +   Q +D    A 
Sbjct: 97  TDQFAGGVTGEIAYDGIPQ-DEMMKKYRADVIYN---GELDVHFPYLTVQQTLD-FAIAC 151

Query: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK-----LSGGELQRFAIGLS 235
           K P ++V ++ K    K +  +  Y     L H  N ++G      +SGGE +R +I  +
Sbjct: 152 KTPAKRVNDVSKEEYIKSTREL--YATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEA 209

Query: 236 CVQDADVYMFDEPSSYLDVKQRLNAAQIIR---DLLTPTKYVIAVEHDLSVLDYLSDFVC 292
              +  +Y +D  +  LD    L  A+ IR   +LL  T +V   +   ++ +   D V 
Sbjct: 210 LAANGTIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFVTIYQASENIYETF-DKVT 268

Query: 293 IIYGVPSVY 301
           ++Y    +Y
Sbjct: 269 VLYSGRQIY 277

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR      K TAFV 
Sbjct: 193 VRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFVT 252

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1, hypothetical
           start
          Length = 727

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 97/216 (44%), Gaps = 32/216 (14%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE---- 405
           N TF Y   ++   + S T+ +G  +      + G +G+GK+T++KL+      +E    
Sbjct: 469 NVTFGYDGQRKILKNASFTIPAGMKT-----AIAGPSGSGKSTVLKLVFRFYDPEEGRVL 523

Query: 406 -NSEKVQKLNVSMKPQTIA------PKFPGTVRQ-LFFKKIRGQFLSPQFQTDVVKPLKI 457
            N   V++ ++    + I       P F  T+ + + F +I     S +  T V+   ++
Sbjct: 524 VNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWENVKFGRIEA---SDEEITRVIDKAQL 580

Query: 458 DDIIDQEVQ-----------HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIIC 506
            D+I +  Q            +SGGE QR+AI   L   ADI   DE ++ LD+      
Sbjct: 581 SDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSL 640

Query: 507 SKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
            + IRR     +KT+  + H  +     ADK+IV E
Sbjct: 641 LRTIRRNFNSGEKTSVYIAHR-LRTIADADKIIVLE 675

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 83/197 (42%), Gaps = 35/197 (17%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            G    + G +G GKST LK++         RF DP E + ++    G +++ Y    L 
Sbjct: 490 AGMKTAIAGPSGSGKSTVLKLVF--------RFYDPEEGRVLVN---GVDVREYDIDQLR 538

Query: 162 DNIKAIIK--PQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNR-- 217
             I  + +  P + D I   +K            R+E   E +   I   QL  ++ +  
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVKFG----------RIEASDEEITRVIDKAQLSDLIAKLP 588

Query: 218 --------EIG-KLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQII-RDL 267
                   E G  +SGGE QR AI    ++DAD+  FDE +S LD     +  + I R+ 
Sbjct: 589 QGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNF 648

Query: 268 LTPTKYVIAVEHDLSVL 284
            +  K  + + H L  +
Sbjct: 649 NSGEKTSVYIAHRLRTI 665

>Scas_618.3
          Length = 793

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 88/190 (46%), Gaps = 33/190 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDNI 164
           + LVG NG GK+T LK++  + +P  G               R   L+  YFT+   D++
Sbjct: 602 IALVGANGCGKTTLLKVMMEELRPTKGFVS------------RNGRLRIGYFTQHHVDSM 649

Query: 165 KAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLN-REIGKLS 223
              +    VD + +A  G              K  E  + ++ +  +   L  +++  LS
Sbjct: 650 D--LTTSAVDWMSKAYPG--------------KTDEEYRHHLGSFGITGTLGLQKMELLS 693

Query: 224 GGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSV 283
           GG+  R A    C+ +  + + DEPS++LD    L+A  ++  L   +  V+ V HD+S+
Sbjct: 694 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVESLKNFSGGVLMVSHDISI 750

Query: 284 LDYLSDFVCI 293
           +D++ + + +
Sbjct: 751 IDHVCNEIWV 760

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 85/222 (38%), Gaps = 39/222 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 266 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQELRGDETLALQSVLDADVWRK 325

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRME 196
               +E     R  E+    ++  ED+++     + +DN    +   + ++ E L   ME
Sbjct: 326 QLLSEEAKINERLKEMDKLRSEFEEDSLEV----KKLDNEREDLDKHLIQIDEKLA-DME 380

Query: 197 KDSETVKGYIKTLQL---EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
            D    +       L        +     SGG   R ++  +     D+ + DEPS+ LD
Sbjct: 381 SDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 440

Query: 254 VKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
           V    + A +   L T    V+ V HD + L+ ++    IIY
Sbjct: 441 VP---SIAYLAEYLKTYPSTVLTVSHDRAFLNEVA--TDIIY 477

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 80/183 (43%), Gaps = 35/183 (19%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGVIQSDE--------------NSEKVQKLNVSMKP-Q 420
           DS I  ++G NG GKTTL+K++   ++  +                  V  ++++     
Sbjct: 599 DSRI-ALVGANGCGKTTLLKVMMEELRPTKGFVSRNGRLRIGYFTQHHVDSMDLTTSAVD 657

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV- 479
            ++  +PG   + +   + G F        +   L +     Q+++ LSGG+  RVA   
Sbjct: 658 WMSKAYPGKTDEEYRHHL-GSF-------GITGTLGL-----QKMELLSGGQKSRVAFAA 704

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVI 539
           L L  P  I ++DEPS +LD+       + ++ F         +V HD  +  ++ +++ 
Sbjct: 705 LCLNNPH-ILVLDEPSNHLDTTGLDALVESLKNF----SGGVLMVSHDISIIDHVCNEIW 759

Query: 540 VFE 542
           V E
Sbjct: 760 VSE 762

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T   V HD
Sbjct: 409 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PSTVLTVSHD 464

Query: 528 FIMATYLADKVI 539
                 +A  +I
Sbjct: 465 RAFLNEVATDII 476

>AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W
           (HEF3) - SH] complement(291808..294942) [3135 bp, 1044
           aa]
          Length = 1044

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 83/185 (44%), Gaps = 13/185 (7%)

Query: 219 IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
           I  LSGG   + A+  + +++AD+ + DEP+++LD    +N A ++  L T     I V 
Sbjct: 541 IMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRL 338
           HD   LD +  ++    G+        L   V++         + A ++ F+     F L
Sbjct: 598 HDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASDLEFKFPEPGF-L 656

Query: 339 HDATEDTKG---EANKTFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENGTGKTTLI 394
                  K     +N +F+YP   + Q  D +        S S  + ++G NG GK+TLI
Sbjct: 657 EGVKTKQKAIVKVSNMSFQYPGTSKPQIADINFQC-----SLSSRIAVIGPNGAGKSTLI 711

Query: 395 KLLAG 399
            +L G
Sbjct: 712 NVLTG 716

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 76/163 (46%), Gaps = 9/163 (5%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQ 441
           + G NG GK+TL++ +A   Q D    + +   V ++      +   +V    F+   G 
Sbjct: 461 LCGPNGAGKSTLMRAIANG-QVDGFPTQDECRTVYVEHDIDGTQADTSVLDFVFQ---GD 516

Query: 442 FLSPQFQTDVVKPLKI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
             + +  T+ ++     D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+
Sbjct: 517 VGTREVITEKLREFGFSDEMIAMPIMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT 576

Query: 501 EQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEG 543
               +    +  ++     T+ +V HD      +   +I +EG
Sbjct: 577 ----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEG 615

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L ++V   +    TPS H
Sbjct: 948 IITHSAEFTKDLTEEVWAVKDGIMTPSGH 976

>Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement
          Length = 752

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 84/188 (44%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG 225
             +    VD + +   G   K  E  +  +     T    ++ +QL          LSGG
Sbjct: 610 --LNTSAVDWMSKTFPG---KTDEEYRRHLGAFGITGSLGLQKMQL----------LSGG 654

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLD 285
           +  R A    C+ +  + + DEPS++LD    L+A  +I  L   T  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LIDALKNFTGGVLMVSHDISVID 711

Query: 286 YLSDFVCI 293
           ++   + +
Sbjct: 712 HVCSEIWV 719

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 89/218 (40%), Gaps = 31/218 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G+  GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSE 200
           Q + +  + +E      K+ E+  +  ++ + +DN    +   ++++ E L + ME D  
Sbjct: 285 QLLSEESKINERLQEIEKLREEFDEDSLEVKKLDNEREDLDNHLEQISEKL-VDMESDKA 343

Query: 201 TVKGYIKTLQL---EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQR 257
             +       L        +     SGG   R ++  +     D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP-- 401

Query: 258 LNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
            + A +   L T    V+ V HD + L+ ++    IIY
Sbjct: 402 -SIAYLSEYLKTYPATVLVVSHDRAFLNEVA--TDIIY 436

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 79/184 (42%), Gaps = 37/184 (20%)

Query: 376 DSEILVMMGENGTGKTTLIKLLA-------GVIQSD---------ENSEKVQKLNVSMKP 419
           DS I  ++G NG GKTTL+K++        G +  +         ++      LN S   
Sbjct: 558 DSRI-ALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLRIGYFTQHHVDSMDLNTSA-V 615

Query: 420 QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479
             ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA  
Sbjct: 616 DWMSKTFPGKTDEEYRRHL-GAF-------GITGSLGL-----QKMQLLSGGQKSRVAFA 662

Query: 480 -LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKV 538
            L L  P  I ++DEPS +LD+         ++ F         +V HD  +  ++  ++
Sbjct: 663 ALCLNNPH-ILVLDEPSNHLDTAGLDALIDALKNFT----GGVLMVSHDISVIDHVCSEI 717

Query: 539 IVFE 542
            V E
Sbjct: 718 WVSE 721

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  VV HD
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVLVVSHD 423

Query: 528 FIMATYLADKVI 539
                 +A  +I
Sbjct: 424 RAFLNEVATDII 435

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 35/175 (20%)

Query: 382 MMGENGTGKTTLIKLL--------AGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQL 433
           ++G +G+GK+TL  L+          ++  D +   + + N+ ++  T+  + P     L
Sbjct: 385 VIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINR-NIILENITLVSQTP----TL 439

Query: 434 FFKKIRGQFLSPQFQTDVVKPLKID----------------DIIDQEVQH----LSGGEL 473
           F   IR   L+    T++   L+++                D +D  +      LSGG+ 
Sbjct: 440 FNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQA 499

Query: 474 QRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDF 528
           Q+VA+  A      I L+DEP + +D  QRI+  + I+R+   N KT  ++ HD 
Sbjct: 500 QKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRW--RNGKTTVIITHDL 552

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 221 KLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHD 280
           KLSGG+ Q+ A+  +  ++  + + DEP S +D++QR+   + I+        VI + HD
Sbjct: 493 KLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGKTTVI-ITHD 551

Query: 281 L 281
           L
Sbjct: 552 L 552

 Score = 33.1 bits (74), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 77/170 (45%), Gaps = 22/170 (12%)

Query: 349  ANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSE 408
            +N +F Y  +   +   +LT  +     ++I  ++G++G+GK+TLI L+ G+    E S 
Sbjct: 995  SNLSFTYAQVHNKK---TLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSI 1051

Query: 409  KVQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQFLSPQFQT-------DVVKPLKID 458
             +   +++        K    ++Q   L F  IR   L    +T       +V++ + + 
Sbjct: 1052 NICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLK 1111

Query: 459  DII-------DQEVQH--LSGGELQRVAIVLALGIPADIYLIDEPSAYLD 499
              I       D ++    LSGG+ QR+ +   +     + ++DE ++ LD
Sbjct: 1112 SFIISLNNGLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALD 1161

>Kwal_27.12711
          Length = 1246

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 87/206 (42%), Gaps = 33/206 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFDDPPEWQEIIKYFRGSELQNYFTK- 158
           G ++ ++G +G GK+T L +LA K    L   G F   PE         G    +Y T+ 
Sbjct: 46  GSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPE----TSSHSGEITTSYLTQQ 101

Query: 159 -MLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSE--TVKGYIKTLQLEHVL 215
            +L  N+      QY  +               LKL+  K      V+  I  L L+   
Sbjct: 102 DILASNLTCRETLQYAAD---------------LKLQSSKSERQGLVEELIAELGLKDCA 146

Query: 216 NREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTP 270
           N  +G      LSGGE +R +IG+  + +  +   DEP++ LD        + +R L   
Sbjct: 147 NTLVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVVRTLRKLSHK 206

Query: 271 --TKYVIAVEHDLSVLDYLSDFVCII 294
               +++++    + + +L D VCI+
Sbjct: 207 GGRSFIMSIHQPRADILFLLDQVCIM 232

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 21/190 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRFDDPPEWQEIIKYFRGSELQNYFTKM 159
           +P  +  ++G +G GKST L  L+GK     L  F+          +F  S++    T+ 
Sbjct: 674 QPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGS-----IFFNNSQV----TQD 724

Query: 160 LEDNIKAIIKPQYVDNI-PRAIKGPVQKVGELLKLRMEKDS---ETVKGYIKTLQLEHVL 215
           +  ++ + + PQ  D++ P+            L+L   K       V   I  L L+H  
Sbjct: 725 IFKDVCSFV-PQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCE 783

Query: 216 NREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDL-LT 269
           N  +G      +SGGE +R ++G   + D+ + + DEP+S LD        +++ ++   
Sbjct: 784 NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDSFTSFKILEVLTNISRK 843

Query: 270 PTKYVIAVEH 279
           P K VI   H
Sbjct: 844 PGKTVILTIH 853

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 38/160 (23%)

Query: 374 FSDSEILVMMGENGTGKTTLIKLLAG-----VIQSDENS-----------EKVQKLNVSM 417
           F    I  +MG +G+GK+TL+  L+G     V+ S E S           + + K   S 
Sbjct: 673 FQPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGSIFFNNSQVTQDIFKDVCSF 732

Query: 418 KPQTIAPKFPG-TVRQ--LFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQE---------- 464
            PQ      P  TVR+  LF   +R   +  + +       ++DD+I +           
Sbjct: 733 VPQDDDHLLPQLTVRETLLFAADLRLHHMKARNRIS-----RVDDLISELGLKHCENTLV 787

Query: 465 ----VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
               V+ +SGGE +R+++   L   + I L+DEP++ LDS
Sbjct: 788 GSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDS 827

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 81/187 (43%), Gaps = 35/187 (18%)

Query: 364 DFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIA 423
           D S+TV SG      I+ ++G +G+GKTTL+ +LA    S  +    Q+ +    P+T +
Sbjct: 38  DISMTVPSG-----SIMAIIGGSGSGKTTLLNVLA----SKMSKTLKQRGSFRFVPETSS 88

Query: 424 PKFPGTVRQLFFKKIRGQFLSP----QFQTD----------------VVKPLKIDDIIDQ 463
                T   L  + I    L+     Q+  D                ++  L + D  + 
Sbjct: 89  HSGEITTSYLTQQDILASNLTCRETLQYAADLKLQSSKSERQGLVEELIAELGLKDCANT 148

Query: 464 EVQH-----LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            V       LSGGE +R++I + +     +  +DEP+  LD+    +  + +R+ + H  
Sbjct: 149 LVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVVRTLRK-LSHKG 207

Query: 519 KTAFVVE 525
             +F++ 
Sbjct: 208 GRSFIMS 214

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
           complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 84/188 (44%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 562 IALVGANGCGKTTLLKVMMEQLRPITGHVSRNPRLR-----------IGYFTQHHIDSMD 610

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG 225
             +    VD + +   G   K  E  +  +     T    ++ +QL          LSGG
Sbjct: 611 --LNASAVDWMSKTFPG---KTDEEYRRHLGAFGITGSLGLQKMQL----------LSGG 655

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLD 285
           +  R A    C+    + + DEPS++LD    L+A  +++ L   +  V+ V HD+SV+D
Sbjct: 656 QKSRVAFAALCLNSPHILILDEPSNHLDTAG-LDA--LVQALKNFSGGVLMVSHDISVID 712

Query: 286 YLSDFVCI 293
            + D + +
Sbjct: 713 SVCDEIWV 720

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 94/221 (42%), Gaps = 37/221 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQ------------KPNLGRFDDPPEWQEII------ 144
           G+  GLVG NGIGKST L+ L+ ++            +  L R DD    Q ++      
Sbjct: 226 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQEL-RGDDTKVLQSVLDADVWR 284

Query: 145 KYFRGSELQNYFTKMLED--NIKA-----IIKPQYVDNIPRAIKGPVQKVGELLKLRMEK 197
           K     EL+    + L+D   ++A      ++ + +DN    ++  +Q++ E L   ME 
Sbjct: 285 KQLLSEELK--INERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAEKLA-DMES 341

Query: 198 DSETVKGYIKTLQL---EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDV 254
           D    +       L        +     SGG   R ++  +     D+ + DEPS+ LDV
Sbjct: 342 DKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDV 401

Query: 255 KQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
               + A +   L T    V+ V HD S L+ ++    IIY
Sbjct: 402 P---SIAYLAEYLKTYPATVLVVSHDRSFLNEVA--TDIIY 437

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 90/213 (42%), Gaps = 41/213 (19%)

Query: 352 TFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLL-------AGVIQSD 404
           +F Y   +    D +L V+     DS I  ++G NG GKTTL+K++        G +  +
Sbjct: 539 SFGYDESQLLLKDVNLDVQM----DSRI-ALVGANGCGKTTLLKVMMEQLRPITGHVSRN 593

Query: 405 ---------ENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPL 455
                    ++      LN S     ++  FPG   + + + + G F        +   L
Sbjct: 594 PRLRIGYFTQHHIDSMDLNASA-VDWMSKTFPGKTDEEYRRHL-GAF-------GITGSL 644

Query: 456 KIDDIIDQEVQHLSGGELQRVAIV-LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI 514
            +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+       + ++ F 
Sbjct: 645 GL-----QKMQLLSGGQKSRVAFAALCLNSPH-ILILDEPSNHLDTAGLDALVQALKNF- 697

Query: 515 LHNKKTAFVVEHDFIMATYLADKVIVFEGTPSK 547
                   +V HD  +   + D++ V E    K
Sbjct: 698 ---SGGVLMVSHDISVIDSVCDEIWVSESGTVK 727

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHD 527
            SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  VV HD
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVLVVSHD 424

Query: 528 FIMATYLADKVI 539
                 +A  +I
Sbjct: 425 RSFLNEVATDII 436

>Scas_712.29
          Length = 610

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 84/189 (44%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK   + ++
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVR 482

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG 225
                   D  P   +      G+L +  +  + +TV               ++G LS G
Sbjct: 483 --------DKYPNISQDFQYWRGQLGRYGLTGEGQTV---------------QMGTLSEG 519

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLD 285
           +  R    L  ++  +V + DEP++ LD+    + A+ I +       V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF---NGGVVVVSHDFRLLD 576

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 577 KIAKDIFVV 585

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 78/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQE--IIKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  E   ++Y    E QN 
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVV-REAQNE 165

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSETVKGYIKTLQLEHV 214
             K LED ++  I  +          GP  ++ E L  RM+  D +T +     + +   
Sbjct: 166 L-KRLEDLVEKYIVEE----------GPECELLEPLYERMDSLDPDTFESRAAVILIGLG 214

Query: 215 LN-----REIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
            N     ++   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 215 FNSKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 12/101 (11%)

Query: 461 IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
           I ++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T
Sbjct: 220 ILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRT 275

Query: 521 AFVVEH--DFI------MATYLADKVIVFEGTPSKHANARA 553
             +V H  DF+      M    A K+  + G    +   R+
Sbjct: 276 LVLVSHSQDFLNGVCTNMLDMRAQKLTAYGGNYDSYWKTRS 316

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 93/222 (41%), Gaps = 48/222 (21%)

Query: 370 ESGDFS---DSEILVMMGENGTGKTTLIKLLAGVI--QSDENSEKVQ-KLNV-SMKPQT- 421
           E+ DF    DS I  ++G NG GK+TL+K++ G +  QS   S     KL V S   Q  
Sbjct: 412 ENLDFGVDMDSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQ 470

Query: 422 ----------IAPKFPGTVRQLFFKKIRGQF----LSPQFQTDVVKPLKIDDIIDQEVQH 467
                     +  K+P   +   F+  RGQ     L+ + QT              ++  
Sbjct: 471 LDLTKSALEFVRDKYPNISQD--FQYWRGQLGRYGLTGEGQT-------------VQMGT 515

Query: 468 LSGGELQRVAI-VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH 526
           LS G+  RV   +LAL  P ++ L+DEP+  LD       ++ I  F         VV H
Sbjct: 516 LSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLAEAINEF----NGGVVVVSH 570

Query: 527 DFIMATYLADKVIVFEGTPSKHANARAPESLLTGCNRFLKNL 568
           DF +   +A  + V E   +   N     S+L    +  KN+
Sbjct: 571 DFRLLDKIAKDIFVVENKTATRWNG----SILEYKTKLAKNV 608

>Kwal_0.327
          Length = 1019

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 83/182 (45%), Gaps = 29/182 (15%)

Query: 371 SGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTV 430
           SG     EI+ +MG +G GKTTL+ +LA   ++ + S  + K+N S   +    K  G V
Sbjct: 389 SGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSI-KINGSEITKQNLSKIAGFV 447

Query: 431 RQLFF--------------------KKIRGQFLSPQFQT-DVVKPLKIDDIIDQEV---- 465
            Q  F                    +K+   F+  Q +   V++ L+I DI D+ +    
Sbjct: 448 DQENFLLPTLTVYETVLNSALLRLPRKL--SFVQKQKRVYQVLEELRILDIKDRIIGDDL 505

Query: 466 -QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVV 524
            + +SGGE +RV+I   L     +  +DEP++ LDS       + + R  LH  +T  + 
Sbjct: 506 ERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLILS 565

Query: 525 EH 526
            H
Sbjct: 566 IH 567

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 84/210 (40%), Gaps = 32/210 (15%)

Query: 69  AITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQK 128
            +T  N+  N+      R  +N        + +PG+++ L+G +G GK+T L ILA K K
Sbjct: 365 TLTFENIEYNIRSEKGERMILNGIS----GSVKPGEIMALMGGSGAGKTTLLDILAMKDK 420

Query: 129 PNLGRFDDPPEWQEIIKYFRGS-----ELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGP 183
                        EI K          + +N+    L   +   +    +  +PR     
Sbjct: 421 AGKASGSIKINGSEITKQNLSKIAGFVDQENFLLPTL--TVYETVLNSALLRLPR----- 473

Query: 184 VQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQ 238
                   KL   +  + V   ++ L++  + +R IG      +SGGE +R +I    V 
Sbjct: 474 --------KLSFVQKQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVT 525

Query: 239 DADVYMFDEPSSYLDVKQRLNAAQIIRDLL 268
              V   DEP+S LD     NA  +I  L+
Sbjct: 526 SPSVLFLDEPTSGLDSN---NANNVIECLV 552

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 101/235 (42%), Gaps = 39/235 (16%)

Query: 70  ITIINLPTNLEQHVTHRYSVNSFKLHRLPTPR----------PGQVLGLVGTNGIGKSTA 119
           IT++    +LE   T  Y+  + K+      +          PG +  ++G +G GKS+ 
Sbjct: 669 ITVVAQDVDLEVKYTKLYNRKNHKIFEYENKKILQNVSAVFKPGMINAIMGPSGSGKSSF 728

Query: 120 LKILAGKQKPNLG---------RFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKP 170
           L +++G+ + +L          + +D P  Q++ K+      Q+      +D++ A++  
Sbjct: 729 LNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSYVSQD------DDHLLAMLTV 782

Query: 171 QYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK-----LSGG 225
           +   +   A++        L  L  +         I  L L+H  N  IG      +SGG
Sbjct: 783 RETFDFAAALR--------LKHLSKDDKRSRTDSLIAILGLKHCENTIIGNEFIKGISGG 834

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTP-TKYVIAVEH 279
           E +R ++G+  + D  + + DEP+S LD        +I+ +L +   K VI   H
Sbjct: 835 EKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTILEILENLCSEHNKTVILTIH 889

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 89/218 (40%), Gaps = 13/218 (5%)

Query: 90  NSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYF- 147
           +S  +H L    P G V+ ++G +G GK+T L +LA K    L    +     E  K   
Sbjct: 34  DSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNV 93

Query: 148 --RGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSET--VK 203
               SE         ++N+     PQ      R            LKL   K  +T  V 
Sbjct: 94  DDSSSEASFDLNATYKENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIVN 153

Query: 204 GYIKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRL 258
             I  L L+   +  +G      LSGGE +R ++G   V +  V   DEP++ LD     
Sbjct: 154 QLIDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAY 213

Query: 259 NAAQIIRDLLTPT--KYVIAVEHDLSVLDYLSDFVCII 294
              + ++ L       +++++    S + +L D+VCI+
Sbjct: 214 LVVKTLKKLAKEDGRTFILSIHQPRSDILFLFDYVCIL 251

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 75/194 (38%), Gaps = 38/194 (19%)

Query: 371 SGDFSDSEILVMMGENGTGKTTLIKLLAGVIQS--------------------DENSEKV 410
           S D     ++ +MG +G+GKTTL+ +LA  I S                    D +SE  
Sbjct: 42  SLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNVDDSSSEAS 101

Query: 411 QKLNVSMKPQTIAPKFPG--------TVRQLFFKKIRGQFLSPQFQTDVVKPLKIDD--- 459
             LN + K        P         T R+        +  + + +  ++    ID+   
Sbjct: 102 FDLNATYKENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIVNQLIDELGL 161

Query: 460 -------IIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRR 512
                  + D   + LSGGE +R+++   +     +  +DEP+  LD+    +  K +++
Sbjct: 162 KDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKTLKK 221

Query: 513 FILHNKKTAFVVEH 526
               + +T  +  H
Sbjct: 222 LAKEDGRTFILSIH 235

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 85/208 (40%), Gaps = 40/208 (19%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE---- 405
           +K FEY   K  Q        S  F    I  +MG +G+GK++ + L++G ++S      
Sbjct: 691 HKIFEYENKKILQN------VSAVFKPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKF 744

Query: 406 NSEKVQKLNVSMKPQTIAPKFPGTVRQ-----LFFKKIRGQFLSPQFQTDV-VKPLKIDD 459
           N+    KLN +   Q +       V Q     L    +R  F    F   + +K L  DD
Sbjct: 745 NTAGTIKLNDTPISQDMFKHLCSYVSQDDDHLLAMLTVRETF---DFAAALRLKHLSKDD 801

Query: 460 --------------------IIDQE-VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYL 498
                               II  E ++ +SGGE +RV++ + L     I L+DEP++ L
Sbjct: 802 KRSRTDSLIAILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGL 861

Query: 499 DSEQRIICSKVIRRFILHNKKTAFVVEH 526
           DS       +++      + KT  +  H
Sbjct: 862 DSFTSSTILEILENLCSEHNKTVILTIH 889

>YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongation
           factor EF-3A, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 85/194 (43%), Gaps = 31/194 (15%)

Query: 219 IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
           I  LSGG   + A+  + +++AD+ + DEP+++LD    +N A ++  L T     I + 
Sbjct: 541 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 597

Query: 279 HDLSVLDYLSDFVCIIYGVP--SVYGVVT-------LPSSVREGINIFLDGHIPA----E 325
           HD   LD + +++    G+      G  T          +  E  N  L+   P     E
Sbjct: 598 HDSVFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKFPEPGYLE 657

Query: 326 NIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGE 385
            ++ + +A+               N  F+YP   + Q    +T  +   S S  + ++G 
Sbjct: 658 GVKTKQKAIV-----------KVTNMEFQYPGTSKPQ----ITDINFQCSLSSRIAVIGP 702

Query: 386 NGTGKTTLIKLLAG 399
           NG GK+TLI +L G
Sbjct: 703 NGAGKSTLINVLTG 716

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 73/160 (45%), Gaps = 7/160 (4%)

Query: 384 GENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFL 443
           G NG GK+TL++ +A   Q D    + +   V ++          +V    F+   G   
Sbjct: 463 GPNGCGKSTLMRAIANG-QVDGFPTQEECRTVYVEHDIDGTHSDTSVLDFVFES--GVGT 519

Query: 444 SPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQR 503
               +  +++    D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+   
Sbjct: 520 KEAIKDKLIEFGFTDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT--- 576

Query: 504 IICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEG 543
            +    +  ++     T+  + HD +    + + +I +EG
Sbjct: 577 -VNVAWLVNYLNTCGITSITISHDSVFLDNVCEYIINYEG 615

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEF----EGGVI 947

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L ++V   +    TPS H
Sbjct: 948 IITHSAEFTKNLTEEVWAVKDGRMTPSGH 976

>Kwal_33.15561
          Length = 1297

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 30/185 (16%)

Query: 364  DFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIA 423
            + SL V+ G     EI+ ++G +G+GK+TL  LL  +   +  S  +   +++   +   
Sbjct: 1079 NLSLKVDRG-----EIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKAL 1133

Query: 424  PKFPGTVRQ--LFF-------------KKIRGQFLSPQFQT----DVVK--PLKIDDIID 462
                  V Q  LFF             +K+  + ++    T    + V   P ++  +ID
Sbjct: 1134 RSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVID 1193

Query: 463  QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
               Q LSGG++QR+AIV AL     + ++DE ++ LD+    I S+ ++  + H   T  
Sbjct: 1194 --TQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHT--TTL 1249

Query: 523  VVEHD 527
            VV H 
Sbjct: 1250 VVTHS 1254

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 29/188 (15%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
            G+++GL+GT+G GKST   +L        G                G+++  +  K L  
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLYPVENGSIS-----------IDGTDINQWDRKALRS 1135

Query: 163  NIKAI-IKPQYVDN--IPRAIKGPVQKVGE------LLKLRM-EKDSETVKGYIKTLQLE 212
             I  +  KP +     I     G ++KV +      LL L M E  + T K      +L 
Sbjct: 1136 CIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPK------RLH 1189

Query: 213  HVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTK 272
             V++ ++  LSGG++QR AI  + ++   + + DE +S LD +     ++ ++  L  T 
Sbjct: 1190 SVIDTQL--LSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHTT 1247

Query: 273  YVIAVEHD 280
             ++    +
Sbjct: 1248 TLVVTHSE 1255

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 93/205 (45%), Gaps = 36/205 (17%)

Query: 350 NKTFEYPAMKR--TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLL-------AGV 400
           N +F YP+  +     + +L V  G F+      ++G++G+GK+T+  LL       +G+
Sbjct: 364 NVSFAYPSRSKHPVIKNLNLKVPGGRFT-----FIVGKSGSGKSTISNLLLKLYRPCSGL 418

Query: 401 IQSDENSEKVQKLN-------VSMKPQTIAPKFPGTVR---QLFFKKIR-----GQFLSP 445
           I+   N   ++++N       +++  Q  +P F  +++   QL   + R      Q    
Sbjct: 419 IKV--NDVDIREINQQDLFRSITLVEQN-SPLFEDSIKNNIQLTSDEHRDDGRLSQACQA 475

Query: 446 QFQTDVVKPLK--IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQR 503
                V++ L   +D II      LSGGE QRVA+  A    + I ++DE  +  D   +
Sbjct: 476 AMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHK 535

Query: 504 IICSKVIRRFILHNKKTAFVVEHDF 528
            +  + IR +     +T  ++ H+ 
Sbjct: 536 DLLMEAIRFW--RKGRTTIILTHEL 558

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 88/197 (44%), Gaps = 19/197 (9%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFDDPPEWQEIIKYFRGSELQNYFTKML 160
           G+   +VG +G GKST   +L    +P  G  + +D       I+     +L    T ++
Sbjct: 388 GRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVD-----IREINQQDLFRSIT-LV 441

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQ--LEHVLNRE 218
           E N      P + D+I   I+    +  +  +L     +  ++G I+ L   L+ ++   
Sbjct: 442 EQN-----SPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSS 496

Query: 219 IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
              LSGGE QR A+  + V+D+ + + DE  S  D   +    + IR      +  I + 
Sbjct: 497 GVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAIR-FWRKGRTTIILT 555

Query: 279 HDLSVLDYLS-DFVCII 294
           H+L+  D L  DFV ++
Sbjct: 556 HELN--DILEDDFVLLM 570

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RFDDPPEWQEIIKYFRGSELQNY 155
           RPG++L ++G  G G ST LK +AG+     G      +D   + ++++KYF+   + N 
Sbjct: 169 RPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQ-KDMLKYFKSDVIYN- 226

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKG-YIKTLQLEHV 214
               ++ +   +   Q +D    A K P +++ +  +   ++  E ++  Y     L+H 
Sbjct: 227 --GEMDVHFPHLTVQQTLD-FAVACKTPSKRINDFTR---QQYIEFIRDLYATIFGLKHT 280

Query: 215 LNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR---D 266
            N ++G      +SGGE +R +I  +      +Y +D  +  LD    L   + IR   +
Sbjct: 281 YNTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTN 340

Query: 267 LLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
           LL  T  +   +   ++ +   D V I+Y    +Y
Sbjct: 341 LLKSTALITVYQASENIYETF-DKVTILYEGKQIY 374

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 86/205 (41%), Gaps = 45/205 (21%)

Query: 378 EILVMMGENGTGKTTLIKLLAGV----------IQSDENSEK------------------ 409
           E+L+++G  G+G +T +K +AG           I  D  S+K                  
Sbjct: 172 EMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYFKSDVIYNGEMDV 231

Query: 410 -------VQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIID 462
                   Q L+ ++  +T + +     RQ + + IR  + +  F        K+ D   
Sbjct: 232 HFPHLTVQQTLDFAVACKTPSKRINDFTRQQYIEFIRDLY-ATIFGLKHTYNTKVGDDF- 289

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
             V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K TA 
Sbjct: 290 --VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTAL 347

Query: 523 VVEH---DFIMATYLADKV-IVFEG 543
           +  +   + I  T+  DKV I++EG
Sbjct: 348 ITVYQASENIYETF--DKVTILYEG 370

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 75/172 (43%), Gaps = 38/172 (22%)

Query: 371  SGDFSDSEILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQK 412
            SG      +  +MGE+G GKTTL+  LA     GV+  D               +  VQ+
Sbjct: 860  SGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIGVVTGDMLVNGKPIDASFERRTGYVQQ 919

Query: 413  LNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSP-QFQTDVVKPLKIDDIIDQEV--QHLS 469
             +V +K  T+           F  ++R     P + + D V+  K+ +I+D     + L 
Sbjct: 920  QDVHIKEMTVRESLQ------FSARMRRPLTVPDEEKLDYVE--KVIEILDMSAYGEALV 971

Query: 470  GG--------ELQRVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRR 512
            G         + ++++I + L   P  +  +DEP++ LDS+      +++++
Sbjct: 972  GNIGYGLNVEQRKKLSIAVELVAKPNLLLFLDEPTSGLDSQSAWAIVQLLKK 1023

>CAGL0C02343g 236840..238672 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 610

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 86/188 (45%), Gaps = 27/188 (14%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKA 166
            LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK    +   
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGV-YSQHSQDQLDLTK----SALE 479

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGE 226
            ++ +Y  NI +  +      G+L +  +  D++ V               ++G LS G+
Sbjct: 480 FVRDKY-SNISQDFQ---YWRGQLGRYGLTGDAQKV---------------QMGTLSEGQ 520

Query: 227 LQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDY 286
             R    L  +++ +V + DEP++ LD+    + A  I +       V+ V HD  +LD 
Sbjct: 521 RSRVVFALLALENPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLDK 577

Query: 287 LSDFVCII 294
           ++  + ++
Sbjct: 578 IAKDIFVV 585

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  
Sbjct: 222 KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLV 277

Query: 523 VVEH--DFI 529
           +V H  DF+
Sbjct: 278 LVSHSQDFL 286

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 76/166 (45%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDP--PEWQEIIKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA ++ P     ++   D+P  P     ++Y    E QN 
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVV-REAQNE 165

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRME-KDSETVKGYIKTLQLEHV 214
             K +ED ++ II             GP  ++ + L  RM+  D  T +     + +   
Sbjct: 166 L-KRVEDLVEKIILED----------GPESELLDPLYERMDGMDPSTFESRAAVILIGLG 214

Query: 215 LN-----REIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
            N     ++   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 215 FNSQTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 75/168 (44%), Gaps = 12/168 (7%)

Query: 381 VMMGENGTGKTTLIKLLAGVI--QSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKI 438
            ++G NG GK+TL+K++ G +  QS   S     + + +  Q    +   T   L F + 
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTH-VKLGVYSQHSQDQLDLTKSALEFVRD 483

Query: 439 RGQFLSPQFQTDVVKPLKIDDIID-QEVQH--LSGGELQRVAI-VLALGIPADIYLIDEP 494
           +   +S  FQ    +  +     D Q+VQ   LS G+  RV   +LAL  P ++ L+DEP
Sbjct: 484 KYSNISQDFQYWRGQLGRYGLTGDAQKVQMGTLSEGQRSRVVFALLALENP-NVLLLDEP 542

Query: 495 SAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
           +  LD       +  I  F         VV HDF +   +A  + V E
Sbjct: 543 TNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVVE 586

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
           the ATP-binding cassette (ABC) superfamily, has
           similarity to Drosophila white protein [3885 bp, 1294
           aa]
          Length = 1294

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 87/179 (48%), Gaps = 24/179 (13%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRFDDPPEWQEIIKYFRGSELQN--YFT 157
           +PG +  ++G +G GKS+ L +++G+ K ++  +FD             GS + N    +
Sbjct: 718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTS-----------GSIMFNDIQVS 766

Query: 158 KMLEDNIKAIIKPQYVDNIPRAIK-GPVQKVGELLKLRMEKDSETVK---GYIKTLQLEH 213
           +++  N+ + +  Q  D++  A+      K    L+L    ++E ++     I++L L+H
Sbjct: 767 ELMFKNVCSYVS-QDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRSLGLKH 825

Query: 214 VLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDL 267
             N  IG      +SGGE +R  +G+  + D  + + DEP+S LD        +I+  L
Sbjct: 826 CENNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKL 884

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 100/233 (42%), Gaps = 30/233 (12%)

Query: 89  VNSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RF------DDP 137
           VN+F +  LP+   G V+ ++G +G GK+T L +LA K    L      R+       +P
Sbjct: 45  VNTFSMD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEP 100

Query: 138 PEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK 197
            E +    +  G +        ++ ++     PQ     PR       K    LKL   +
Sbjct: 101 NETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSE 154

Query: 198 DSE--TVKGYIKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSS 250
            ++   V+  I+ L L+   +  +G      LSGGE +R +IG   + +  +   DEP++
Sbjct: 155 RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTT 214

Query: 251 YLDVKQRLNAAQIIRDLLTPT--KYVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
            LD        + ++ L       +++++    S + +L D VCI+     VY
Sbjct: 215 GLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVY 267

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 82/211 (38%), Gaps = 47/211 (22%)

Query: 371 SGDFSDSEILVMMGENGTGKTTLIKLLAGVIQ---SDENSEKVQKLNVSMKPQTIAPK-- 425
           S D     ++ +MG +G+GKTTL+ +LA  I    +   S +    +   +P    PK  
Sbjct: 49  SMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNETEPKRA 108

Query: 426 ------FPGTVRQLFFKKIRGQFLSP--------QFQTDV-------VKPLKIDDII--- 461
                  P     +     +   LSP        +F  D+        K L ++ +I   
Sbjct: 109 HLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSERTKKLMVEQLIEEL 168

Query: 462 -----------DQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
                      D   + LSGGE +R++I   +     I  +DEP+  LD+    +  K +
Sbjct: 169 GLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTL 228

Query: 511 RRFILHNKKTAFVVEHDFIMATYLADKVIVF 541
           ++    + +T       FIM+ +     I+F
Sbjct: 229 KKLAKEDGRT-------FIMSIHQPRSDILF 252

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 458 DDIIDQE-VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 516
           ++II  E V+ +SGGE +RV + + L     I L+DEP++ LDS       +++ +    
Sbjct: 828 NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCRE 887

Query: 517 NKKTAFVVEH 526
             KT  +  H
Sbjct: 888 QGKTIIITIH 897

>Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement
          Length = 608

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDNI 164
           + LVG NG+GKST LKI+ G+  P  GR              R + ++   +++  +D +
Sbjct: 422 IALVGPNGVGKSTLLKIMTGQLMPQSGRVS------------RHTHVKLGVYSQHSQDQL 469

Query: 165 KAIIKP-QYV-DNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKL 222
                P ++V D  P   +      G+L +  +  +++T                ++G L
Sbjct: 470 DLTKSPLEFVRDKYPNISQDFQYWRGQLGRYGLTGEAQT---------------SQMGTL 514

Query: 223 SGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLS 282
           S G+  R    L  ++  +V + DEP++ LD+    + A  I +       V+ V HD  
Sbjct: 515 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFR 571

Query: 283 VLDYLSDFVCII 294
           +LD ++  + ++
Sbjct: 572 LLDKIAQDIFVV 583

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E+    +  +E QN  
Sbjct: 105 GRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNEL 164

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSETVKGYIKTLQL---- 211
            K LED ++ II             GP  ++ E L  +M+  D  T +     + +    
Sbjct: 165 -KRLEDLVEKIILED----------GPESELLEPLYEKMDSMDPNTFESRAAVILIGLGF 213

Query: 212 -EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
               + ++   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 214 NSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 258

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 91/213 (42%), Gaps = 45/213 (21%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGVI--QSDENSEKVQ------------KLNVSMKP-Q 420
           DS I  ++G NG GK+TL+K++ G +  QS   S                +L+++  P +
Sbjct: 419 DSRI-ALVGPNGVGKSTLLKIMTGQLMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLE 477

Query: 421 TIAPKFPGTVRQLFFKKIRGQF----LSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRV 476
            +  K+P   +   F+  RGQ     L+ + QT              ++  LS G+  RV
Sbjct: 478 FVRDKYPNISQD--FQYWRGQLGRYGLTGEAQT-------------SQMGTLSEGQRSRV 522

Query: 477 AI-VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLA 535
              +LAL  P ++ L+DEP+  LD       +  I  F         VV HDF +   +A
Sbjct: 523 VFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIA 577

Query: 536 DKVIVFEGTPSKHANARAPESLLTGCNRFLKNL 568
             + V E   +   N     S+L   N+  KN+
Sbjct: 578 QDIFVVEHKTATRWNG----SILDYKNKLAKNV 606

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 81/179 (45%), Gaps = 35/179 (19%)

Query: 382 MMGENGTGKTTLIKLLA----------GVIQSDENSE--KVQKLN-VSMKPQTIAPKFPG 428
           ++GENG GK+T +K +A           V   DE +E  ++  L+ V  + Q    +   
Sbjct: 110 LLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNELKRLED 169

Query: 429 TVRQLFFKK-IRGQFLSPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 472
            V ++  +     + L P ++  D + P   +                I ++ + +SGG 
Sbjct: 170 LVEKIILEDGPESELLEPLYEKMDSMDPNTFESRAAVILIGLGFNSKTITKKTKDMSGGW 229

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 284

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
            transporter responsible for export of a factor mating
            pheromone, member of ATP-binding cassette (ABC)
            superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 82/183 (44%), Gaps = 24/183 (13%)

Query: 350  NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEK 409
            N TF YP+       F     + D    + L ++GE+GTGK+TL+ LL  +   +    K
Sbjct: 1056 NLTFAYPSAPTA---FVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIK 1112

Query: 410  VQKLNVSMKPQTIAPK-----------FPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKID 458
            +   +V+    T   K           F GT+R      ++ + L  +   D +K + I 
Sbjct: 1113 IDGTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMY-DALKYVGIH 1171

Query: 459  DIIDQEVQHL---------SGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKV 509
            D +    Q L         SGG+ QR+ I  AL   + I ++DE ++ LDS    I +++
Sbjct: 1172 DFVISSPQGLDTRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEI 1231

Query: 510  IRR 512
            +++
Sbjct: 1232 VKK 1234

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 91/233 (39%), Gaps = 44/233 (18%)

Query: 330 RSEALQFRLHDATEDTKGEANKTFEYPA--MKRTQGDFSLTVESGDFSDSEILVMMGENG 387
           ++ A QF L  AT D    AN +F YP+   +    + SL   +G F+      ++G++G
Sbjct: 342 KTVAHQFPLDYATSDLTF-ANVSFSYPSRPSEAVLKNVSLNFSAGQFT-----FIVGKSG 395

Query: 388 TGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQFLS 444
           +GK+TL  LL         S  +   N+    Q +  +    V Q   LF   +R   L 
Sbjct: 396 SGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILL 455

Query: 445 PQFQTDVVK-----------------------------PLKIDDIIDQEVQHLSGGELQR 475
               TD V+                             P  ++ +I      LSGG+ QR
Sbjct: 456 GS--TDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQR 513

Query: 476 VAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDF 528
           VAI  A      I  +DE  + LD   R +  K IR +     KT  ++ H+ 
Sbjct: 514 VAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHW--RKGKTTIILTHEL 564

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDL 281
           LSGG+ QR AI  + ++D  +   DE  S LD+  R    + IR      K  I + H+L
Sbjct: 506 LSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRH-WRKGKTTIILTHEL 564

Query: 282 SVL---DYL 287
           S +   DYL
Sbjct: 565 SQIESDDYL 573

>Scas_566.1
          Length = 466

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 97/222 (43%), Gaps = 18/222 (8%)

Query: 89  VNSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFR 148
           VNSF L  LP+   G V+ ++G +G GK+T L +LA K    L + D    +    K  R
Sbjct: 67  VNSFSLD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGL-KTDGDIHYILEEKPQR 121

Query: 149 GSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSE--TVKGYI 206
            SE +    + ++D++K    PQ      R            LKL   K+ +   V   I
Sbjct: 122 DSEQE----QEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLI 177

Query: 207 KTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAA 261
             L L+      +G      LSGGE +R ++G   + +  +   DEP++ LD        
Sbjct: 178 HELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVV 237

Query: 262 QIIRDLLTPT--KYVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
           + ++ L       +++++    S + +L D VCI+     VY
Sbjct: 238 KTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVY 279

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 89/207 (42%), Gaps = 42/207 (20%)

Query: 365 FSLTVESGDFSDSEILVMMGENGTGKTTLIKLLA----GVIQSD------------ENSE 408
           FSL + SG      ++ +MG +G+GKTTL+ +LA    G +++D             +SE
Sbjct: 70  FSLDLPSG-----SVMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQRDSE 124

Query: 409 KVQKLNVSMK----PQTIAPKFPGTVRQLF-----FKKIRGQFLSPQFQTDVVKPLKIDD 459
           + Q++   +K    PQ        T R+        K  R +         ++  L + D
Sbjct: 125 QEQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIHELGLKD 184

Query: 460 -----IIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI 514
                + D   + LSGGE +R+++   +     I  +DEP+  LD+    +  K +++  
Sbjct: 185 CAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLA 244

Query: 515 LHNKKTAFVVEHDFIMATYLADKVIVF 541
             + +T       FIM+ +     I+F
Sbjct: 245 KEDGRT-------FIMSIHQPRSDILF 264

>YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a protein
           complex required for activation of Gcn2p protein kinase
           in response to amino acid starvation, member of the
           non-transporter group within the ATP-binding cassette
           (ABC) superfamily [2259 bp, 752 aa]
          Length = 752

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 81/181 (44%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LKI+  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLN-REIGKLSG 224
             +    VD + ++  G              K  E  + ++ +  +   L  +++  LSG
Sbjct: 610 --LTTSAVDWMSKSFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVL 284
           G+  R A    C+ +  + + DEPS++LD    L+A  ++  L      V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVEALKNFNGGVLMVSHDISVI 710

Query: 285 D 285
           D
Sbjct: 711 D 711

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 82/193 (42%), Gaps = 43/193 (22%)

Query: 376 DSEILVMMGENGTGKTTLIKL-------LAGVIQSDE-------NSEKVQKLNVSMKP-Q 420
           DS I  ++G NG GKTTL+K+       L G +  +            V  ++++     
Sbjct: 558 DSRI-ALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLRIGYFTQHHVDSMDLTTSAVD 616

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV- 479
            ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA   
Sbjct: 617 WMSKSFPGKTDEEYRRHL-GSF-------GITGTLGL-----QKMQLLSGGQKSRVAFAA 663

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVI 539
           L L  P  I ++DEPS +LD+       + ++ F         +V HD  +   +  ++ 
Sbjct: 664 LCLNNPH-ILVLDEPSNHLDTTGLDALVEALKNF----NGGVLMVSHDISVIDSVCKEIW 718

Query: 540 V--------FEGT 544
           V        FEGT
Sbjct: 719 VSEQGTVKRFEGT 731

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 91/224 (40%), Gaps = 43/224 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQ------------KPNLGRFDDPPEWQEIIKYFRGS 150
           G   GLVG NGIGKST L+ L+ ++            +  L R DD    Q ++      
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQEL-RGDDTKALQSVL------ 277

Query: 151 ELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQ 210
           +   +  ++L +  K   + + +D + +  +    +V +L   R + D+  ++   K + 
Sbjct: 278 DADVWRKQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLDNHLIQISDKLVD 337

Query: 211 LE-------------------HVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSY 251
           +E                       +     SGG   R ++  +     D+ + DEPS+ 
Sbjct: 338 MESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNM 397

Query: 252 LDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
           LDV    + A +   L T    V+ V HD + L+ ++    IIY
Sbjct: 398 LDVP---SIAYLAEYLKTYPNTVLTVSHDRAFLNEVA--TDIIY 436

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PNTVL 418

Query: 523 VVEHDFIMATYLADKVI 539
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>Kwal_34.16240
          Length = 752

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 83/188 (44%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LKIL  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLRVA-----------YFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG 225
             +    VD +     G   K  E  +  +     T    ++ +QL          LSGG
Sbjct: 610 --LNTSAVDWMSTTFPG---KTDEEYRRHLGAFGITGSLGLQKMQL----------LSGG 654

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLD 285
           +  R A    C+ +  + + DEPS++LD    L+A  ++  L   T  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LMDALKKFTGGVLMVSHDISVID 711

Query: 286 YLSDFVCI 293
            + + + +
Sbjct: 712 GVCNEIWV 719

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 90/222 (40%), Gaps = 39/222 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   G+VG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGIVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALNSVLDADVWRK 284

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRME 196
               +E     R  E++   ++  ED++++    + +DN    ++  ++++ E L + ME
Sbjct: 285 QLLSEESKINERLQEIEKLRSEFEEDSLES----KKLDNEREDLESHLEQISEKL-IDME 339

Query: 197 KDSETVKGYIKTLQL---EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
            D    +       L        +     SGG   R ++  +     D+ + DEPS+ LD
Sbjct: 340 SDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 399

Query: 254 VKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
           V    + A +   L T    V+ V HD + L+ ++    IIY
Sbjct: 400 VP---SIAYLSEYLKTYPATVVVVSHDRAFLNEVA--TDIIY 436

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 85/200 (42%), Gaps = 45/200 (22%)

Query: 376 DSEILVMMGENGTGKTTLIKLL-------AGVIQSD---------ENSEKVQKLNVSMKP 419
           DS I  ++G NG GKTTL+K+L        G +  +         ++      LN S   
Sbjct: 558 DSRI-ALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLRVAYFTQHHVDSMDLNTSA-V 615

Query: 420 QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479
             ++  FPG   + + + + G F        +   L +     Q++Q LSGG+  RVA  
Sbjct: 616 DWMSTTFPGKTDEEYRRHL-GAF-------GITGSLGL-----QKMQLLSGGQKSRVAFA 662

Query: 480 -LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKV 538
            L L  P  I ++DEPS +LD+         +++F         +V HD  +   + +++
Sbjct: 663 ALCLNNPH-ILVLDEPSNHLDTAGLDALMDALKKFT----GGVLMVSHDISVIDGVCNEI 717

Query: 539 IV--------FEGTPSKHAN 550
            V        FEGT   + N
Sbjct: 718 WVSENGTVKRFEGTIFDYKN 737

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVV 418

Query: 523 VVEHDFIMATYLADKVI 539
           VV HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (44%), Gaps = 33/193 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 ISLVGANGCGKTTLLKVMMEQLRPTKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGY--IKTLQLEHVLNREIGKLS 223
             +    VD +  A  G   +     + R    +  + G   I+ +QL          LS
Sbjct: 610 --LNQSAVDWMSTAFPGKTDE-----EYRRHLGAFGISGSLGIQRMQL----------LS 652

Query: 224 GGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSV 283
           GG+  R A    C+ +  + + DEPS++LD    L+A  ++  L +    V+ V HD+SV
Sbjct: 653 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LVDALKSFNGGVLMVSHDISV 709

Query: 284 LDYLSDFVCIIYG 296
           ++ + + + +  G
Sbjct: 710 INSVCNEIWVSEG 722

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 97/218 (44%), Gaps = 31/218 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQN------YF 156
           G+  GLVG NGIGKST LK L+ +++ N+ +       ++ I+      LQ+      + 
Sbjct: 225 GRRYGLVGQNGIGKSTLLKALS-RRELNVPKHISVLHVEQEIRGDETKALQSVLDADVWR 283

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGEL------LKLRMEK------DSETVKG 204
            ++L +  K   + Q ++N+ +       +V +L      L+  +E+      D E+ K 
Sbjct: 284 KQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISEKLIDMESDKA 343

Query: 205 YIKTLQLEHVL-------NREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQR 257
             +   + + L        +     SGG   R ++  +     D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP-- 401

Query: 258 LNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
            + A +   L T    V+ V HD + L+ ++    IIY
Sbjct: 402 -SIAYLAEYLKTYPATVLVVSHDRAFLNEVA--TDIIY 436

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 87/208 (41%), Gaps = 39/208 (18%)

Query: 352 TFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE------ 405
           +F Y        D +L V+     DS I  ++G NG GKTTL+K++   ++  +      
Sbjct: 538 SFSYKESDPLLTDVNLDVQM----DSRI-SLVGANGCGKTTLLKVMMEQLRPTKGFVSRN 592

Query: 406 --------NSEKVQKLNVSMKP-QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLK 456
                       V  ++++      ++  FPG   + + + + G F        +   L 
Sbjct: 593 PRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRRHL-GAF-------GISGSLG 644

Query: 457 IDDIIDQEVQHLSGGELQRVAIV-LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
           I     Q +Q LSGG+  RVA   L L  P  I ++DEPS +LD+         ++ F  
Sbjct: 645 I-----QRMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTAGLDALVDALKSF-- 696

Query: 516 HNKKTAFVVEHDFIMATYLADKVIVFEG 543
                  +V HD  +   + +++ V EG
Sbjct: 697 --NGGVLMVSHDISVINSVCNEIWVSEG 722

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVL 418

Query: 523 VVEHDFIMATYLADKVI 539
           VV HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>Kwal_33.15623
          Length = 562

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 89/199 (44%), Gaps = 25/199 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G  + +VG NGIGK+T LK+L+G         DD P    I    R   L  +F ++ + 
Sbjct: 61  GDKVTIVGENGIGKTTFLKLLSG--------VDDYPFSGSIEIEGRIGFLPQHFEEV-DG 111

Query: 163 NIKAI---IKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHV----- 214
           N+ A+   +K  Y D I   ++ P+            ++  ++ G+    Q+ H+     
Sbjct: 112 NLLAVEVLLKSLYDDEINEFLELPLTPFSH----EWIQELNSLGGHEIFRQVSHIGLRQE 167

Query: 215 -LNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKY 273
            L R    LSGGE  +  +    + + D  + DEP+++LD K        +R        
Sbjct: 168 ILRRPFRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF---NGT 224

Query: 274 VIAVEHDLSVLDYLSDFVC 292
           V+ V HD ++++ +S F+ 
Sbjct: 225 VVMVTHDRALINAVSSFIS 243

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 76/204 (37%), Gaps = 65/204 (31%)

Query: 364 DFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIA 423
           D    V  GD      + ++GENG GKTT +KLL+GV     +     +  +   PQ   
Sbjct: 53  DLDFVVSYGD-----KVTIVGENGIGKTTFLKLLSGVDDYPFSGSIEIEGRIGFLPQ--- 104

Query: 424 PKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDI----------------------- 460
                      F+++ G  L+ +    ++K L  D+I                       
Sbjct: 105 ----------HFEEVDGNLLAVEV---LLKSLYDDEINEFLELPLTPFSHEWIQELNSLG 151

Query: 461 ---IDQEVQH--------------LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQR 503
              I ++V H              LSGGE  +  +     +  D  L+DEP+ +LD++  
Sbjct: 152 GHEIFRQVSHIGLRQEILRRPFRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGI 211

Query: 504 IICSKVIRRFILHNKKTAFVVEHD 527
                 +R+F      T  +V HD
Sbjct: 212 EWLEFFLRKF----NGTVVMVTHD 231

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 76/199 (38%), Gaps = 26/199 (13%)

Query: 359 KRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMK 418
           K+   + S T+  G     E LV+ G NG GKTTL ++L   I+ D  +       VSM 
Sbjct: 380 KQIFANISFTLTKG-----ERLVIQGPNGCGKTTLNRILMAHIKPDHGT-------VSMS 427

Query: 419 PQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIID----------QEVQHL 468
              +          L  +K   Q L    + D  +   I ++ D            ++ L
Sbjct: 428 GNAVVGYLDQEQENLPLEKSPIQLLEEDPKIDASRQTAIRNLRDFGIYKWHDLKSPLRDL 487

Query: 469 SGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDF 528
           S G  ++  +   +     I ++DEP+ ++D        +VI   +L          HD 
Sbjct: 488 SVGCRRKTQLCQIIMRKCSILVLDEPTNHID----FPSLEVIEDALLAFPGIIVATTHDR 543

Query: 529 IMATYLADKVIVFEGTPSK 547
                +A ++I F    S+
Sbjct: 544 YFTEKVATRIIDFSKYSSE 562

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
           Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
           permease, start by similarity
          Length = 1022

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 116/300 (38%), Gaps = 72/300 (24%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLA---------GV 400
           N T+E    K    D  L   +G     E+L +MG +G GKTTL+ +LA         G 
Sbjct: 374 NITYEVSPAKNVTADV-LNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGS 432

Query: 401 IQS---DENSEKVQKL------------NVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSP 445
           I+    D + +K  K+             +++    +        RQL F   + +    
Sbjct: 433 IKVNGVDIDKDKYSKIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVY-- 490

Query: 446 QFQTDVVKPLKIDDIIDQEV-----QHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
               DV++ L+I DI D+ +     + +SGGE +RV+I   L     +  +DEP++ LD+
Sbjct: 491 ----DVLEELRIFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDA 546

Query: 501 EQRIICSKVIRRFILHNKKTAFVVEHD--------FIMATYLADKVIVFEGTPSKHANAR 552
                  + + R   H  KT  +  H         F     L++  +V+ G   K     
Sbjct: 547 NNANNVIECLVRLANHYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSGDAHK----- 601

Query: 553 APESLLTGCNRFLKN---------------LNVTFRRDTTSFRPRINKLDSQMDREQKLS 597
                    N FLKN               ++VTF       R  I+ L++ +   + L+
Sbjct: 602 --------VNEFLKNEGYACPPDYNIADYLIDVTFEPSKFVTRANIDDLEATLPTTEGLN 653

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 77/181 (42%), Gaps = 34/181 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K K           G   D  ++ +II +    + 
Sbjct: 398 KPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIGFV---DQ 454

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
           ++Y    L   +   +    +  +PR             +L        V   ++ L++ 
Sbjct: 455 EDYLLPTL--TVYETVLNSALLRLPR-------------QLSFSAKQRRVYDVLEELRIF 499

Query: 213 HVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDL 267
            + +R IG      +SGGE +R +I    V    V   DEP+S LD     NA  +I  L
Sbjct: 500 DIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDAN---NANNVIECL 556

Query: 268 L 268
           +
Sbjct: 557 V 557

>KLLA0A01452g 130078..131901 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 607

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 82/189 (43%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+     GR       +  + Y + S+ Q   TK   + ++
Sbjct: 421 IALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGV-YSQHSQDQLDLTKSALEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG 225
                   D  P   +      G+L +  +  + +TV               ++G LS G
Sbjct: 480 --------DKYPHVSQDFQYWRGQLGRYGLTGEGQTV---------------QMGTLSEG 516

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLD 285
           +  R    L  ++  +V + DEP++ LD+    + A  I +       V+ V HD  +LD
Sbjct: 517 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLD 573

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 574 KIAKDIFVV 582

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 99/212 (46%), Gaps = 47/212 (22%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKP------QTIAPKFPGTVRQL-- 433
           ++GENG GK+T +K +A        +  +  L+   +P      + +  +  G +++L  
Sbjct: 109 LLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGELKRLED 168

Query: 434 FFKKIRGQFLSPQFQTDVVKPL--KIDDI----------------------IDQEVQHLS 469
             +KI    L    ++D+++PL  ++DD+                      I+++ + +S
Sbjct: 169 LVEKI---LLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTINKKTKDMS 225

Query: 470 GGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--D 527
           GG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  D
Sbjct: 226 GGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQD 281

Query: 528 FI--MATYLAD----KVIVFEGTPSKHANARA 553
           F+  + T + D    K++ + G    +   R+
Sbjct: 282 FLNGVCTNMLDMRLQKLMAYGGNYDSYVKTRS 313

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 33/170 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQE------IIKYFRGSE 151
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E      +++  +G  
Sbjct: 104 GRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGE- 162

Query: 152 LQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSETVKGYIKTLQ 210
                 K LED ++ I+             GP   + E L  RM+  D  T +     + 
Sbjct: 163 -----LKRLEDLVEKILLED----------GPESDLLEPLYERMDDMDPSTFESRAAIIL 207

Query: 211 L-----EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
           +        +N++   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 208 IGLGFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 90/214 (42%), Gaps = 47/214 (21%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGVI--QSDENSEKVQ-KLNV-SMKPQT---------- 421
           DS I  ++G NG GK+TL+K++ G +  QS   S     KL V S   Q           
Sbjct: 418 DSRI-ALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGVYSQHSQDQLDLTKSALE 476

Query: 422 -IAPKFPGTVRQLFFKKIRGQF----LSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRV 476
            +  K+P   +   F+  RGQ     L+ + QT              ++  LS G+  RV
Sbjct: 477 FVRDKYPHVSQD--FQYWRGQLGRYGLTGEGQT-------------VQMGTLSEGQRSRV 521

Query: 477 AI-VLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLA 535
              +LAL  P ++ L+DEP+  LD       +  I  F         VV HDF +   +A
Sbjct: 522 VFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIA 576

Query: 536 DKVIVFEGTPSKHANA-RAPESLLTGCNRFLKNL 568
             + V E     H  A R   S+L   N+  KN+
Sbjct: 577 KDIFVVE-----HKTATRWDGSILDYKNKLAKNV 605

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of
           the ATP-binding cassette (ABC) superfamily of membrane
           transporters, component of the mitochondrial inner
           membrane [2073 bp, 690 aa]
          Length = 690

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (44%), Gaps = 19/188 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG++G GKST LK++         RF DP   + +I    G +++ Y    L  
Sbjct: 462 GWKTAIVGSSGSGKSTILKLVF--------RFYDPESGRILIN---GRDIKEYDIDALRK 510

Query: 163 NIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRMEKDSETVKGYIKTL--QLEHVLNR 217
            I  + +  P + D I   +K G +    E +   +EK    +   IK L    + ++  
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEK--AQLAPLIKKLPQGFDTIVGE 568

Query: 218 EIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTP-TKYVIA 276
               +SGGE QR AI    +++A +  FDE +S LD        + IRD  T  ++  + 
Sbjct: 569 RGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVY 628

Query: 277 VEHDLSVL 284
           + H L  +
Sbjct: 629 IAHRLRTI 636

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 116/271 (42%), Gaps = 44/271 (16%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE---- 405
           N TF Y   ++   + S T+ +G  +      ++G +G+GK+T++KL+      +     
Sbjct: 440 NVTFGYHPDRKILKNASFTIPAGWKT-----AIVGSSGSGKSTILKLVFRFYDPESGRIL 494

Query: 406 -NSEKVQKLNVSMKPQTIA------PKFPGTVRQ-LFFKKI------------RGQFLSP 445
            N   +++ ++    + I       P F  T+ + + F +I            + Q L+P
Sbjct: 495 INGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQ-LAP 553

Query: 446 QFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRII 505
             +     P   D I+ +    +SGGE QR+AI   L   A I   DE ++ LD+     
Sbjct: 554 LIKK---LPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQA 610

Query: 506 CSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSKHANARAPESLLTGCNRFL 565
             + IR       +T+  + H  +     ADK+IV +       N R  E    G +  L
Sbjct: 611 LLRTIRDNFTSGSRTSVYIAHR-LRTIADADKIIVLD-------NGRVREE---GKHLEL 659

Query: 566 KNLNVTFRRDTTSFRPRINKLDSQMDREQKL 596
             +  +  R+  + +  ++ L++++  +Q+L
Sbjct: 660 LAMPGSLYRELWTIQEDLDHLENELKDQQEL 690

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
           complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 85/185 (45%), Gaps = 32/185 (17%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ--LF 434
           SE+  ++G+ G+GK+ LI+ + G +    N   V + NV+   Q +A    GTVR   LF
Sbjct: 638 SELTCIIGKVGSGKSALIQAMLGDL-FRVNGSAVVRGNVAYVSQ-VAWIMNGTVRDNILF 695

Query: 435 FKKIRGQFLSPQFQTDVVKPLKID---------DIIDQEVQHLSGGELQRVAIVLALGIP 485
             K   +F     QT     L +D           + ++   LSGG+  R+++  A+   
Sbjct: 696 GHKYDAKFYQ---QTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYAR 752

Query: 486 ADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--------KKTAFVVEHDFIMATYLADK 537
           AD YL+D+P A +D          + + +L N        K  A V+  + I A  +AD 
Sbjct: 753 ADTYLLDDPLAAVDEH--------VAKHLLQNVFGPNGLLKSKARVLTTNKITALEIADH 804

Query: 538 VIVFE 542
           +++ E
Sbjct: 805 IVLLE 809

>YER036C (YER036C) [1461] chr5 complement(223366..225198) Member of
           the non-transporter group of the ATP-binding cassette
           (ABC) superfamily [1833 bp, 610 aa]
          Length = 610

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 85/189 (44%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK    +  
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTK----SAL 478

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG 225
             ++ +Y  NI +  +      G+L +  +  + +TV               ++  LS G
Sbjct: 479 EFVRDKY-SNISQDFQF---WRGQLGRYGLTGEGQTV---------------QMATLSEG 519

Query: 226 ELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLD 285
           +  R    L  ++  +V + DEP++ LD+    + A  I +       V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF---NGGVVVVSHDFRLLD 576

Query: 286 YLSDFVCII 294
            ++  + ++
Sbjct: 577 KIAQDIFVV 585

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 41/209 (19%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTI-APKFPGTVRQLFFKKIRG 440
           ++GENG GK+T +K LA           +  L+   +P  + A  +  T  Q   K+I  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIED 171

Query: 441 ----QFLSPQFQTDVVKPL--KIDDI----------------------IDQEVQHLSGGE 472
                 L    ++++++PL  ++D +                      I ++ + +SGG 
Sbjct: 172 LVEKTILEDGPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGW 231

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--DFI- 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+ 
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFLN 287

Query: 530 -----MATYLADKVIVFEGTPSKHANARA 553
                M    A K+  + G    +   R+
Sbjct: 288 GVCTNMIDMRAQKLTAYGGNYDSYHKTRS 316

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  E+    +  +E Q+  
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSETVKGYIKTLQLEHVL 215
            K +ED ++  I             GP  ++ E L  RM+  D +T +     + +    
Sbjct: 167 -KRIEDLVEKTILED----------GPESELLEPLYERMDSLDPDTFESRAAIILIGLGF 215

Query: 216 N-----REIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
           N     ++   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 216 NKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 86/199 (43%), Gaps = 17/199 (8%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGVI--QSDENSEKVQKLNVSMKPQTIAPKFPGTVRQL 433
           DS I  ++G NG GK+TL+K++ G +  QS   S     + + +  Q    +   T   L
Sbjct: 421 DSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTH-VKLGVYSQHSQDQLDLTKSAL 478

Query: 434 FFKKIRGQFLSPQFQTDVVKPLKIDDIID-QEVQHLSGGELQRVAIV---LALGIPADIY 489
            F + +   +S  FQ    +  +     + Q VQ  +  E QR  +V   LAL  P ++ 
Sbjct: 479 EFVRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQP-NVL 537

Query: 490 LIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSKHA 549
           L+DEP+  LD       +  I  F         VV HDF +   +A  + V E   +   
Sbjct: 538 LLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQDIFVVENKTA--- 590

Query: 550 NARAPESLLTGCNRFLKNL 568
             R   S+L   N+  KN+
Sbjct: 591 -TRWDGSILQYKNKLAKNV 608

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 85/187 (45%), Gaps = 20/187 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQK-----PNLGRFDDPPEWQEIIKYFRGSELQNY 155
           RPG+++ ++G  G G ++ LK +AG+            +D  P+ +E+++ +R   + N 
Sbjct: 186 RPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQ-REMMRRYRAEVVYN- 243

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVL 215
               ++ +   +   Q +D    A K P  +V  +   R E  +   + Y     L H  
Sbjct: 244 --SEIDVHFPHLTVKQTLD-FALACKTPHMRVNNVS--RAEYITLMRELYATVFGLRHTY 298

Query: 216 NREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR---DL 267
           + ++G      +SGGE +R +I  +   +A VY +D  +  LD    L  AQ +R   +L
Sbjct: 299 DTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNL 358

Query: 268 LTPTKYV 274
           L  T  V
Sbjct: 359 LQSTSLV 365

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 70/158 (44%), Gaps = 27/158 (17%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GVIQSD-------------ENSEKVQKLNVSMKPQT 421
            +  +MGE+G GKTTL+  LA    GVI  D               +  VQ+ +V +K  T
Sbjct: 883  LTALMGESGAGKTTLLNTLAQRNVGVITGDMLVNGLPIDASFERRTGYVQQQDVHVKEMT 942

Query: 422  I--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479
            +  + +F   +R+    +   +     +   +++ L + D  D  V     G        
Sbjct: 943  VRESLQFSARLRR---PESVSEAEKMNYVEKIIEILGMSDFADALVGDAGYGLNVEQRKK 999

Query: 480  LALGI-----PADIYLIDEPSAYLDSEQRIICSKVIRR 512
            L++G+     P+ +  +DEP++ LDS+      ++++R
Sbjct: 1000 LSIGVELVAKPSLLLFLDEPTSGLDSQSSWAIVQLLKR 1037

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVV 524
           ++ +SGGE +RV+I  AL   A +Y  D  +  LD+   +  ++ +R      + T+ V 
Sbjct: 307 IRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNLLQSTSLVT 366

Query: 525 EH---DFIMATYLADKVIV-FEG 543
            +   + I  T+  DKV+V FEG
Sbjct: 367 LYQASENIYETF--DKVLVLFEG 387

>Scas_695.24
          Length = 1288

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 77/173 (44%), Gaps = 27/173 (15%)

Query: 350  NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQ------- 402
            N TF YP+         L +E    +  + + ++GE+G+GK+TL+ LL  + Q       
Sbjct: 1053 NLTFAYPSETNVNVYEDLNLEM--HASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIY 1110

Query: 403  ---SDENSEKVQKLNVSMKPQTIAPK-FPGTVRQLFFKKIRGQFLSPQFQTDVVK----- 453
               +D N   +  L   +      P  F GTVR+     I    L  +   D++K     
Sbjct: 1111 LDGTDVNDWGLMNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMEL-FDMLKYVGIY 1169

Query: 454  ------PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
                  P  +D  ID ++  LSGG+ QR+ I  AL     I ++DE ++ LD+
Sbjct: 1170 EFVESLPFGLDTRIDTKL--LSGGQAQRICIARALLRKPKILILDECTSALDA 1220

>CAGL0K10472g 1020016..1022274 highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D++ 
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLN-REIGKLSG 224
             +    VD + +   G              K  E  + ++ +  +   L  +++  LSG
Sbjct: 610 --LSTSAVDWMSKTFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVL 284
           G+  R A    C+ +  + + DEPS++LD         ++  +   T  ++ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILILDEPSNHLDTT---GIDALVDAMKNFTGGILMVSHDISVI 710

Query: 285 D 285
           +
Sbjct: 711 N 711

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 75/165 (45%), Gaps = 35/165 (21%)

Query: 352 TFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKL-------LAGVIQSD 404
           +F Y   K    D +L ++     DS I  ++G NG GKTTL+K+       L+G +  +
Sbjct: 538 SFGYSPDKLLLKDVNLDIQM----DSRI-ALVGANGCGKTTLLKVMLEQLRPLSGYVSRN 592

Query: 405 E-------NSEKVQKLNVSMKP-QTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLK 456
                       V  +++S      ++  FPG   + + + + G F        +   L 
Sbjct: 593 PRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEYRRHL-GSF-------GITGTLG 644

Query: 457 IDDIIDQEVQHLSGGELQRVAIV-LALGIPADIYLIDEPSAYLDS 500
           +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+
Sbjct: 645 L-----QKMQLLSGGQKSRVAFAALCLNNPH-ILILDEPSNHLDT 683

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 88/218 (40%), Gaps = 31/218 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSE 200
           Q + +  + +E      K+ E+  +  ++ + +DN    +   + ++ E L + ME D  
Sbjct: 285 QLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKL-VDMESDKA 343

Query: 201 TVKGYIKTLQL---EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQR 257
             +       L        +     SGG   R ++  +     D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSI 403

Query: 258 LNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIY 295
              A+ ++    P+  V+ V HD + L+ ++    IIY
Sbjct: 404 AYLAEYLKSY--PST-VLTVSHDRAFLNEVA--TDIIY 436

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 463 QEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKSY----PSTVL 418

Query: 523 VVEHDFIMATYLADKVI 539
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump
           involved in resistance to multiple drugs, member of the
           ATP-binding cassette (ABC) superfamily [4506 bp, 1501
           aa]
          Length = 1501

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 93/213 (43%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       +D  P+ +E++K ++   + N  
Sbjct: 186 GEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQ-EEMMKRYKADVIYN-- 242

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLN 216
              L+ +   +   Q +D    A K P  +V  + K   E  +     Y     L H  N
Sbjct: 243 -GELDVHFPYLTVKQTLD-FAIACKTPALRVNNVSK--KEYIASRRDLYATIFGLRHTYN 298

Query: 217 REIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR---DLL 268
            ++G      +SGGE +R +I  +      +Y +D  +  LD    L  A+ IR   +LL
Sbjct: 299 TKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLL 358

Query: 269 TPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
             T +V   +   ++ +   D V ++Y    +Y
Sbjct: 359 KSTAFVTIYQASENIYETF-DKVTVLYSGKQIY 390

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR      K TAFV
Sbjct: 306 VRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFV 364

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 78/186 (41%), Gaps = 23/186 (12%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA +   N+G                G  +   F +   
Sbjct: 881  PGTMTALMGESGAGKTTLLNTLAQR---NVGIITGD-------MLVNGRPIDASFERR-- 928

Query: 162  DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSET---VKGYIKTLQLEHVLNRE 218
                  ++ Q +      ++  +Q    + + +   DSE    V+  I+ L +E      
Sbjct: 929  ---TGYVQQQDIHIAELTVRESLQFSARMRRPQHLPDSEKMDYVEKIIRVLGMEEYAEAL 985

Query: 219  IGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPTKY 273
            +G++  G    + ++ +IG+  V   D+ +F DEP+S LD +      Q++R L    + 
Sbjct: 986  VGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLSKAGQS 1045

Query: 274  VIAVEH 279
            ++   H
Sbjct: 1046 ILCTIH 1051

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 72/160 (45%), Gaps = 31/160 (19%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GVIQSD-------------ENSEKVQKLNVSMKPQT 421
            +  +MGE+G GKTTL+  LA    G+I  D               +  VQ+ ++ +   T
Sbjct: 884  MTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGRPIDASFERRTGYVQQQDIHIAELT 943

Query: 422  IAPKFPGTVRQLFFKKIRGQFLSPQFQTD----VVKPLKIDDIIDQEVQHLSGG----EL 473
            +      + R       R Q L    + D    +++ L +++  +  V  +  G    + 
Sbjct: 944  VRESLQFSARMR-----RPQHLPDSEKMDYVEKIIRVLGMEEYAEALVGEVGCGLNVEQR 998

Query: 474  QRVAIVLALGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 512
            ++++I + L    D+ L +DEP++ LDS+      +++R+
Sbjct: 999  KKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRK 1038

>Scas_710.50
          Length = 602

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 82/183 (44%), Gaps = 28/183 (15%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RFDDPPEWQEIIKYFRG 149
           T +PG +  ++G +G GKST L +++G+ + +            F+D    +E+ K    
Sbjct: 25  TFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFK---- 80

Query: 150 SELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTL 209
               N  + + +D+   + K    +    A    +  + E  + R+ K  E     I+ L
Sbjct: 81  ----NVCSYVSQDDDHLLAKLTVRETFKFAADLRLHNLTE--EQRVIKSDEL----IRAL 130

Query: 210 QLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQII 264
            L+H  N  IG      +SGGE +R  +G+  + D  + + DEP+S LD        +I+
Sbjct: 131 GLKHCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEIL 190

Query: 265 RDL 267
           + L
Sbjct: 191 KKL 193

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 88/186 (47%), Gaps = 32/186 (17%)

Query: 371 SGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSD----------------ENSEKVQK-- 412
           +  F    I  +MG +G+GK+TL+ L++G I+S                 + SE++ K  
Sbjct: 23  NATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFKNV 82

Query: 413 -LNVSMKPQTIAPKFPGTVRQLF--FKKIRGQFLSPQFQT----DVVKPLKI----DDII 461
              VS     +  K   TVR+ F     +R   L+ + +     ++++ L +    ++II
Sbjct: 83  CSYVSQDDDHLLAKL--TVRETFKFAADLRLHNLTEEQRVIKSDELIRALGLKHCENNII 140

Query: 462 DQE-VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
             E ++ +SGGE +RV + + L     I L+DEP++ LDS       +++++  +   KT
Sbjct: 141 GNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKLSVEYGKT 200

Query: 521 AFVVEH 526
             +  H
Sbjct: 201 IIITIH 206

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -
           SH] complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 72/156 (46%), Gaps = 25/156 (16%)

Query: 371 SGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTV 430
           SG  S  EIL +MG +G GKT L+ +L    ++ E S  V+   V +   T++ K  G V
Sbjct: 388 SGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVS-KVVGFV 446

Query: 431 RQ--------LFFKKIRGQFL-----SPQFQT------DVVKPLKIDDIIDQEVQH---- 467
            Q          ++ +    L     S  F         V++ L+I DI D+ + +    
Sbjct: 447 DQDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGNDFER 506

Query: 468 -LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
            +SGGE +RV+I   L     I  +DEP++ LDS  
Sbjct: 507 GISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNN 542

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 74/177 (41%), Gaps = 28/177 (15%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPN----LGRFDDPPEWQEIIKYFRGSELQ-NYF 156
           PG++L ++G +G GK+  L IL  K K        + +  P  +  +    G   Q N+ 
Sbjct: 393 PGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKVVGFVDQDNHL 452

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLN 216
              L   +   +    +  +PR++    ++             + V   ++ L++  + +
Sbjct: 453 LPTL--TVYETVLNSALLRLPRSMSFAAKQ-------------KRVYQVLEELRIFDIRD 497

Query: 217 REIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLL 268
           R IG      +SGGE +R +I    V    +   DEP+S LD     NA  +I  L+
Sbjct: 498 RLIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSN---NANNVIECLV 551

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 99/212 (46%), Gaps = 31/212 (14%)

Query: 353  FEYPAMKRTQ--GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENS--- 407
            F YPA K  Q   +F+L +  G       + ++GE+G+GK+TL  L+ G+      S   
Sbjct: 1053 FAYPAAKDVQIYKNFNLRINQGT-----KVAIVGESGSGKSTLFYLICGLYPVKPASLFI 1107

Query: 408  --EKVQKLNVSMKPQTIA-----PKF-PGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDD 459
                +    +S   + IA     P+F  GT+R+     + G     +   +V+  ++I +
Sbjct: 1108 DGTDICNWEMSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIY-EVLAEVRIIN 1166

Query: 460  IIDQ---------EVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
             +           +   +SGG+LQR++IV AL     + ++DE ++ LD+      + V+
Sbjct: 1167 FVRSLPEGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVV 1226

Query: 511  RRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
            R   LH+  T  V+ H   M   + D+++V +
Sbjct: 1227 RNS-LHD-ITVIVITHSKQMMK-MCDRIVVLK 1255

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 228 QRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLS-VLD 285
           QR A+  + ++DA V + DE  S LD+  R    ++IR      K  I + H+LS VLD
Sbjct: 506 QRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRS-WRADKTTIILTHELSHVLD 563

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 84/203 (41%), Gaps = 35/203 (17%)

Query: 352 TFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE-----N 406
           +F YPA   T+   +L   S  F  ++I  ++G++G+GK+TL  LL       E     N
Sbjct: 365 SFNYPARPDTK---ALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVN 421

Query: 407 SEKVQKLNVSMKPQTIA------PKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDI 460
           S  ++ ++ S   Q I         F GT+    F+ I             VK      +
Sbjct: 422 STNLRGIDRSWLLQNITLVEQSCTLFNGTL----FENITLSAKPVNKTAGAVKRACQMAL 477

Query: 461 IDQEVQHLSGG---------------ELQRVAIVLALGIPADIYLIDEPSAYLDSEQRII 505
           +++ V  L  G               + QRVA+  A+   A + ++DE  + LD   R +
Sbjct: 478 LEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDL 537

Query: 506 CSKVIRRFILHNKKTAFVVEHDF 528
             +VIR +     KT  ++ H+ 
Sbjct: 538 LMEVIRSW--RADKTTIILTHEL 558

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 83/190 (43%), Gaps = 35/190 (18%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQ--KPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            G  + +VG +G GKST   ++ G    KP    F D            G+++ N+    L
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICGLYPVKPA-SLFID------------GTDICNWEMSAL 1120

Query: 161  EDNIKAI-IKPQYV-----DNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHV 214
               I  +  KP++      +N+   ++G +    E+ ++  E     +  ++++L     
Sbjct: 1121 RKIIAVVEQKPRFFNGTIRENLVYGLEGTITD-NEIYEVLAEVR---IINFVRSLPEGLE 1176

Query: 215  LNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYV 274
               +   +SGG+LQR +I  + ++   + + DE +S LD       A ++R+ L      
Sbjct: 1177 TRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL------ 1230

Query: 275  IAVEHDLSVL 284
                HD++V+
Sbjct: 1231 ----HDITVI 1236

>Kwal_47.19116
          Length = 607

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 77/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA K+ P     ++   D+P E  E   ++Y   +E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVV-NEAQNE 162

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSETVKGYIKTLQL--- 211
             K LED ++  I             GP   V E +  RM+  D  T +     + +   
Sbjct: 163 L-KRLEDLVEKTILED----------GPESDVLEGIYERMDSLDPSTFESRAAVILIGLG 211

Query: 212 --EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
                +N++   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 212 FNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 82/192 (42%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDNI 164
           + LVG NG+GKST LKI+ G+     GR              R + ++   +++  +D +
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVS------------RHTHVKLGVYSQHSQDQL 468

Query: 165 KAIIKP-QYVDNIPRAIKGPVQKV-GELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKL 222
                P ++V +    I    Q   G+L +  +  + +T                ++  L
Sbjct: 469 DLTKSPLEFVRDKYSHISHDFQYWRGQLGRYGLTGEGQT---------------SQMATL 513

Query: 223 SGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLS 282
           S G+  R    L  +Q  +V + DEP++ LD+    + A  I +       V+ V HD  
Sbjct: 514 SEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLADAINEF---NGGVVVVSHDFR 570

Query: 283 VLDYLSDFVCII 294
           +LD ++  + ++
Sbjct: 571 LLDKIAKDIFVV 582

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 461 IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
           I+++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRT 272

Query: 521 AFVVEH--DFI 529
             +V H  DF+
Sbjct: 273 LVLVSHSQDFL 283

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 86/207 (41%), Gaps = 40/207 (19%)

Query: 380 LVMMGENGTGKTTLIKLLAG--VIQSDENSEKVQ-KLNV---SMKPQTIAPKFP-GTVRQ 432
           + ++G NG GK+TL+K++ G    QS   S     KL V     + Q    K P   VR 
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLEFVRD 480

Query: 433 LF------FKKIRGQF----LSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAI-VLA 481
            +      F+  RGQ     L+ + QT              ++  LS G+  RV   +LA
Sbjct: 481 KYSHISHDFQYWRGQLGRYGLTGEGQT-------------SQMATLSEGQRSRVVFALLA 527

Query: 482 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVF 541
           L  P ++ L+DEP+  LD       +  I  F         VV HDF +   +A  + V 
Sbjct: 528 LQAP-NVLLLDEPTNGLDIATIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVV 582

Query: 542 EGTPSKHANARAPESLLTGCNRFLKNL 568
           E   +     R   S+L   N+  KN+
Sbjct: 583 ENKTA----TRWDGSILDYKNKLAKNV 605

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 96/215 (44%), Gaps = 22/215 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQN 154
           R G+++ ++G  G G S+ LK+ AG+     G       +D  P+ +E++K ++   + N
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQ-KEMMKRYKPDVIYN 244

Query: 155 YFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHV 214
                 +D     +  Q   +   A K P ++V ++   R E  + T   +     L H 
Sbjct: 245 ----GEQDVHFPHLTVQQTLDFAIACKTPSKRVNDV--SREEYIASTRDLHATIFGLRHT 298

Query: 215 LNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR---D 266
            + ++G      +SGGE +R +I  + V    +Y +D  +  LD    L  A+ IR   +
Sbjct: 299 YHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTN 358

Query: 267 LLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
           LL  T +V   +   ++ +   D V ++Y    +Y
Sbjct: 359 LLGSTAFVTIYQASENIYETF-DKVTVLYTGRQIY 392

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 25/188 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF--DDPPEWQEIIKYF--RGSELQNYF 156
            +PG +  L+G +G GK+T L  LA +   N+G    D     + I   F  R   +Q   
Sbjct: 884  KPGTLTALMGESGAGKTTLLNTLAQR---NVGIITGDMLVNGKPIDISFERRTGYVQQQD 940

Query: 157  TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLN 216
              + E  ++  +  Q+   + RA     Q V E      E+  E V+  IK L +E   +
Sbjct: 941  IHISELTVRESL--QFSARMRRA-----QNVPE------EEKMEHVERIIKVLDMEEYAD 987

Query: 217  REIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPT 271
              +G +  G    + ++ +IG+  V   D+ +F DEP+S LD +      Q+++ L    
Sbjct: 988  ALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKKLAKAG 1047

Query: 272  KYVIAVEH 279
            + ++   H
Sbjct: 1048 QSILCTIH 1055

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVV 524
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAFV 
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNLLGSTAFVT 367

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 73/160 (45%), Gaps = 31/160 (19%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GVIQSD-------------ENSEKVQKLNVSMKPQT 421
            +  +MGE+G GKTTL+  LA    G+I  D               +  VQ+ ++ +   T
Sbjct: 888  LTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDISFERRTGYVQQQDIHISELT 947

Query: 422  IAPKFPGTVRQLFFKKIRGQFLSPQFQTD----VVKPLKIDDIIDQEVQHLSGG----EL 473
            +      + R       R Q +  + + +    ++K L +++  D  V  +  G    + 
Sbjct: 948  VRESLQFSARMR-----RAQNVPEEEKMEHVERIIKVLDMEEYADALVGDVGRGLNVEQR 1002

Query: 474  QRVAIVLALGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 512
            ++++I + L    D+ L +DEP++ LDS+      +++++
Sbjct: 1003 KKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKK 1042

>Scas_108.1
          Length = 335

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 11/131 (8%)

Query: 179 AIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGK-----LSGGELQRFAIG 233
           A K P ++V  + K    K +  +  Y     L H  + ++G      +SGGE +R +I 
Sbjct: 1   ACKTPAKRVNNISKAEYVKTTREL--YATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIA 58

Query: 234 LSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR---DLLTPTKYVIAVEHDLSVLDYLSDF 290
            + V +  VY +D  +  LD    L  A+ IR   +LL  T +V   +   ++ +   D 
Sbjct: 59  EALVANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETF-DK 117

Query: 291 VCIIYGVPSVY 301
           V ++Y    +Y
Sbjct: 118 VTVLYDGRQIY 128

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 522
           V+ +SGGE +RV+I  AL     +Y  D  +  LD+   +  +K IR  I+ N  + TAF
Sbjct: 44  VRGVSGGERKRVSIAEALVANGSVYCWDNATRGLDASTALEYAKAIR--IMTNLLESTAF 101

Query: 523 VV 524
           V 
Sbjct: 102 VT 103

>AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH]
           (859615..861438) [1824 bp, 607 aa]
          Length = 607

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 27/188 (14%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKA 166
            LVG NG+GKST LKI+ G+  P+ GR       +  + Y + S+ Q   TK   + ++ 
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVRD 480

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGE 226
             K  ++    +  +G + + G             + G  +T Q+          LS G+
Sbjct: 481 --KYAHISEDFQFWRGQLGRYG-------------LTGEAQTAQM--------ATLSEGQ 517

Query: 227 LQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDY 286
             R    L  ++  +V + DEP++ LD+    + A  I         V+ V HD  +LD 
Sbjct: 518 RSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIDAF---NGGVVVVSHDFRLLDR 574

Query: 287 LSDFVCII 294
           ++  + ++
Sbjct: 575 IAKDIYVV 582

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 78/179 (43%), Gaps = 35/179 (19%)

Query: 382 MMGENGTGKTTLIKLLAG-------------VIQSDENSEKVQKLNVSMKPQTIAPKFPG 428
           ++GENG GK+T +K +A              + +  E SE      V  + Q    +   
Sbjct: 109 LLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVREAQNELKRLED 168

Query: 429 TVRQLFFKK-IRGQFLSPQFQ-TDVVKPLKIDD--------------IIDQEVQHLSGGE 472
            V ++  +     + L P ++  D + P   +                I+++ + +SGG 
Sbjct: 169 LVEKILLEDGPESELLDPLYEKMDSMDPSTFESRAAIILIGLGFNAKTINRKTKDMSGGW 228

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--DFI 529
             RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 78/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQE--IIKYFRGSELQNY 155
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E   ++Y    E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVV-REAQNE 162

Query: 156 FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSETVKGYIKTLQL--- 211
             K LED ++ I+             GP  ++ + L  +M+  D  T +     + +   
Sbjct: 163 L-KRLEDLVEKILLED----------GPESELLDPLYEKMDSMDPSTFESRAAIILIGLG 211

Query: 212 --EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVK 255
                +NR+   +SGG   R A+  +      + + D+P+++LD++
Sbjct: 212 FNAKTINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 91/212 (42%), Gaps = 20/212 (9%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           GQ++ ++G +G GK+T L +LAGK   ++  +D        I+Y R +  +       ++
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNSSI-NYDGE------IQYSRDAAKEG---SKADE 90

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDS--ETVKGYIKTLQL----EHVLN 216
            +      Q+     R       ++   LKL + K      V+  I  L L    E  + 
Sbjct: 91  KVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVG 150

Query: 217 REIGK-LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPT--KY 273
             I K LSGGE +R +I +  + +  V   DEP++ LD        + ++ L        
Sbjct: 151 DSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTI 210

Query: 274 VIAVEHDLSVLDYLSDFVCIIY-GVPSVYGVV 304
           ++++    S + +  D VC++  G P   G V
Sbjct: 211 IMSIHQPRSDILFALDQVCLLSKGFPMYCGAV 242

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 16/187 (8%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
           RP  +  ++G +G GK++ L +++ +   N   F    E   II  F     Q    K +
Sbjct: 683 RPNAINAIMGPSGSGKTSLLNLISDRVCSNF--FTKFNESGRII--FN----QQPVMKSM 734

Query: 161 EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDS--ET-VKGYIKTLQLEHVLNR 217
             ++   +       +P        K    L+L    +S  ET V+  I  L L++  N 
Sbjct: 735 FKSVCCYVSQDDNHLLPNLTVYETLKYAARLRLSHHNESRIETRVRTLISDLGLKNCANT 794

Query: 218 EIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTK 272
            +G      +SGGE +R +IG+  + D  V + DEP+S LD        ++++ L    K
Sbjct: 795 LVGNDLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDSFTSSTIIELLKKLCQQGK 854

Query: 273 YVIAVEH 279
            +I   H
Sbjct: 855 TIILTIH 861

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 76/176 (43%), Gaps = 25/176 (14%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGVIQSD---------------ENSEKVQKLNVSMKPQ 420
           + +++ ++G +G+GKTT++ +LAG   S                E S+  +K+  +   Q
Sbjct: 40  NGQLMAIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKADEKVTTAYLTQ 99

Query: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQ-----FQTDVVKPLKIDD-----IIDQEVQHLSG 470
             A     T R+        +   P+        +++  L + D     + D   + LSG
Sbjct: 100 HDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVGDSINKGLSG 159

Query: 471 GELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH 526
           GE +R++I + +     +  +DEP+  LD+    +  K +++   H  +T  +  H
Sbjct: 160 GEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTIIMSIH 215

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
           ++ +SGGE +RV+I + L     + L+DEP++ LDS
Sbjct: 801 IKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDS 836

>Kwal_26.9480
          Length = 719

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 55/126 (43%), Gaps = 9/126 (7%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 517
           D I+ +    +SGGE QR+AI   L   A I   DE ++ LD+       + I+      
Sbjct: 590 DTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTG 649

Query: 518 KKTAFVVEHDFIMATYLADKVIVFE----GTPSKHANARA-PESL---LTGCNRFLKNLN 569
            KT+  + H  +     ADK+IV E        KHA   A P+SL   L      L +LN
Sbjct: 650 SKTSVYIAHR-LRTIADADKIIVLEHGRVKEEGKHAELLATPKSLYAELWNVQENLDDLN 708

Query: 570 VTFRRD 575
               RD
Sbjct: 709 KELERD 714

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 88/201 (43%), Gaps = 21/201 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++         RF DP E + ++    G +++    + L  
Sbjct: 489 GSKTAIVGPSGSGKSTILKLVF--------RFYDPIEGRILLD---GKDVRELDIESLRR 537

Query: 163 NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTL--QLEHVLNREIG 220
           +I  +  PQ       +I   V K G +     E +    +  ++ L  QL    +  +G
Sbjct: 538 SIGVV--PQDTPLFNESIWDNV-KFGRIDATDQEIERAIDRAQLRALIRQLPKGRDTIVG 594

Query: 221 K----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRD-LLTPTKYVI 275
           +    +SGGE QR AI    ++DA +  FDE +S LD        + I++   T +K  +
Sbjct: 595 ERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSV 654

Query: 276 AVEHDLSVLDYLSDFVCIIYG 296
            + H L  +      + + +G
Sbjct: 655 YIAHRLRTIADADKIIVLEHG 675

>Scas_573.11
          Length = 689

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 219 IGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVE 278
           I  LSGG   + A+  + +++AD+ + DEP+++LD    +N A ++  L T     I + 
Sbjct: 581 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 637

Query: 279 HDLSVLDYLSDFV 291
           HD   LD + +++
Sbjct: 638 HDSVFLDSVCEYI 650

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 76/165 (46%), Gaps = 16/165 (9%)

Query: 384 GENGTGKTTLIKLLA-GVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIR 439
           G NG GK+TL++ +A G +    + E+ + + V            GT  +   L F    
Sbjct: 502 GPNGAGKSTLMRAIANGQVDGFPSQEECRTVYVEHD-------IDGTHAETSVLDFVYGE 554

Query: 440 GQFLSPQFQTDVVKPLKI-DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYL 498
           G   + +  T+ +      D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +L
Sbjct: 555 GNLGTKEVITEKLTEFGFSDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHL 614

Query: 499 DSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEG 543
           D+    +    +  ++     T+  + HD +    + + +I +EG
Sbjct: 615 DT----VNVAWLVNYLNTCGITSITISHDSVFLDSVCEYIINYEG 655

>Kwal_56.23844
          Length = 1494

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 107/239 (44%), Gaps = 28/239 (11%)

Query: 342  TEDTKGEANKTFE-YPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGV 400
             ED        FE Y A  R + D SL   + D    E + ++G  G GK++L   L  +
Sbjct: 1243 AEDWPTHGAIKFENYSARYRPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRI 1302

Query: 401  IQSDE----------NSEKVQKL--NVSMKPQTIAPKFPGTVRQ------LFFKKIRGQF 442
            I++ E          +S  ++ L  ++S+ PQ  +  F GTVR+       +  +     
Sbjct: 1303 IEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQD-SQVFEGTVRENIDPTNEYTDEEIWHA 1361

Query: 443  LSPQFQTDVVKPL---KIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLD 499
            L      D +K L   +++ ++ +   +LS G+ Q + +  AL IP  I ++DE +A +D
Sbjct: 1362 LELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVD 1421

Query: 500  SEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSKHANARAPESLL 558
             E   +  + IR       +T   + H  I     +D+++V +    K A   +PE+LL
Sbjct: 1422 VETDQVIQETIR--TAFKNRTILTIAHR-INTILDSDRILVLDS--GKIAEFDSPEALL 1475

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 14/132 (10%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQK--LNVSMKPQTIAPKFPGTVRQ--L 433
           E+  ++G+ G+GK+ LI+ + G +   +    V      VS  P  +     GTV++  L
Sbjct: 642 ELTCIVGKVGSGKSALIQGILGDLFRVKGFASVHGSIAYVSQVPWIM----NGTVKENIL 697

Query: 434 FFKKIRGQFLSPQFQTDVVK------PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPAD 487
           F  K    F     +   +       P   + ++ ++   LSGG+  R+++  A+   AD
Sbjct: 698 FGHKYDADFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARAD 757

Query: 488 IYLIDEPSAYLD 499
            YL+D+P A +D
Sbjct: 758 TYLLDDPLAAVD 769

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 38/190 (20%)

Query: 350  NKTFEYPAMKRTQ--GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQS---- 403
            N +F YP+   T       L V SG     E + ++GE+G+GK+TL  L++ + +     
Sbjct: 1078 NLSFSYPSAPSTAIYKGLKLDVFSG-----ETIAVVGESGSGKSTLTLLISALYEVPNGS 1132

Query: 404  ------DENSEKVQKLN-----VSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQ---- 448
                  D N     KL      V  KPQ     F GTV +     I G+    Q +    
Sbjct: 1133 IEIDGIDINRWDTNKLRTIISVVEQKPQF----FDGTVGENLLYGISGRVTQIQVKEALC 1188

Query: 449  ----TDVV--KPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
                 D V   P  +D  ID  +  +SGG+ QR++I  A+     I  +DE ++ LD+  
Sbjct: 1189 LAGVQDFVFSLPEGLDTRIDTSL--ISGGQAQRLSIARAMLRKPKILFLDECTSALDTSN 1246

Query: 503  RIICSKVIRR 512
                + +I++
Sbjct: 1247 THAIANLIKK 1256

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 72/175 (41%), Gaps = 31/175 (17%)

Query: 102  PGQVLGLVGTNGIGKST-ALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
             G+ + +VG +G GKST  L I A  + PN G  +             G ++  + T  L
Sbjct: 1101 SGETIAVVGESGSGKSTLTLLISALYEVPN-GSIE-----------IDGIDINRWDTNKL 1148

Query: 161  EDNIKAI-IKPQYVD-----NIPRAIKGPVQK--VGELLKLRMEKDSETVKGYIKTLQLE 212
               I  +  KPQ+ D     N+   I G V +  V E L L   +D            L 
Sbjct: 1149 RTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDF--------VFSLP 1200

Query: 213  HVLNREIGK--LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR 265
              L+  I    +SGG+ QR +I  + ++   +   DE +S LD       A +I+
Sbjct: 1201 EGLDTRIDTSLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIK 1255

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
           (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 87/201 (43%), Gaps = 23/201 (11%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQ-----EIIKYFRGSELQNYF 156
           PG+ + +VG +G GKST   +L         RF DP         E I+ F  S+ +   
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLL--------RFYDPISGSITIGGEDIRLFNLSKYRRMM 506

Query: 157 TKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLK----LRMEKDSETVKGYIKTLQLE 212
             + ++ +  +     ++NI  A+  P+    +  +    LR+   S  V  + + LQ  
Sbjct: 507 GIVQQEPV--LFNASILENITYAL--PLHLTKDPARIDRALRLSNCSAFVGSFPEGLQT- 561

Query: 213 HVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTK 272
             +     +LSGG+ QR A+  + +QD  + + DE +S LD K     A  +       K
Sbjct: 562 -AVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAK 620

Query: 273 YVIAVEHDLSVLDYLSDFVCI 293
             I++ H  S + + +  + +
Sbjct: 621 ITISIAHRKSTIQHSTRVIVL 641

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 467 HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE-QRIICSKVIRR 512
            LSGG+ QRVA+  A      I ++DE ++ LDS+ + I+ S +++R
Sbjct: 569 QLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQR 615

>Scas_40.1
          Length = 203

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 71/161 (44%), Gaps = 25/161 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFDDPPEWQEIIKYFRGSELQNYFTKM 159
           G ++ +VG +G GK+T L +LA K    L   G ++   +         GS  Q+  T  
Sbjct: 47  GSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADG--------GSRQQDITT-- 96

Query: 160 LEDNIKAIIKPQYVDNIPRAIKGPVQKVGEL-LKLRMEKDSETVKGYIKTLQLEHVLNRE 218
                 A +  Q V +    ++  +    +L LK   ++    V+  I  L L+   +  
Sbjct: 97  ------AYLAQQDVSSPKLTVRETLSYAADLKLKAPRQERRRLVEELIAELGLKECSDTR 150

Query: 219 IGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDV 254
           +G      LSGGE +R +IG+  + +  +   DEP++ LD 
Sbjct: 151 VGDSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 25/153 (16%)

Query: 371 SGDFSDSEILVMMGENGTGKTTLIKLLAGVIQ------------SDENSEKVQKLNVSMK 418
           S D     I+ ++G +G+GKTTL+ +LA  I             +D  S +       + 
Sbjct: 41  SMDLPSGSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQQDITTAYLA 100

Query: 419 PQTI-APKFPGTVRQLFFKKIRGQFLSPQFQ-----TDVVKPLKIDD-----IIDQEVQH 467
            Q + +PK   TVR+        +  +P+ +      +++  L + +     + D E + 
Sbjct: 101 QQDVSSPKL--TVRETLSYAADLKLKAPRQERRRLVEELIAELGLKECSDTRVGDSEHRG 158

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
           LSGGE +R++I + +     +  +DEP+  LD+
Sbjct: 159 LSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
           cassette transporter protein, mitochondrial,
           hypothetical start
          Length = 720

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 81/176 (46%), Gaps = 24/176 (13%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR-FDDPPEWQEI----IKYFRGSELQ 153
           T  PG+   +VG +G GKST L+++     P  GR   D  + +E+    ++   G   Q
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQ 537

Query: 154 NYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQK--VGELLKLRMEKDSETVKGYIKTLQL 211
           +  T +  D I   +K   ++     I   ++K  + +L+  ++ K +ET+ G       
Sbjct: 538 D--TPLFNDTIWENVKFGRINATDNEIVTAIEKAQLSDLIH-KLPKGTETIVG------- 587

Query: 212 EHVLNREIG-KLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRD 266
                 E G  +SGGE QR AI    ++D  +  FDE +S LD     +  + I++
Sbjct: 588 ------ERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKE 637

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 454 PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
           P   + I+ +    +SGGE QR+AI   L     I   DE ++ LD+       K I+  
Sbjct: 579 PKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKEN 638

Query: 514 ILHNKKTAFVVEHDFIMATYLADKVIVFE 542
                KT+  + H  +     ADK+IV E
Sbjct: 639 FSDVAKTSVYIAHR-LRTIADADKIIVLE 666

>Scas_574.8
          Length = 702

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 104/249 (41%), Gaps = 37/249 (14%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE---- 405
           N TF Y + ++   + S T+  G  +      ++G +G+GK+T++KL+      ++    
Sbjct: 440 NVTFGYDSKRKILNNASFTIPGGLKT-----AVVGPSGSGKSTILKLVFRFYDPEQGRIL 494

Query: 406 -NSEKVQKLNV-------SMKPQTIAPKFPGTVRQ-LFFKKIRGQFLSPQFQTDVVK--- 453
            N   V++ +V        + PQ   P F  T+ + + F +I       +  T + K   
Sbjct: 495 INGVDVKEYDVDSLRRVMGVVPQD-TPLFNDTIWENVKFGRIDAT--DEEVHTVIEKAQL 551

Query: 454 -------PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIIC 506
                  P   + I+ +    +SGGE QR+AI   L   A I   DE ++ LD+      
Sbjct: 552 APLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQAL 611

Query: 507 SKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSK----HANARA-PESLLTGC 561
              IR       +T+  + H  +     ADK+IV E    K    H+   A P SL    
Sbjct: 612 LTTIRANFESGSRTSVYIAHR-LRTIADADKIIVLEDGAVKEEGTHSGLLATPGSLYANL 670

Query: 562 NRFLKNLNV 570
               +NL+V
Sbjct: 671 WNIQENLDV 679

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 81/179 (45%), Gaps = 19/179 (10%)

Query: 81  QHVTHRYSVNSFKLHRLPTPRPGQV-LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPE 139
           ++VT  Y      L+      PG +   +VG +G GKST LK++         RF DP +
Sbjct: 439 ENVTFGYDSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVF--------RFYDPEQ 490

Query: 140 WQEIIKYFRGSELQNYFTKMLEDNIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRME 196
            + +I    G +++ Y    L   +  + +  P + D I   +K G +    E +   +E
Sbjct: 491 GRILIN---GVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDATDEEVHTVIE 547

Query: 197 KDSETVKGYIKTL--QLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
           K    +   IK L    E ++      +SGGE QR AI    +++A +  FDE +S LD
Sbjct: 548 K--AQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALD 604

>Kwal_14.2052
          Length = 523

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 90/230 (39%), Gaps = 14/230 (6%)

Query: 198 DSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQR 257
           D +     ++TL+L+H+ NR    LS G+++R  +  S ++D D  + ++P   LD    
Sbjct: 133 DDQLYDCLLRTLKLKHLENRWAMGLSNGQMRRARLARSLLKDPDFTLIEDPFLGLDP--- 189

Query: 258 LNAAQIIRDLL---TPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSVYG----VVTLPSSV 310
             A  II + L   T    VI + +   + ++ +   C+     S  G    V  L   V
Sbjct: 190 -TATGIISEFLGNYTRCSIVIGLRYQDPIPEWCTHVCCVDADGISFQGEKSAVQKLIDQV 248

Query: 311 REGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMK-RTQGDFSLTV 369
           R   N  +D  +P   I          L   +     +     E   +  R +G+     
Sbjct: 249 RNDFNQQIDS-MPVSRISVDDLISMHPLSALSVHDIVKMPDVIELRGLSVRYKGEPIFDN 307

Query: 370 ESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKP 419
                S      + G+NGTGK+TL  L+        NS  V+   V  KP
Sbjct: 308 LCWSVSPKTTWHIRGDNGTGKSTLFSLITADHPQSWNSRVVEN-GVPRKP 356

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
           complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 93/214 (43%), Gaps = 28/214 (13%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN--- 406
           N TF Y   +R   + S T+ +G  +      ++G +G+GK+T++KL+    + ++    
Sbjct: 439 NVTFGYDPERRILNNVSFTIPAGMKT-----AIVGPSGSGKSTILKLVFRFYEPEQGRIL 493

Query: 407 --SEKVQKLN-------VSMKPQTIAPKFPGTVRQ-LFFKKIRG---QFLSPQFQTDVVK 453
                ++ L+       + + PQ   P F  T+ + + F  I     + L    +  + K
Sbjct: 494 VGGTDIRDLDLLSLRKAIGVVPQD-TPLFNDTIWENVKFGNISSSDDEILRAIEKAQLTK 552

Query: 454 -----PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSK 508
                P     ++ +    +SGGE QR+AI   L   A +   DE ++ LD+        
Sbjct: 553 LLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLH 612

Query: 509 VIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
            I++    N KT+  V H  +     ADK+IV E
Sbjct: 613 TIQQNFSSNSKTSVYVAHR-LRTIADADKIIVLE 645

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 75/159 (47%), Gaps = 24/159 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++         RF +P + + ++    G+++++     L  
Sbjct: 461 GMKTAIVGPSGSGKSTILKLVF--------RFYEPEQGRILVG---GTDIRDLDLLSLRK 509

Query: 163 NIKAIIK--PQYVDNIPRAIK-GPVQKVGELLKLRMEKDSETVKGYIKTLQ-LEHVLNRE 218
            I  + +  P + D I   +K G +    + +   +EK   T     K LQ L    +  
Sbjct: 510 AIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLT-----KLLQNLPKGASTV 564

Query: 219 IGK----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
           +G+    +SGGE QR AI    ++DA +  FDE +S LD
Sbjct: 565 VGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALD 603

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 ATP-binding cassette transporter
           family member, hypothetical start
          Length = 706

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 85/204 (41%), Gaps = 23/204 (11%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILA-----GKQKPNLGRFDDPPEWQEIIKYFR--GSE 151
           T RPG+ + +VG +G GKST   +L      G  +  LG  +D      + KY R  G  
Sbjct: 452 TVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLG--NDNIRDFNLRKYRRLLGVV 509

Query: 152 LQN--YFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTL 209
            Q    F+  + DNI   +  + V++  R  +   Q              +T  G   T 
Sbjct: 510 QQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANFPDGLQTTVGPRGT- 568

Query: 210 QLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLT 269
                      +LSGG+ QR A+  + + D  + + DE +S LD +     AQ ++    
Sbjct: 569 -----------QLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSA 617

Query: 270 PTKYVIAVEHDLSVLDYLSDFVCI 293
             K  I++ H +S + + S  + +
Sbjct: 618 RGKTTISIAHRVSTIQHSSRVIVL 641

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%)

Query: 467 HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            LSGG+ QR+A+  A  +   I ++DE ++ LDS+   + ++ +++     K T
Sbjct: 569 QLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARGKTT 622

>KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member singleton, start by similarity
          Length = 273

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 95/221 (42%), Gaps = 40/221 (18%)

Query: 352 TFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGV---------- 400
           T+ +P  KR+   D SL+VE     + ++LV+ G NG GK+TL+KLL+G           
Sbjct: 14  TYAFPGSKRSAIHDLSLSVEW----NKKVLVV-GNNGAGKSTLLKLLSGKHLCLGGNIKV 68

Query: 401 -----IQSDENSEKV---QKLNVSMKPQTIAPKFPGTVR-----QLFFKKIRGQFLSPQF 447
                   + + E V     L        I  +  G +       L   + RG+      
Sbjct: 69  GNKNPFAPNNDQESVILTTYLGTEWASMAIVHRDIGVLELLESIGLSHYRARGE------ 122

Query: 448 QTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICS 507
             ++V+ L++D  I+  +  LS G+ +RV + + L  P  + L+DE +  LD   R    
Sbjct: 123 --ELVRILEVD--INWRMFKLSDGQKRRVQLCMGLLKPFKVLLLDEVTVDLDVVARDRLF 178

Query: 508 KVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE-GTPSK 547
           + + R     + +     H F      AD++I  + GT ++
Sbjct: 179 QFLDRETRDRQCSVVYATHIFDGLAPWADEIIHLQDGTITR 219

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 40  VVGNNGAGKSTLLKLLSGKH 59

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 86/197 (43%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L +LA + +  +        G   D   +Q    Y +  +L
Sbjct: 869  KPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRD-TSFQRKTGYCQQQDL 927

Query: 153  QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
                T+ + D +K     +   +I RA                EK++  V+  IK L +E
Sbjct: 928  HGR-TQTVRDALKFSAYLRQPQSISRA----------------EKNA-YVEDIIKLLGME 969

Query: 213  HVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDL 267
               +  +G    G    + +R  IG+  V   ++ +F DEP+S LD +   +  Q+I+ L
Sbjct: 970  AYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKL 1029

Query: 268  LTPTKYVIAVEHDLSVL 284
            +   + ++   H  S +
Sbjct: 1030 VNHGQAILCTIHQPSAI 1046

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 79/177 (44%), Gaps = 28/177 (15%)

Query: 367  LTVESGDFSDSEILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSE 408
            LT   G      +  +MG +G GKTTL+ +LA     GV+  +               + 
Sbjct: 861  LTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRDTSFQRKTG 920

Query: 409  KVQKLNVSMKPQTI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV- 465
              Q+ ++  + QT+  A KF   +RQ    +   +     +  D++K L ++   D  V 
Sbjct: 921  YCQQQDLHGRTQTVRDALKFSAYLRQ---PQSISRAEKNAYVEDIIKLLGMEAYADAVVG 977

Query: 466  ---QHLSGGELQRVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      ++I++ + H +
Sbjct: 978  VTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQ 1034

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 104/247 (42%), Gaps = 28/247 (11%)

Query: 339 HDATEDTKGEANKTFEYPAMKRTQGDFSLTVE-SGDFSDSEILVMMGENGTGKTTLIKLL 397
            D T  T    N T+  P++     + ++  E SG     +IL +MG +G GKTTL+ +L
Sbjct: 377 EDDTLATLSFENITYSVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDIL 436

Query: 398 AGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ---------LFFKKIRGQFLS-PQF 447
           A   ++   S  ++   +SM  ++ + K  G V Q         +F   +    L  P+ 
Sbjct: 437 AMKRKTGHVSGSIKVNGISMDRKSFS-KIIGFVDQDDFLLPTLTVFETVLNSALLRLPKA 495

Query: 448 QTDVVKPLKIDDIIDQEV--------------QHLSGGELQRVAIVLALGIPADIYLIDE 493
            +   K  ++  ++++                + +SGGE +RV+I   L     +  +DE
Sbjct: 496 LSFEAKKARVYKVLEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDE 555

Query: 494 PSAYLD-SEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVF-EGTPSKHANA 551
           P++ LD S    +   ++R    +N+     +        YL DK+++  +G      NA
Sbjct: 556 PTSGLDASNANNVIECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNA 615

Query: 552 RAPESLL 558
           +     L
Sbjct: 616 KKVSEFL 622

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 23/211 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PGQ+L ++G +G GK+T L ILA K+K           G   D   + +II +    + 
Sbjct: 414 KPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDF 473

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
                 + E  + + +       +P+A+    +K       R+ K  E ++      ++ 
Sbjct: 474 LLPTLTVFETVLNSALL-----RLPKALSFEAKKA------RVYKVLEELRIIDIKDRII 522

Query: 213 HVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTK 272
              N     +SGGE +R +I    V    V   DEP+S LD     N  + +  L +   
Sbjct: 523 G--NEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYN 580

Query: 273 --YVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
              V+++    S + YL D + ++     VY
Sbjct: 581 RTLVLSIHQPRSNIFYLFDKLVLLSKGEMVY 611

>KLLA0D02156g complement(184520..186085) similar to sgd|S0002468
           Saccharomyces cerevisiae YDR061w, start by similarity
          Length = 521

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 3/84 (3%)

Query: 441 QFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDS 500
           +++ P+  T ++K LK+ DI D+    LS G+++R  +  +L    D+ +ID+P   LD 
Sbjct: 132 RYVDPELLTYLLKELKLIDIKDRWAMGLSNGQMRRTRLARSLLKEPDLTIIDDPFLGLDP 191

Query: 501 EQRIICSKVIRRFILHNKKTAFVV 524
               I SK + ++   +K T+ ++
Sbjct: 192 SACSIISKFLSKY---DKGTSVII 212

>Kwal_23.5161
          Length = 1489

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 77/169 (45%), Gaps = 33/169 (19%)

Query: 371  SGDFSDSEILVMMGENGTGKTTLIKLLA----GVIQSD-------------ENSEKVQKL 413
            SG  +   +  +MGE+G GKTTL+  LA    G+I  D               +  VQ+ 
Sbjct: 868  SGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDASFERRTGYVQQQ 927

Query: 414  NVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQ-----FQTDVVKPLKIDDIIDQEVQHL 468
            +V +K  T+   F       F  ++R     P+     +   +++ L ++D  +  +  +
Sbjct: 928  DVHVKEMTVRESFQ------FAARMRRPQSIPESEKLAYVEKIIEILDMEDYAEALIGDV 981

Query: 469  SGG----ELQRVAIVLALGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 512
              G    + ++V+I + L    D+ L +DEP++ LDS+      +++RR
Sbjct: 982  GYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRR 1030

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K  A V
Sbjct: 296 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTNLQKSIALV 354

>Scas_628.13
          Length = 1060

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 75/185 (40%), Gaps = 34/185 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PGQ+  ++G +G GK+T L ILA K+K           G       + ++I +    + 
Sbjct: 425 KPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFV---DQ 481

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
            +Y    L   +   +    +  +PR              +  E     V   ++ L++ 
Sbjct: 482 NDYLHPTL--TVYETVLNSALLRLPRT-------------MSFESKQSRVFQILEELRIF 526

Query: 213 HVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDL 267
            + +R IG      +SGGE +R +I    V    +   DEP+S LD     NA  +I  L
Sbjct: 527 DIKDRIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDAN---NANNVITSL 583

Query: 268 LTPTK 272
           +   K
Sbjct: 584 VRLAK 588

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 90/195 (46%), Gaps = 31/195 (15%)

Query: 338 LHDATEDTKGEANKTFEYPAMKR---TQGDFSLTVE---SGDFSDSEILVMMGENGTGKT 391
           L   T  T    N T+E P++ +   +Q + ++ V     G     +I  +MG +G GKT
Sbjct: 382 LKSETSATLSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKT 441

Query: 392 TLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ--------LFFKKIRGQFL 443
           TL+ +LA   ++ +   ++ K+N ++  +    K  G V Q          ++ +    L
Sbjct: 442 TLLDILAMKRKTGQVGGEI-KVNGNIMSRKSYSKLIGFVDQNDYLHPTLTVYETVLNSAL 500

Query: 444 -----SPQFQT------DVVKPLKIDDIIDQEVQH-----LSGGELQRVAIVLALGIPAD 487
                +  F++       +++ L+I DI D+ + +     +SGGE +RV+I   L     
Sbjct: 501 LRLPRTMSFESKQSRVFQILEELRIFDIKDRIIGNDFERGISGGEKRRVSIACELVTSPL 560

Query: 488 IYLIDEPSAYLDSEQ 502
           I  +DEP++ LD+  
Sbjct: 561 ILFLDEPTSGLDANN 575

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
           cerevisiae YCR011c ADP1 ATP-dependent permease, start by
           similarity
          Length = 1055

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 34/181 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN--------LGRFDDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K+K           G+     ++ ++I +    + 
Sbjct: 401 KPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLIGFV---DQ 457

Query: 153 QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
            +Y    L   +   +    +  +PR              +  E     V   ++ L++ 
Sbjct: 458 DDYLLPTL--TVYETVLNSALLRLPRT-------------MSFEAKQARVFHVLEELRIM 502

Query: 213 HVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDL 267
            + +R +G      +SGGE +R +I    V    V   DEP+S LD     NA  +I  L
Sbjct: 503 DIKDRIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAN---NANNVIECL 559

Query: 268 L 268
           +
Sbjct: 560 V 560

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 78/168 (46%), Gaps = 30/168 (17%)

Query: 359 KRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMK 418
           +R   D S  V+ G     EIL +MG +G GKTTL+ +LA   ++ + S  + ++N  + 
Sbjct: 390 QRVLNDISGLVKPG-----EILSIMGGSGAGKTTLLDILAMKRKTGDVSGSI-RVNGKVV 443

Query: 419 PQTIAPKFPGTVRQ--------LFFKKIRGQFL-----SPQFQT------DVVKPLKIDD 459
            +    K  G V Q          ++ +    L     +  F+        V++ L+I D
Sbjct: 444 SRKDYTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMD 503

Query: 460 IIDQEVQH-----LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
           I D+ V +     +SGGE +RV+I   L     +  +DEP++ LD+  
Sbjct: 504 IKDRIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANN 551

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 24/192 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG++  L+G +G GK+T L +LA  Q+ N+G                G  L N  +   
Sbjct: 872  KPGKMTALMGESGAGKTTLLNVLA--QRINMG-------------VITGDMLVNSQSLPA 916

Query: 161  EDNIKAIIKPQYVDNIPR-AIKGPVQKVGELLKLR---MEKDSETVKGYIKTLQLEHVLN 216
              N       Q  +++   +++  ++   EL + R   +E+  E V+  I  L +++   
Sbjct: 917  SFNRSCGYVAQADNHMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQNYAE 976

Query: 217  REIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPT 271
              +GK   G    + ++ +IG+  V    + +F DEP+S LD +   +  Q +R L    
Sbjct: 977  ALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSG 1036

Query: 272  KYVIAVEHDLSV 283
            + ++   H  S 
Sbjct: 1037 QSILCTIHQPSA 1048

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 82/186 (44%), Gaps = 43/186 (23%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  + +E++K ++G      EL 
Sbjct: 177 GEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVIYCPELD 236

Query: 154 NYFTKM-LEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQ-- 210
            +F K+ +++ I   +K           K P          R+  D  T K Y+  ++  
Sbjct: 237 FHFPKITVKETIDFALK----------CKTP----------RVRIDRMTRKQYVDNIRDM 276

Query: 211 ------LEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLN 259
                 L H    ++G      +SGGE +R ++  +   +A +Y +D  +  LD    L 
Sbjct: 277 WCTVFGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALE 336

Query: 260 AAQIIR 265
            AQ IR
Sbjct: 337 FAQAIR 342

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 296 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 5/32 (15%)

Query: 378 EILVMMGENGTGKTTLIKLLA-----GVIQSD 404
           ++  +MGE+G GKTTL+ +LA     GVI  D
Sbjct: 875 KMTALMGESGAGKTTLLNVLAQRINMGVITGD 906

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 88/210 (41%), Gaps = 28/210 (13%)

Query: 91  SFKLHRLPTPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRFDDPPEWQEIIK 145
           +F++H      PG+ +  VG +G GKST   +L      G    ++G +D        I 
Sbjct: 386 NFQIH------PGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYD--------IS 431

Query: 146 YFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGY 205
            F   + +     + ++ +  +     +DNI   +         L  L M   +     +
Sbjct: 432 AFNLRKYRRMLGVVQQEPL--LFNGTILDNITYGLHDK-----SLTDLNMALKAANCDQF 484

Query: 206 IKT--LQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQI 263
           IK   + L+ ++     +LSGG+ QR A+    +Q+ D+ + DE +S LD K      + 
Sbjct: 485 IKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKE 544

Query: 264 IRDLLTPTKYVIAVEHDLSVLDYLSDFVCI 293
           ++         I++ H LS + + S  + I
Sbjct: 545 LQRRQEAGMTTISIAHRLSTIRHSSRVIVI 574

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 76/183 (41%), Gaps = 25/183 (13%)

Query: 350 NKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEK 409
           N +F Y   K    + +  +  G     E +  +G +G GK+T+  LL    ++   +  
Sbjct: 370 NVSFAYSNGKSVLSEMNFQIHPG-----EHVCFVGGSGCGKSTISSLLLRYYRTGSGNIS 424

Query: 410 VQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQF---LSPQFQTDVVKPLK------- 456
           +   ++S        +  G V+Q   LF   I       L  +  TD+   LK       
Sbjct: 425 IGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTDLNMALKAANCDQF 484

Query: 457 -------IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKV 509
                  +D ++      LSGG+ QR+A+        DI ++DE ++ LD++   I +K 
Sbjct: 485 IKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKE 544

Query: 510 IRR 512
           ++R
Sbjct: 545 LQR 547

>KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces
           cerevisiae YGR281w YOR1 ATP-binding cassette transporter
           protein, start by similarity
          Length = 1454

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 113/253 (44%), Gaps = 43/253 (16%)

Query: 373 DFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFP----G 428
           D  ++E +++ G  GTGK++L+  LAG ++    S       +++K   +   +P     
Sbjct: 598 DVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGS-------MTIKGDLLLCGYPWVQNA 650

Query: 429 TVRQ--LF---FKKIRGQ----FLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIV 479
           TV+   LF   F K + Q      S Q   D++      +I ++ +  LSGG+  R+A+ 
Sbjct: 651 TVKDNILFGSPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERGIT-LSGGQKARIALA 709

Query: 480 LALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATY---LAD 536
            ++    DIYL D+  + +DS    +C  ++   ++      ++ +   I+AT+   L D
Sbjct: 710 RSVYKDMDIYLFDDVLSAVDSR---VCKHIVDECMM-----GYLKQKTRILATHQLSLID 761

Query: 537 KV--IVFEGTPSKHANARAPESLL--TGCNRFLKNLNVTFRR-----DTTSFRPRINKLD 587
           K   ++F G          PE L   TG +  ++  N          DT +    I  + 
Sbjct: 762 KASRVIFLGLDGSFDIGTVPELLKRNTGFSDLMQFQNSAPAEELEDDDTKAQNMEITAIS 821

Query: 588 SQMD--REQKLSG 598
           SQ D  ++Q LSG
Sbjct: 822 SQTDISKKQSLSG 834

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 21/138 (15%)

Query: 218 EIGK----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLT---P 270
           EIG+    LSGG+  R A+  S  +D D+Y+FD+  S +D +       I+ + +     
Sbjct: 690 EIGERGITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRV---CKHIVDECMMGYLK 746

Query: 271 TKYVIAVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFR 330
            K  I   H LS++D  S    I  G+   + + T+P  ++            ++ ++F+
Sbjct: 747 QKTRILATHQLSLIDKASR--VIFLGLDGSFDIGTVPELLKRNTGF-------SDLMQFQ 797

Query: 331 SEALQFRLHDATEDTKGE 348
           + A    L D  +DTK +
Sbjct: 798 NSAPAEELED--DDTKAQ 813

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 83/213 (38%), Gaps = 64/213 (30%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L +LA + +                                
Sbjct: 881  KPGTLTALMGSSGAGKTTLLDVLANRVR-------------------------------- 908

Query: 161  EDNIKAIIKPQYVDNIPRA--------------IKGPVQKVGELLK----LRMEKD-SET 201
               +  +    +VD +PR               + G  Q V + LK    LR  +  SE 
Sbjct: 909  ---VGVVTGDMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEA 965

Query: 202  -----VKGYIKTLQLEHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSY 251
                 V+  I+ L++E   +  +G    G    + +R  IG+  V   ++ +F DEP+S 
Sbjct: 966  EIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSG 1025

Query: 252  LDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVL 284
            LD +   +  Q++R L    + V+   H  S +
Sbjct: 1026 LDSQTAWSVCQLMRKLANHGQAVLCTIHQPSAI 1058

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 97/240 (40%), Gaps = 51/240 (21%)

Query: 367  LTVESGDFSDSEILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSE 408
            LT   G      +  +MG +G GKTTL+ +LA     GV+  D              N+ 
Sbjct: 873  LTNVDGWVKPGTLTALMGSSGAGKTTLLDVLANRVRVGVVTGDMFVDGLPRGASFQRNTG 932

Query: 409  KVQKLNVSMKPQTI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKI----DDIID 462
              Q+ ++    QT+  A KF   +RQ    +   +     +  D+++ L++    D I+ 
Sbjct: 933  YCQQQDLHGCTQTVRDALKFSAYLRQ---PQSVSEAEIDAYVEDIIRLLEMEAYADAIVG 989

Query: 463  QEVQHLSGGELQRVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRF-------- 513
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++R+         
Sbjct: 990  VTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQAVL 1049

Query: 514  -ILHNKKTAFVVEHDFIMATYLADKVIVFEGTP----------SKHANARAPESLLTGCN 562
              +H      + E D ++      + + F G             KH + + PE    GCN
Sbjct: 1050 CTIHQPSAILMQEFDRLLLLASGGRTVYFGGLGKGCATMVEYFEKHGSQKFPE----GCN 1105

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
           ATP-binding cassette (ABC) superfamily, equivalent to a
           "half-sized" ABC protein with one ATP-binding domain and
           one transmembrane domain, involved in release of
           peptides from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 93/227 (40%), Gaps = 28/227 (12%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPE---------WQEIIKYFRG 149
           T +PG+ +  VG +G GKST   +L      N G  +   E         ++ +I Y + 
Sbjct: 456 TIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQ 515

Query: 150 SELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTL 209
             L   F   + DNI   I P+  +   R I+  + K      L    D           
Sbjct: 516 EPL--LFNGTILDNILYCIPPEIAEQDDR-IRRAIGKANCTKFLANFPDG---------- 562

Query: 210 QLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLT 269
            L+ ++     +LSGG+ QR A+  + + D  V + DE +S LD +     A+ ++  + 
Sbjct: 563 -LQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE 621

Query: 270 PTKYVIAVEHDLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINI 316
                I++ H LS + + +  + +       +G V    S R+ I I
Sbjct: 622 RGFTTISIAHRLSTIKHSTRVIVL-----GKHGSVVETGSFRDLIAI 663

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 84/193 (43%), Gaps = 40/193 (20%)

Query: 350 NKTFEYPAMKRTQ--GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENS 407
           N +F YP   + Q   D ++T++ G     E +  +G +G+GK+T+  LL      +  S
Sbjct: 436 NVSFTYPTRPKHQIFKDLNITIKPG-----EHVCAVGPSGSGKSTIASLLLRYYDVNSGS 490

Query: 408 -----EKVQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQFL---SPQF--QTDVVK- 453
                E ++  N+    + I     G V+Q   LF   I    L    P+   Q D ++ 
Sbjct: 491 IEFGDEDIRNFNLRKYRRLI-----GYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRR 545

Query: 454 --------------PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLD 499
                         P  +  ++      LSGG+ QR+A+  A  +   + ++DE ++ LD
Sbjct: 546 AIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALD 605

Query: 500 SEQRIICSKVIRR 512
           S+   I +K ++R
Sbjct: 606 SQSEEIVAKNLQR 618

>Kwal_56.22747
          Length = 1538

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 95/219 (43%), Gaps = 40/219 (18%)

Query: 382  MMGENGTGKTTLIKLLAGVIQSDENSEKVQ------------KLNVSMKPQTIAPKFPGT 429
            ++G  G GK+TL   L  +++  E +  +             + N+S+ PQ  A  F GT
Sbjct: 1321 IVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLKDLRSNLSIIPQD-AQAFEGT 1379

Query: 430  VR-----------QLFFKKIRGQFLSP---QFQTDVVKPLKIDDIIDQEVQ----HLSGG 471
            VR           +  +K +    L P   +   D   P K +D++  ++     +LS G
Sbjct: 1380 VRTNLDPFEQYSDEEIWKALELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVG 1439

Query: 472  ELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--DFI 529
            + Q + +  AL   + I ++DE +A +DSE   +  + IR       +T   + H  D +
Sbjct: 1440 QRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEF--KDRTILTIAHRIDTV 1497

Query: 530  MATYLADKVIVFEGTPSKHANARAPESLLTGCNRFLKNL 568
            M +   DK++V +    K  +  +P +LL   +    NL
Sbjct: 1498 MDS---DKIMVLDKGEVKEFD--SPSNLLAQKDSIFYNL 1531

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 80/169 (47%), Gaps = 19/169 (11%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIA------PKFPGTVR 431
           +++ ++G  G GK+T ++ L G +    NS       V  +  ++A           +V+
Sbjct: 655 QLVCVVGRVGAGKSTFLQALLGQLPCISNSPSHASPTVHFRANSVALCSQQSWIMNASVK 714

Query: 432 Q--LFFKKI-RGQFLSPQFQTDVVKPLKI-----DDIIDQEVQHLSGGELQRVAIVLALG 483
              LF  +     + +      +V  L+I     + ++ ++   LSGG+  R+++  A+ 
Sbjct: 715 DNVLFGHRFDEATYKATLEACQLVPDLEILADGDETLVGEKGISLSGGQKARLSLARAVY 774

Query: 484 IPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMAT 532
             +D+YL+D+  + +D+E   +C ++I + +  +KKT  +     I+ T
Sbjct: 775 SRSDVYLLDDILSAVDAE---VCKRIIEQVL--SKKTGLLKNKTVILTT 818

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 glutathione
           S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 83/180 (46%), Gaps = 24/180 (13%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQK--LNVSMKPQTIAPKFPGTVRQLFF 435
           E+  ++G+ G+GK+ LI+ L G +   +    V     NVS  P  +     GTV+    
Sbjct: 654 ELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHGDVANVSQVPWIM----NGTVKD--- 706

Query: 436 KKIRGQFLSPQFQTDVVKP--LKID---------DIIDQEVQHLSGGELQRVAIVLALGI 484
             + G    P+F    +K   L ID          ++ ++   LSGG+  R+++  A+  
Sbjct: 707 NILFGHKYDPEFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYS 766

Query: 485 PADIYLIDEPSAYLDSE--QRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
            AD YL+D+P A +D    + +I   +    +LH+K    V+  + I    +AD + + E
Sbjct: 767 RADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTK--VLATNKITVLSIADSITLME 824

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 pleiotropic drug resistance
            protein, start by similarity
          Length = 1560

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 83/198 (41%), Gaps = 34/198 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G++G GK+T L  LA +    +        GR  D   +Q    Y +  +L
Sbjct: 921  KPGTLTALMGSSGAGKTTLLDALADRISTGVITGDVLVNGRPTDA-SFQRSTGYCQQQDL 979

Query: 153  QNYFTKMLED-NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQL 211
                  + E     A ++  Y  N+ +                 EKD E V+  I+ L++
Sbjct: 980  HGRTQTVREALTFSAYLRQPY--NVSKK----------------EKD-EYVETIIRLLEM 1020

Query: 212  EHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRD 266
            E   +  +G    G    + +R  IG+  V    + +F DEP+S LD +   +  Q++R 
Sbjct: 1021 ETYADALVGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRK 1080

Query: 267  LLTPTKYVIAVEHDLSVL 284
            L    + ++   H  S +
Sbjct: 1081 LANHGQAILCTIHQPSAI 1098

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 78/167 (46%), Gaps = 32/167 (19%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GVI  D              ++   Q+ ++  + Q
Sbjct: 925  LTALMGSSGAGKTTLLDALADRISTGVITGDVLVNGRPTDASFQRSTGYCQQQDLHGRTQ 984

Query: 421  TI--APKFPGTVRQLF--FKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGE 472
            T+  A  F   +RQ +   KK + +++       +++ L+++   D  V    + L+  +
Sbjct: 985  TVREALTFSAYLRQPYNVSKKEKDEYVET-----IIRLLEMETYADALVGVTGEGLNVEQ 1039

Query: 473  LQRVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
             +R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 1040 RKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQ 1086

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
            required for weak organic acid resistance, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 85/194 (43%), Gaps = 36/194 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDD---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  +     Y   ++
Sbjct: 869  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNAKPLPASFNRSCGYV--AQ 924

Query: 152  LQNYFTKM-LEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQ 210
              N+  ++ + ++++   + +   ++P                 +E+  E V+  I  L 
Sbjct: 925  ADNHMAELSVRESLRFAAELRQQSSVP-----------------LEEKYEYVEKIITLLG 967

Query: 211  LEHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIR 265
            +++     +GK   G    + ++ +IG+  V    + +F DEP+S LD +   +  Q +R
Sbjct: 968  MQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMR 1027

Query: 266  DLLTPTKYVIAVEH 279
             L    + ++   H
Sbjct: 1028 ALADSGQSILCTIH 1041

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 80/186 (43%), Gaps = 43/186 (23%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK L+G+    +   G F  D  +  E++  ++G      EL 
Sbjct: 174 GEMLFVVGRPGAGCSTFLKCLSGETSELVDVQGEFSYDGLDQSEMMSKYKGYVIYCPELD 233

Query: 154 NYFTKM-LEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQ-- 210
            +F K+ +++ I   +K           K P          R+  D  T K Y+  ++  
Sbjct: 234 FHFPKITVKETIDFALK----------CKTP----------RVRIDKMTRKQYVDNIRDM 273

Query: 211 ------LEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLN 259
                 L H    ++G      +SGGE +R ++  +   +A +Y +D  +  LD    L 
Sbjct: 274 WCTVFGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALE 333

Query: 260 AAQIIR 265
            AQ IR
Sbjct: 334 FAQAIR 339

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 293 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 339

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 5/32 (15%)

Query: 378 EILVMMGENGTGKTTLIKLLA-----GVIQSD 404
           ++  +MGE+G GKTTL+ +LA     GVI  D
Sbjct: 872 KMTALMGESGAGKTTLLNVLAQRINMGVITGD 903

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
           Saccharomyces cerevisiae YPL058c PDR12 multidrug
           resistance transporter, start by similarity
          Length = 1518

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 90/223 (40%), Gaps = 27/223 (12%)

Query: 95  HRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS 150
           H +     G++L +VG  G G ST LK ++G+    +   G F  D     E+++ F+G 
Sbjct: 167 HCVGVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGDFSYDGLSQAEMMEKFKGY 226

Query: 151 -----ELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGY 205
                EL  +F K+    +K  I      +     K P  ++  L + +   +   +  +
Sbjct: 227 VIYCPELDFHFPKI---TVKETI------DFALKCKTPRVRIDHLSRNQYVDNMRDL--W 275

Query: 206 IKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNA 260
                L H     +G      +SGGE +R ++  +    A +Y +D  +  LD    L  
Sbjct: 276 CTVFGLRHTYATNVGNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEF 335

Query: 261 AQIIRDL--LTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSVY 301
           AQ IR    L     ++A+      +  L D   ++Y    VY
Sbjct: 336 AQAIRTATNLMNNSAIVAIYQAGENIYELFDKTTVLYNGKQVY 378

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 84/197 (42%), Gaps = 34/197 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF---------DDPPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ ++G           D P  +     Y   S+
Sbjct: 870  KPGKMTALMGESGAGKTTLLNVLA--QRISVGVITGDMLVNAKDLPLSFNRSCGYVAQSD 927

Query: 152  LQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQL 211
                   M E +++  ++       P+++  P+Q           +  + V+  I  L +
Sbjct: 928  -----NHMGELSVRESLRFAAELRQPKSV--PLQ-----------EKYDYVEKIISLLGM 969

Query: 212  EHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRD 266
            E      IGK   G    + ++ +IG+  V    + +F DEP+S LD +   +  Q +R 
Sbjct: 970  EKYAEAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1029

Query: 267  LLTPTKYVIAVEHDLSV 283
            L    + ++   H  S 
Sbjct: 1030 LADSGQSILCTIHQPSA 1046

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V AL + A IY  D  +  LD+   +  ++ IR
Sbjct: 294 VRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIR 340

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 5/32 (15%)

Query: 378 EILVMMGENGTGKTTLIKLLA-----GVIQSD 404
           ++  +MGE+G GKTTL+ +LA     GVI  D
Sbjct: 873 KMTALMGESGAGKTTLLNVLAQRISVGVITGD 904

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L I    PA  YL DE  A LD + RI  ++ I+  
Sbjct: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNL 1225

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 89/180 (49%), Gaps = 21/180 (11%)

Query: 368 TVESGDFSDSEILVMMGENGTGKTTLIKLLAGVI-----QSDENSEKVQ--KLNVSMKPQ 420
           ++++ +   S ++ ++G  G GK+T++K + G +      +D  S + Q     V+  PQ
Sbjct: 636 SIDNFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGNNDHLSPQFQINATTVAYCPQ 695

Query: 421 TIAPKFPGTVRQ--LFFKKIRGQFLSP-----QFQTDV-VKPLKIDDIIDQEVQHLSGGE 472
             A     +V+   LF  K    F        Q   D+ V P   + ++ ++   LSGG+
Sbjct: 696 E-AWIMNASVKDNILFGHKYDEAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGGQ 754

Query: 473 LQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMAT 532
             R+++  A+   AD+YL+D+  + +D+E   +C  +I+  +  ++KT  + +   ++AT
Sbjct: 755 KTRLSLARAVYSRADLYLLDDILSAVDTE---VCKTIIKEVL--DEKTGLLKDKSIVLAT 809

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 5/92 (5%)

Query: 467  HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH 526
            +LS G+ Q + +  AL   + I ++DE +A +D E   I  + IR+      +T   + H
Sbjct: 1428 NLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEF--ADRTILTIAH 1485

Query: 527  DFIMATYLADKVIVFEGTPSKHANARAPESLL 558
              +   + +D++IV +G   K  +   PE+LL
Sbjct: 1486 R-LDTVFDSDRIIVLDGGEVKEFD--KPETLL 1514

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
           Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
           cassette (ABC) transporter family member, hypothetical
           start
          Length = 789

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 86/200 (43%), Gaps = 32/200 (16%)

Query: 352 TFEYPAMKRTQ--GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLL-------AGVIQ 402
           +F YP  K  Q   D + T+E G       + ++G +G GK+T+  LL       +G I 
Sbjct: 478 SFSYPTRKTNQIFKDLNFTIEPGSN-----VCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532

Query: 403 SDENSEKVQKLNV-SMKPQ-TIAPKFP----GTVRQLFFKKIRGQFLSPQFQTDVVK--- 453
            D   + + KL+  S++ Q  +  + P    GT+R+     +  Q    + ++   K   
Sbjct: 533 VD--GQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC 590

Query: 454 -------PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIIC 506
                  P   + II      LSGG+ QR+AI  AL     I ++DE ++ LD E     
Sbjct: 591 HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650

Query: 507 SKVIRRFILHNKKTAFVVEH 526
           +  + R +   + T   + H
Sbjct: 651 NYTLGRLMKSKELTIISIAH 670

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKY-VIAVEHD 280
           LSGG+ QR AI  + +    + + DE +S LDV+        +  L+   +  +I++ H 
Sbjct: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHR 671

Query: 281 LSVL 284
           LS +
Sbjct: 672 LSTI 675

>Scas_567.1
          Length = 810

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 35/182 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  +  E++  ++G      EL 
Sbjct: 180 GEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDGLDQAEMMSKYKGYVVYCPELD 239

Query: 154 NYFTKM-LEDNIKAIIKPQY----VDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKT 208
            +F K+ +++ I   +K +     +DN+ RA     + V  L  +           +   
Sbjct: 240 FHFPKITVKETIDFALKCKTPRTRIDNMSRA-----EYVDSLRDM-----------WCTV 283

Query: 209 LQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQI 263
             L H    ++G      +SGGE +R ++  +    A +Y +D  +  LD    L  AQ 
Sbjct: 284 FGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQA 343

Query: 264 IR 265
           IR
Sbjct: 344 IR 345

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIR 511
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 299 VRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIR 345

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 79/165 (47%), Gaps = 28/165 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVI---------QSDENSEK----VQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GVI         Q D++  +     Q+ ++ +K  
Sbjct: 888  LTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSFARSIGYCQQQDLHLKTS 947

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 474
            T+  + +F   +RQ     I  +    Q+  DV+K L+++   D  V    + L+  + +
Sbjct: 948  TVRESLRFSAYLRQPADVSIEEK---NQYVEDVIKILEMEQYADAVVGVPGEGLNVEQRK 1004

Query: 475  RVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1005 RLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1049

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 85/204 (41%), Gaps = 46/204 (22%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILA---------------GKQKPNLGRFDDPPEWQEIIK 145
            +PG +  L+G +G GK+T L  LA               GKQ+      DD   +   I 
Sbjct: 884  KPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQR------DD--SFARSIG 935

Query: 146  YFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGY 205
            Y +  +L +  T  + ++++              ++ P         + +E+ ++ V+  
Sbjct: 936  YCQQQDL-HLKTSTVRESLR----------FSAYLRQPAD-------VSIEEKNQYVEDV 977

Query: 206  IKTLQLEHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNA 260
            IK L++E   +  +G    G    + +R  IG+       + +F DEP+S LD +   + 
Sbjct: 978  IKILEMEQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI 1037

Query: 261  AQIIRDLLTPTKYVIAVEHDLSVL 284
             Q+++ L    + ++   H  S +
Sbjct: 1038 CQLMKKLANHGQAILCTIHQPSAI 1061

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
            Saccharomyces cerevisiae YLL015w BPT1, start by
            similarity
          Length = 1568

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 90/208 (43%), Gaps = 37/208 (17%)

Query: 382  MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSM-------KPQTIAPK----FPGTV 430
            ++G  G GK+TL   L  +++  E    +  +++S        +  +I P+    F GTV
Sbjct: 1347 VVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDAQAFEGTV 1406

Query: 431  RQLF-----------FKKIRGQFLSPQFQTDVVKPLKID-----DIIDQEV----QHLSG 470
            R              +K +    L P  +  +V  L  D     D++D ++     +LS 
Sbjct: 1407 RSNLDPFNRHTDAEIWKALELSHLKPHIER-IVSELPDDENKPTDLLDTQISDNGNNLSM 1465

Query: 471  GELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIM 530
            G+ Q + +  AL  P+ I ++DE +A +D E   I  + IR       +T   + H  I 
Sbjct: 1466 GQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRT--AFKDRTILTIAHR-ID 1522

Query: 531  ATYLADKVIVFEGTPSKHANARAPESLL 558
                +DK++V +    K  +   P++LL
Sbjct: 1523 TVLDSDKIMVLDKGEVKEFD--TPDNLL 1548

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 83/188 (44%), Gaps = 32/188 (17%)

Query: 341 ATEDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAG- 399
           ++EDT  EA  +    A+K        ++E+     +++  ++G  G+GK+T ++ + G 
Sbjct: 625 SSEDTDEEAEISSPGVALK--------SIENFSAKKAQLTCIVGRVGSGKSTFLQAILGQ 676

Query: 400 --VIQSDENSEKVQKLNVSMKPQTIAPKFPGTV---------------RQLFFKKIRGQF 442
              + SD  S    K+ +        P+ P  +                 ++ K I+   
Sbjct: 677 LPCVSSDSASGVKPKVVIRADNLAYCPQQPWIMNASLKDNILFGYKYDEAMYKKTIKACQ 736

Query: 443 LSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
           L P  +   + P     ++ ++   LSGG+  R+++  A+   AD+YL+D+  + +DS  
Sbjct: 737 LLPDLE---ILPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSH- 792

Query: 503 RIICSKVI 510
             +C  +I
Sbjct: 793 --VCKSII 798

>Scas_468.1
          Length = 691

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 213 HVLNREIGK----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLL 268
           H  + +IG     LSGG+ QR AI  + ++  ++ + DE +S LDV+           L+
Sbjct: 517 HTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLM 576

Query: 269 -TPTKYVIAVEHDLSVL 284
            T +  ++++ H LS +
Sbjct: 577 KTKSMTIVSIAHRLSTI 593

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 468 LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
           LSGG+ QR+AI  AL    +I ++DE ++ LD E
Sbjct: 530 LSGGQKQRIAIARALIKKPNILILDEATSALDVE 563

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 169  KPQYVDNIPRA--IKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREI--GKLSG 224
            KP++ D   R   + G  + V    +LR    S  +  +++TL   + LN  +  G +SG
Sbjct: 1117 KPKFFDGTVRENLVYGLKRNVSNS-ELRSVLKSVDLLSFVQTL--PNDLNTRVHDGLMSG 1173

Query: 225  GELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHD 280
            G+ QR +I  + ++   + + DE +S LD       A++IR +L     VI + H 
Sbjct: 1174 GQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLKNVT-VIVITHS 1228

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 117/271 (43%), Gaps = 45/271 (16%)

Query: 323  PAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVM 382
            P++N  F S A          +T   +N +F + +    +   SL+ E      +E + +
Sbjct: 1017 PSQNQSFFSTA-------GNRETIKISNLSFAFSSAPMNKIFNSLSCE---ICLNETVGI 1066

Query: 383  MGENGTGKTTLI------------KLLAGVIQSDENSEKVQKLNVSMKPQTIAPKF-PGT 429
            +GE+G+GK+TL             K+  G I  ++  E   +  +S+  Q   PKF  GT
Sbjct: 1067 VGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQ--KPKFFDGT 1124

Query: 430  VRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHL---------SGGELQRVAIVL 480
            VR+     ++    + + ++ V+K + +   +      L         SGG+ QR++I  
Sbjct: 1125 VRENLVYGLKRNVSNSELRS-VLKSVDLLSFVQTLPNDLNTRVHDGLMSGGQAQRLSIAR 1183

Query: 481  ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540
             L     I ++DE ++ LD+      +++IR  +L N     +   + +M   + D+V+V
Sbjct: 1184 TLLRQPKIIILDECTSALDAANSFAIAELIRT-VLKNVTVIVITHSEQLMQ--ICDRVLV 1240

Query: 541  F-------EGTPSKHANARAPESLLTGCNRF 564
                    EG+ ++   +R     +  C R+
Sbjct: 1241 LKKGKVKEEGSYAELFESRGELYRIVSCTRY 1271

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 454 PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
           P  ID ++ +    LSGG+ QRVA+  A      + ++DE  + LD   R +  + IR +
Sbjct: 482 PNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHW 541

Query: 514 ILHNKKTAFVVEHDF 528
                KT  ++ H++
Sbjct: 542 --RKGKTTIILTHEY 554

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 211 LEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIR 265
           ++ +L R    LSGG+ QR A+  + +++  V + DE  S LD+  R    + IR
Sbjct: 485 IDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIR 539

>CAGL0L06402g 718726..723333 highly similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 or sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 74/164 (45%), Gaps = 24/164 (14%)

Query: 350 NKTFEY---PAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN 406
           N TF +   P  K    + +   + G+ S      ++G+ G+GK+  ++ L G +   + 
Sbjct: 650 NATFLWKRKPEYKVALKNINYQAKKGELS-----CIVGKVGSGKSAFLQSLLGDLFRVKG 704

Query: 407 SEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKP--LKID------ 458
              +   +V+   Q +A    GTVR      + G    P+F    +K   L ID      
Sbjct: 705 FATIHG-SVAYVSQ-VAWIMNGTVRD---NVLFGHKYDPEFYEKTIKACALTIDLATLVD 759

Query: 459 ---DIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLD 499
               ++ ++   LSGG+  R+++  A+   AD YL+D+P A +D
Sbjct: 760 GDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVD 803

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 92/220 (41%), Gaps = 49/220 (22%)

Query: 382  MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNV------------SMKPQTIAPKFPGT 429
            ++G  G GK++L   L  +I++      +  +++            S+ PQ  +  F GT
Sbjct: 1326 IVGRTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQD-SQVFEGT 1384

Query: 430  VRQLFFKKIRGQFLSPQFQ---TDVVKPLKIDDIIDQEVQ---------------HLSGG 471
            +R+          + P  Q    D+ + L++  + +  +Q               +LS G
Sbjct: 1385 IRE---------NIDPTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVG 1435

Query: 472  ELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--DFI 529
            + Q + +  AL +P+ + ++DE +A +D E   +  + IR       +T   + H  + I
Sbjct: 1436 QRQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQETIRTSF--KDRTILTIAHRINTI 1493

Query: 530  MATYLADKVIVFEGTPSKHANARAPESLLTGCNRFLKNLN 569
            M     D++IV +    K      PE+LL   N    +L+
Sbjct: 1494 MDN---DRIIVLD--KGKVVEFDTPEALLKNTNSIFYSLS 1528

>Scas_711.39
          Length = 1227

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +I++        
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171

Query: 521  AFVVEHDFIMATYLAD 536
               V   FI  T+  D
Sbjct: 1172 -LSVNAQFICTTFRTD 1186

>Kwal_14.2435
          Length = 1247

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197

Query: 521  AFVVEHDFIMATYLADKVIV 540
                   FI  T+  D + V
Sbjct: 1198 -------FICTTFRTDMLQV 1210

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
           sterol uptake and anaerobic growth, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 206 IKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNA 260
           ++   L HVL   +G      +SGGE +R +I  + + +  VY++D  +  LD    L+ 
Sbjct: 151 LREFGLSHVLKTIVGNDFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALDF 210

Query: 261 AQIIRDLLTPTKYV 274
            +I+R +   T+ V
Sbjct: 211 LEILRKMAKATRSV 224

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 354 EYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQS 403
            +  +  T G   L   +  F  S +  +MGE+G GKTTL+ +L+  +++
Sbjct: 752 SWKNINYTVGTKKLINNASGFISSGLTALMGESGAGKTTLLNVLSQRVET 801

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 437 KIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSA 496
           +IR + L     + V+K +  +D      + +SGGE +R++I+        +YL D  + 
Sbjct: 145 QIRNELLREFGLSHVLKTIVGNDFF----RGVSGGERKRISIIETFIANGSVYLWDNSTK 200

Query: 497 YLDSEQRIICSKVIRR 512
            LDS   +   +++R+
Sbjct: 201 GLDSATALDFLEILRK 216

>Kwal_27.9666
          Length = 1474

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 84/193 (43%), Gaps = 24/193 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFD-------DPPEWQEIIKYFRGSELQ 153
            +PG +  L+G +G GK+T L  LA +    +   D           +   I Y +  +L 
Sbjct: 854  KPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSIGYCQQQDL- 912

Query: 154  NYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLK-LRMEKDSETVKGYIKTLQLE 212
            +  T  + ++++     +   ++P + K   + V E++K L MEK ++ V G        
Sbjct: 913  HLQTATVRESLRFAAHLRQPQSVPSSEKD--KYVDEVIKILEMEKYADAVVGVAG----- 965

Query: 213  HVLNREIGKLSGGELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPT 271
              LN E       + +R  IG+       + +F DEP+S LD +   +  Q++R L    
Sbjct: 966  EGLNVE-------QRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHG 1018

Query: 272  KYVIAVEHDLSVL 284
            + ++   H  S L
Sbjct: 1019 QAILCTIHQPSAL 1031

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 46/174 (26%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD--ENSEK-----------VQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GV+  D   N  K            Q+ ++ ++  
Sbjct: 858  LTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSIGYCQQQDLHLQTA 917

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQ---------FQTDVVKPLKIDDIIDQEV---- 465
            T+  + +F   +RQ            PQ         +  +V+K L+++   D  V    
Sbjct: 918  TVRESLRFAAHLRQ------------PQSVPSSEKDKYVDEVIKILEMEKYADAVVGVAG 965

Query: 466  QHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 966  EGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHGQ 1019

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
           complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 77/198 (38%), Gaps = 28/198 (14%)

Query: 352 TFEYPAMKRTQ--GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEK 409
           +F YP    +Q      LT+  G       + ++G +G GK+T+  LL     ++  +  
Sbjct: 463 SFSYPTRPTSQIFKKLRLTITPGSN-----VCIVGPSGRGKSTIASLLLRFYDANSGTIL 517

Query: 410 VQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQF---LSPQFQTDVVK---------- 453
           +   ++S        K  G V+Q   L    IR      LS     D ++          
Sbjct: 518 IDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHN 577

Query: 454 -----PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSK 508
                P   D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E     + 
Sbjct: 578 FITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 637

Query: 509 VIRRFILHNKKTAFVVEH 526
            + R +   + T   + H
Sbjct: 638 TLGRLMRSKEITIVSIAH 655

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKY-VIAVEHD 280
           LSGG+ QR AI  + ++   + + DE +S LDV+        +  L+   +  ++++ H 
Sbjct: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656

Query: 281 LSVLDYLSDFVCI 293
           LS +    + V +
Sbjct: 657 LSTIRRSENIVVL 669

>Scas_587.8
          Length = 715

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 78/186 (41%), Gaps = 32/186 (17%)

Query: 350 NKTFEYPA--MKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENS 407
           N +F YP         + S++++ G     E + ++G +G+GK+T+  LL         S
Sbjct: 447 NVSFAYPTRPTHSILNNLSISIQPG-----EHVCIVGPSGSGKSTVSSLLLRYYDVSTGS 501

Query: 408 EKVQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQFL------------SPQF----- 447
            K+   N+         +  G V+Q   LF   I    L            SP       
Sbjct: 502 IKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALE 561

Query: 448 QTDVVKPLK-----IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQ 502
           Q +  K LK     ++ ++      LSGG+ QR+A+  A  +   + ++DE ++ LDS+ 
Sbjct: 562 QANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQS 621

Query: 503 RIICSK 508
             I +K
Sbjct: 622 EEIVAK 627

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 109/287 (37%), Gaps = 44/287 (15%)

Query: 346 KGE---ANKTFEYPAMKRTQ--GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGV 400
           KGE    N +F YP     Q   + + T++SG    S + V+ G +G GK+T+  LL   
Sbjct: 470 KGEIKFENVSFSYPTRSANQIFNNLNFTIDSG----SNVCVV-GPSGRGKSTIASLLLKY 524

Query: 401 IQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRGQFLSPQFQTDVVKPLK- 456
                    +   ++S        +  G V+Q   L    IR         T  +  ++ 
Sbjct: 525 YNPTSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRS 584

Query: 457 -----------------IDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLD 499
                             + +I  +   LSGG+ QR+AI  AL    +I ++DE ++ LD
Sbjct: 585 VSKKCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALD 644

Query: 500 SEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSKHANARAPESLLT 559
            E     +  + + +     T   + H  +     ++ VIV     S     +  E   +
Sbjct: 645 VESEGAINYTLGQLMKSRDITIISIAHR-LSTIRRSENVIVLGDDGSVVEMGKFKELYAS 703

Query: 560 GCNRFLKNLNVTFRRDTTSFR-----------PRINKLDSQMDREQK 595
             ++  K LN    RDTTS R           P+  KL  +   EQ+
Sbjct: 704 KESKLYKLLNEK-ARDTTSKRNAEAVEKNDPSPKAEKLSDEEKEEQR 749

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 212 EHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPT 271
           E V+  +   LSGG+ QR AI  + ++  ++ + DE +S LDV+        +  L+   
Sbjct: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662

Query: 272 KY-VIAVEHDLSVL 284
              +I++ H LS +
Sbjct: 663 DITIISIAHRLSTI 676

>Scas_643.1
          Length = 1289

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 82/180 (45%), Gaps = 30/180 (16%)

Query: 354 EYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQS---------- 403
            +  +  T GD  L      F  S +  +MGE+G GKTTL+ +LA  I+S          
Sbjct: 746 SWKNINYTIGDKKLINNVSGFIGSGLTALMGESGAGKTTLLNVLAQRIESGVVTGELLID 805

Query: 404 -----DENSEK-----VQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVK 453
                +EN+ +     VQ+ ++ +   T+      + R      +RG       +T +  
Sbjct: 806 GKPLTNENAFRRSIGFVQQQDLHLDLLTVKESLEISCR------LRGDGDMKYLET-ISS 858

Query: 454 PLKIDDIIDQEVQHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRR 512
            LK+   +++ V  LS  + + ++I + L   P+ +  +DEP++ LDSE  +   K +++
Sbjct: 859 LLKLP--MNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKK 916

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 206 IKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNA 260
           ++   L HV++  +G      +SGGE +R +I  + + +  VY++D  +  LD    L+ 
Sbjct: 162 LREFGLSHVMDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDF 221

Query: 261 AQIIRDLLTPTKYV 274
             I++ +   TK V
Sbjct: 222 LSILKKMTEATKSV 235

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query: 457 IDDIIDQE-VQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
           +D ++  + V+ +SGGE +R++I+        +YL D  +  LDS   +    ++++   
Sbjct: 171 MDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTE 230

Query: 516 HNKKTAFV--------VEHDFIMATYLADKVIVFEGT 544
             K    V        + + F     L+D   VF GT
Sbjct: 231 ATKSVNLVKISQASDKIVNKFDKILMLSDSYQVFYGT 267

>Scas_714.42
          Length = 1520

 Score = 36.6 bits (83), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 76/165 (46%), Gaps = 28/165 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GVI  D              +    Q+ ++ +K  
Sbjct: 901  LTALMGASGAGKTTLLDCLAERVTMGVITGDVLVNGRPRDQSFPRSIGYCQQQDLHLKTS 960

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 474
            T+  + +F   +RQ     I  +    Q+  DV+K L+++   D  V    + L+  + +
Sbjct: 961  TVRESLRFSAYLRQPADVSIEEK---NQYVEDVIKILEMEAYADAVVGVAGEGLNVEQRK 1017

Query: 475  RVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1018 RLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLADHGQ 1062

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 84/197 (42%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        GR  D   +   I Y +  +L
Sbjct: 897  KPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVLVNGRPRDQ-SFPRSIGYCQQQDL 955

Query: 153  QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
             +  T  + ++++              ++ P         + +E+ ++ V+  IK L++E
Sbjct: 956  -HLKTSTVRESLR----------FSAYLRQPAD-------VSIEEKNQYVEDVIKILEME 997

Query: 213  HVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDL 267
               +  +G    G    + +R  IG+       + +F DEP+S LD +   +  Q+++ L
Sbjct: 998  AYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKL 1057

Query: 268  LTPTKYVIAVEHDLSVL 284
                + ++   H  S +
Sbjct: 1058 ADHGQAILCTIHQPSAI 1074

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 89/221 (40%), Gaps = 47/221 (21%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD--------ENSE-------KVQKLNVSMK 418
            +  +MG +G GKTTL+  LA     GVI  D        +NS        + Q L++S  
Sbjct: 891  LTALMGSSGAGKTTLLDCLASRVTMGVITGDMFVNGHLRDNSFPRSIGYCQQQDLHLSTS 950

Query: 419  PQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 474
                + +F   +RQ     I  +     +  DV+  L++    D  V    + L+  + +
Sbjct: 951  TVRESLRFSAYLRQPSSVSIEEK---NNYVEDVINILEMQQYADAVVGVAGEGLNVEQRK 1007

Query: 475  RVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRF---------ILHNKKTAFVV 524
            R+ I + L   P  +  +DEP++ LDS+      +++R+           +H      + 
Sbjct: 1008 RLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQAILCTIHQPSALLMQ 1067

Query: 525  EHDFIMATYLADKVIVF----EGTP------SKHANARAPE 555
            E D ++      K + F    EG         KH  ++ PE
Sbjct: 1068 EFDILLFLQKGGKTVYFGNLGEGCQEMINYFEKHGASKCPE 1108

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 96/228 (42%), Gaps = 27/228 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L  LA +    +   D          +  G    N F + +
Sbjct: 887  KPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGD---------MFVNGHLRDNSFPRSI 937

Query: 161  EDNIKAIIKPQYVDNIPRAIKGPVQKVGELLK---LRMEKDSETVKGYIKTLQLEHVLNR 217
                    + Q +      ++  ++    L +   + +E+ +  V+  I  L+++   + 
Sbjct: 938  -----GYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEKNNYVEDVINILEMQQYADA 992

Query: 218  EIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPTK 272
             +G    G    + +R  IG+       + +F DEP+S LD +   +  Q++R L    +
Sbjct: 993  VVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

Query: 273  YVIAVEHDLSVLDYLSDFVCIIY---GVPSVYGVVTLPSSVREGINIF 317
             ++   H  S L  + +F  +++   G  +VY    L    +E IN F
Sbjct: 1053 AILCTIHQPSAL-LMQEFDILLFLQKGGKTVY-FGNLGEGCQEMINYF 1098

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 6/56 (10%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQS---DENSEKVQKLNVSMKPQTIAPKFPGTV 430
           ++LV++G  G+G TTL+K ++  I     DENS  V   N  + P+TI   F G V
Sbjct: 175 DLLVVLGRPGSGCTTLLKTISSNIDGYNVDENS--VISYN-GLDPRTIKKHFRGEV 227

>Kwal_56.22329
          Length = 776

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%)

Query: 454 PLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 513
           P   D II      LSGG+ QR+AI  AL     I ++DE ++ LD E     +  + + 
Sbjct: 614 PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKL 673

Query: 514 ILHNKKTAFVVEH 526
           +   + T   + H
Sbjct: 674 MKSKELTIISIAH 686

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKY-VIAVEHD 280
           LSGG+ QR AI  + ++   + + DE +S LDV+        +  L+   +  +I++ H 
Sbjct: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687

Query: 281 LSVL 284
           LS +
Sbjct: 688 LSTI 691

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +++  
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL 1175

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
           Saccharomyces cerevisiae YLL048c YBT1 yeast bile
           transporter, start by similarity
          Length = 1650

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 89/218 (40%), Gaps = 25/218 (11%)

Query: 347 GEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN 406
           G  N TF +    +   DF L   + DF   ++ V++G  G+GKT+L+  L G ++    
Sbjct: 700 GLQNATFTW---DKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNG 756

Query: 407 SEKVQKLN------VSMKPQTIAPKFPGTVRQLFFKKIRGQFL--SPQFQT--------- 449
              V  LN      V     T +  +      L    +R   L  +P  +          
Sbjct: 757 KVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNENRYNAVISAC 816

Query: 450 DVVKPLKIDDIIDQ-EVQH----LSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRI 504
            + +  +I    DQ E+      LSGG+ QRV++  +L   +   L+D+  + +DS   +
Sbjct: 817 GLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTAL 876

Query: 505 ICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
              +      L   +T  +V H+  +    AD VI+ E
Sbjct: 877 WIYENCITGPLMEGRTCVLVSHNVALTLKNADWVIIME 914

>Kwal_27.11147
          Length = 323

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%)

Query: 347 GEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN 406
           G ANK       K    D  L  E+    D ++LV+ G+ G GK+T   LL   + SDE+
Sbjct: 38  GCANKEICESLPKGPDPDIPLITENLSQIDHKVLVLSGKGGVGKSTFTSLLCWALSSDED 97

>Scas_472.1*
          Length = 393

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 11/89 (12%)

Query: 465 VQHLSGGELQRVAIVLALGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 522
           ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 243 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 296

Query: 523 VVEHDFIMATYLADKVIVFEG---TPSKH 548
           ++ H       L ++V   +    TPS H
Sbjct: 297 IITHSAEFTKNLTEEVWAVKDGKMTPSGH 325

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 352 TFEYPAMKRTQ-GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAG 399
           TF+YP   + Q  D S        S S  + ++G NG GK+TLI +L G
Sbjct: 22  TFQYPGTTKPQISDVSFQC-----SLSSRIAVIGPNGAGKSTLINVLTG 65

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 13/80 (16%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  +++        
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174

Query: 521  AFVVEHDFIMATYLADKVIV 540
                +  FI  T+  D + V
Sbjct: 1175 -LSSQAQFICTTFRGDMIAV 1193

>Scas_693.42
          Length = 1512

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 100/242 (41%), Gaps = 28/242 (11%)

Query: 339  HDATEDTKGEANKTFE-YPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLL 397
            H   E    E +  FE Y    R + D  L   +      E + ++G  G GK++L   L
Sbjct: 1258 HRPAETWPDEGDIKFEHYSTRYRPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLAL 1317

Query: 398  AGVIQSDENSEKVQKL------------NVSMKPQTIAPKFPGTVRQ------LFFKKIR 439
              +I++      +  +             +S+ PQ  +  F GTVR+       +  +  
Sbjct: 1318 FRIIEASSGRIVIDNVPINEIGLYDLRHKLSIIPQD-SQVFEGTVRENIDPTNEYTDEQI 1376

Query: 440  GQFLSPQFQTDVVKPLKIDDIIDQEVQ---HLSGGELQRVAIVLALGIPADIYLIDEPSA 496
               L+     D +  +  + + +Q  +   +LS G+ Q + +  AL +P+ I L+DE +A
Sbjct: 1377 WNVLALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATA 1436

Query: 497  YLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFEGTPSKHANARAPES 556
             +D E   +  + IR       +T   + H  I     +D++IV +    K  +  +PE 
Sbjct: 1437 AVDVETDKVIQETIRT--AFKDRTILTIAHR-INTIMDSDRIIVLDNGTIKEFD--SPEK 1491

Query: 557  LL 558
            LL
Sbjct: 1492 LL 1493

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ--LFF 435
           E+  ++G+ G+GK+ +I+ + G +   +    +   NV+   Q +A    GTV++  LF 
Sbjct: 654 ELTCIVGKVGSGKSAMIQSILGDLFRVKGFATIHG-NVAYVSQ-VAWIMNGTVKENILFG 711

Query: 436 KKIRGQFLSPQFQT-----DVVKPLKIDD-IIDQEVQHLSGGELQRVAIVLALGIPADIY 489
            K    F     +      D+   +  D  ++ ++   LSGG+  R+++  A+   AD Y
Sbjct: 712 HKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTY 771

Query: 490 LIDEPSAYLD 499
           L+D+P A +D
Sbjct: 772 LLDDPLAAVD 781

>YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-binding
            cassette (ABC) superfamily [4590 bp, 1529 aa]
          Length = 1529

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 81/197 (41%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        GR  D   +   I Y +  +L
Sbjct: 911  KPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDE-SFPRSIGYCQQQDL 969

Query: 153  QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
                  +    ++  ++       P ++              +E+ +  V+  IK L+++
Sbjct: 970  H-----LKTATVRESLRFSAYLRQPSSVS-------------IEEKNRYVEEVIKILEMQ 1011

Query: 213  HVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDL 267
               +  +G    G    + +R  IG+       + +F DEP+S LD +   +  Q++R L
Sbjct: 1012 QYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKL 1071

Query: 268  LTPTKYVIAVEHDLSVL 284
             T  + ++   H  S +
Sbjct: 1072 ATHGQAILCTIHQPSAI 1088

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 28/165 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQS---------DENSEK----VQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GVI           DE+  +     Q+ ++ +K  
Sbjct: 915  LTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDESFPRSIGYCQQQDLHLKTA 974

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKI----DDIIDQEVQHLSGGELQ 474
            T+  + +F   +RQ     I  +    ++  +V+K L++    D ++    + L+  + +
Sbjct: 975  TVRESLRFSAYLRQPSSVSIEEK---NRYVEEVIKILEMQQYSDAVVGVAGEGLNVEQRK 1031

Query: 475  RVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 1032 RLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLATHGQ 1076

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
           resistance protein of the ATP-binding cassette (ABC)
           family, has similarity to Snq2p, Pdr5p and Candida
           albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 11/83 (13%)

Query: 429 TVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADI 488
           T  + F+ KI G  L+  F T V      +D I      +SGGE +RV+I  AL     I
Sbjct: 152 TANREFYAKIFG--LTHTFDTKVG-----NDFISG----VSGGERKRVSIAEALAAKGSI 200

Query: 489 YLIDEPSAYLDSEQRIICSKVIR 511
           Y  D  +  LDS   +  ++ IR
Sbjct: 201 YCWDNATRGLDSSTALEFARAIR 223

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 88/197 (44%), Gaps = 37/197 (18%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF------DDPPEWQEIIKYFRGSELQNY 155
           PG +  L+G +G GK+T L  LA +   N+G        D  P      +  R   +Q  
Sbjct: 757 PGTLTALIGESGAGKTTLLNTLAQR---NVGTITGDMLVDGLPMDASFKR--RTGYVQQQ 811

Query: 156 FTKMLEDNIKAII-------KPQYVDNIPRAIKGP-VQKVGELLKLRMEKDSETVKGYIK 207
              + E  +K  +       +PQ   +IP A K   V+K+  +L+  M++ SE + G   
Sbjct: 812 DLHVAELTVKESLQFSARMRRPQ---SIPDAEKMEYVEKIISILE--MQEFSEALVG--- 863

Query: 208 TLQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRD 266
             ++ + LN E       + ++ +IG+  V   D+ +F DEP+S LD +      ++++ 
Sbjct: 864 --EIGYGLNVE-------QRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVVKMLKR 914

Query: 267 LLTPTKYVIAVEHDLSV 283
           L    + ++   H  S 
Sbjct: 915 LALAGQSILCTIHQPSA 931

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 73/165 (44%), Gaps = 35/165 (21%)

Query: 379 ILVMMGENGTGKTTLIKLLA----GVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQ-- 432
           +  ++GE+G GKTTL+  LA    G I  D   + +  ++ S K +T      G V+Q  
Sbjct: 760 LTALIGESGAGKTTLLNTLAQRNVGTITGDMLVDGL-PMDASFKRRT------GYVQQQD 812

Query: 433 -----LFFK---KIRGQFLSPQFQTDVVKPLKIDDIID----QEVQHLSGGEL------- 473
                L  K   +   +   PQ   D  K   ++ II     QE      GE+       
Sbjct: 813 LHVAELTVKESLQFSARMRRPQSIPDAEKMEYVEKIISILEMQEFSEALVGEIGYGLNVE 872

Query: 474 --QRVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 515
             ++++I + L G P  +  +DEP++ LDS+      K+++R  L
Sbjct: 873 QRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVVKMLKRLAL 917

>Scas_717.6*
          Length = 1400

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 362 QGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE 405
           +GD  L  +   F  S +  +MGE+G GKTTL+ +L+  + S E
Sbjct: 757 EGDKQLINDCSGFISSGLTALMGESGAGKTTLLNVLSQRVTSGE 800

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query: 191 LKLRMEKDSETVKGYIKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMF 245
           L+ R +   E + G+     L HV++  +G      +SGGE +R +I  + + +  VY++
Sbjct: 146 LEERNQMRDELLNGF----GLSHVVDTFVGNDYVRGVSGGERKRISIIETFIANGSVYLW 201

Query: 246 DEPSSYLDVKQRLNAAQIIRDLLTPTKYV 274
           D  +  LD    L    I++ +   T+ V
Sbjct: 202 DNSTKGLDSSTALEFLSILQTMARTTRSV 230

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 12/135 (8%)

Query: 193 LRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMF-DEPSSY 251
           LR + D + +    K L+L    N  +  L+  E +  +IG+  V    + +F DEP+S 
Sbjct: 847 LRGDGDRDYLGTVAKLLKLPA--NTLVADLTPTEKKLLSIGVELVTKPSLLLFLDEPTSG 904

Query: 252 LDVKQRLNAAQIIRDLLTPTKYVIAVEH--DLSVLDYLSDFVCIIYGVPSVYGVVTLPSS 309
           LD +  L   Q ++ L    + ++   H    SV+ Y  +   +  G   VY        
Sbjct: 905 LDAEAALTIVQFLKKLSLQGQAILCTIHQPSKSVIKYFDNIYLLKRGGECVYF-----GH 959

Query: 310 VREGINIFL--DGHI 322
           + +G + FL  D H+
Sbjct: 960 IDDGCDYFLTHDEHL 974

>CAGL0F01419g complement(142623..146819) highly similar to tr|Q08409
           Saccharomyces cerevisiae YOR011w AUS1, start by
           similarity
          Length = 1398

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 80/171 (46%), Gaps = 18/171 (10%)

Query: 363 GDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTI 422
           GD  L      +  S +  +MGE+G GKTTL+ +L+   Q  E+     ++ +  KP T 
Sbjct: 766 GDKRLINNVSGYIGSGLTALMGESGAGKTTLLNVLS---QRTESGVVSGEILIDGKPLTN 822

Query: 423 APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKID-DI-------------IDQEVQHL 468
              F  ++  +  + I  + L+ +   ++   L+ D D+             +D  V+ L
Sbjct: 823 ENAFRRSIGFVQQQDIHLELLTVKESLEISSELRGDGDMEYVESISELLKLPLDSLVREL 882

Query: 469 SGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
           +  + + ++I + L   P+ +  +DEP++ LD+E  +   + +++  L  +
Sbjct: 883 NPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 933

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 206 IKTLQLEHVLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNA 260
           ++   L HV +  +G      +SGGE +R +I  + + +  VY++D  +  LD    L+ 
Sbjct: 160 LREFGLSHVGDTIVGNDYFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDF 219

Query: 261 AQIIRDLLTPTKYV 274
             I++ +   T+ V
Sbjct: 220 LTILQKMARTTRSV 233

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 86/198 (43%), Gaps = 20/198 (10%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKA 166
            L+G +G GK+T L +L+ + +  +          EI+   +    +N F + +      
Sbjct: 784 ALMGESGAGKTTLLNVLSQRTESGVVS-------GEILIDGKPLTNENAFRRSI-----G 831

Query: 167 IIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGE 226
            ++ Q +      +K  ++   E   LR + D E V+   + L+L   L+  + +L+  +
Sbjct: 832 FVQQQDIHLELLTVKESLEISSE---LRGDGDMEYVESISELLKLP--LDSLVRELNPTQ 886

Query: 227 LQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEH--DLSV 283
            +  +IG+  V    + +F DEP+S LD +  L   Q ++ L    + +    H    SV
Sbjct: 887 RKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQAIFCTIHQPSKSV 946

Query: 284 LDYLSDFVCIIYGVPSVY 301
           + Y  +   +  G   VY
Sbjct: 947 ISYFDNIYLLKRGGECVY 964

>Scas_612.11*
          Length = 1506

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 45/197 (22%)

Query: 345  TKGE---ANKTFEY-PAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGV 400
            TKGE    N  F Y P +     + SL ++SG     E + + G  G GK+T++  L  +
Sbjct: 1241 TKGEIHFENVDFSYRPGLPTVLKNLSLDIKSG-----EKIGICGRTGAGKSTIMSALYRL 1295

Query: 401  IQSDENSEKVQKLNVSM-------KPQTIAPK----FPGTVRQ------------LFFKK 437
             +       +  +++S        +   I P+    F GT+R+            L+   
Sbjct: 1296 NEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNAL 1355

Query: 438  IRGQFLSPQFQTDV--VKP-----------LKIDDIIDQEVQHLSGGELQRVAIVLALGI 484
            +RG  +  +   ++   KP             +D ++++E  + S GE Q +A+  AL  
Sbjct: 1356 VRGGAIEQKELNEIKAQKPDEKGNHSEMYKFHLDQLVEEEGANFSLGERQLLALTRALVR 1415

Query: 485  PADIYLIDEPSAYLDSE 501
             A I ++DE ++ +D E
Sbjct: 1416 QARILILDEATSSVDYE 1432

>YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-binding
           cassette (ABC) superfamily [4695 bp, 1564 aa]
          Length = 1564

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKY--FRGSELQNYFTKM 159
           PG++L ++G  G G +T LK ++     N   F   P+   II Y  F   E++N++   
Sbjct: 205 PGELLVVLGRPGAGCTTLLKSIS----VNTHGFKISPD--TIITYNGFSNKEIKNHYRGE 258

Query: 160 LEDNIKAIIKP------QYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEH 213
           +  N ++ I        Q +  + R +K P  ++  + +    K    V   + T  L H
Sbjct: 259 VVYNAESDIHIPHLTVFQTLYTVAR-LKTPRNRIKGVDRDTFAKHMTEVA--MATYGLSH 315

Query: 214 VLNREIGK-----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLL 268
             + ++G      +SGGE +R +I    +  +    +D  +  LD    L   + ++   
Sbjct: 316 TADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQA 375

Query: 269 TPTKYVIAVE-HDLSVLDY-LSDFVCIIY 295
           T TK    V  +  S   Y L D VC++Y
Sbjct: 376 TITKSAATVAIYQCSKDAYDLFDKVCVLY 404

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 87/195 (44%), Gaps = 28/195 (14%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    L        GR  D   +   I Y +  +L
Sbjct: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGDVFVDGRPRD-QSFPRSIGYCQQQDL 1008

Query: 153  QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGP-VQKVGELLKLRMEKDSET-VKGYIKTLQ 210
             +  T  + ++++     +  D++    K   V++V E+L++++  D+   V G      
Sbjct: 1009 -HLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADAIVGVPG------ 1061

Query: 211  LEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLT 269
                LN E       + +R  IG+       + +F DEP+S LD +   +  Q+++ L +
Sbjct: 1062 --EGLNVE-------QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLAS 1112

Query: 270  PTKYVIAVEHDLSVL 284
              + ++   H  S L
Sbjct: 1113 RGQAILCTIHQPSAL 1127

>CAGL0G05093g complement(483230..484864) similar to sp|Q12298
           Saccharomyces cerevisiae YDR061w, hypothetical start
          Length = 544

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 39/72 (54%)

Query: 451 VVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVI 510
           +V+ LK++++ ++    LS G+++R  +  +L    D+ L+D+P   LD     I SK +
Sbjct: 142 LVRELKLEELQNRWAMGLSNGQMRRARLARSLLKQPDLILVDDPFLGLDPTATAIISKFL 201

Query: 511 RRFILHNKKTAF 522
             +    K+ ++
Sbjct: 202 SNWGGAGKENSY 213

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   ++ I + 
Sbjct: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164

>YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane
           transporter of the ATP-binding cassette (ABC)
           superfamily, plays a role in sterol uptake and anaerobic
           growth [4236 bp, 1411 aa]
          Length = 1411

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 80/173 (46%), Gaps = 18/173 (10%)

Query: 355 YPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLN 414
           +  +  T GD  L  ++  +  S +  +MGE+G GKTTL+ +L+   Q  E+     +L 
Sbjct: 753 WKNINYTIGDKKLINDASGYISSGLTALMGESGAGKTTLLNVLS---QRTESGVVTGELL 809

Query: 415 VSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIID------------ 462
           +  +P T    F  ++  +  + +  + L+ +   ++   L+ D   D            
Sbjct: 810 IDGQPLTNIDAFRRSIGFVQQQDVHLELLTVRESLEISCVLRGDGDRDYLGVVSNLLRLP 869

Query: 463 --QEVQHLSGGELQRVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRR 512
             + V  LS  + + ++I + L   P+ +  +DEP++ LD+E  +   + +++
Sbjct: 870 SEKLVADLSPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKK 922

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 194 RMEKDSETVKGY-IKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYL 252
           R+E   E +K + +  ++  +V N  +  +SGGE +R +I  + + +  VY++D  +  L
Sbjct: 143 RIEMRDELLKEFGLSHVKKTYVGNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGL 202

Query: 253 DVKQRLNAAQIIRDLLTPTKYV 274
           D    L    I + +   T+ V
Sbjct: 203 DSATALEFLSITQKMAKATRSV 224

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 219 IGKLSGGELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAV 277
           +  LS  + +  +IG+  V    + +F DEP+S LD +  L   Q ++ L    + ++  
Sbjct: 874 VADLSPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSMQGQAILCT 933

Query: 278 EH--DLSVLDYLSDFVCIIYGVPSVY 301
            H    SV+ Y  +   +  G   VY
Sbjct: 934 IHQPSKSVISYFDNIYLLKRGGECVY 959

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
           cerevisiae YLL048c YBT1 yeast bile transporter,
           hypothetical start
          Length = 1648

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 89/203 (43%), Gaps = 31/203 (15%)

Query: 373 DFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAP------KF 426
           +F   ++ V++G  G+GKT+++  L G +Q  E    V  L+   + Q+ A        +
Sbjct: 730 EFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAGVINDSIAY 789

Query: 427 PGTVRQLFFKKIRGQFL--SP--QFQTDVV----------KPLKIDDI--IDQEVQHLSG 470
                 L    +R   L  +P  Q + D V          + LK  D   I ++   LSG
Sbjct: 790 CSQAAWLLNDTVRNNILFNAPFDQARYDAVVEACSLKRDFQILKAGDSTEIGEKGITLSG 849

Query: 471 GELQRVAIVLALGIPADIYLIDEPSAYLDSEQRI-ICSKVIRRFILHNKKTAFVVEHDFI 529
           G+ QRV++  AL   A   L+D+  + +DS   + I  K I   ++   +T  +V H+  
Sbjct: 850 GQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEG-RTCILVTHNIA 908

Query: 530 MATYLADKVIVFE-------GTP 545
           +    AD V++ E       GTP
Sbjct: 909 LTMKNADFVVMIEDGKVKEKGTP 931

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 89/212 (41%), Gaps = 40/212 (18%)

Query: 382  MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVS-------MKPQTIAPK----FPGTV 430
            ++G  G GK+T+I  L   +++D  S K+  +N++        +  TI P+    F G++
Sbjct: 1404 IVGRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSI 1463

Query: 431  R------------QLFFKKIRGQFLS--------PQFQT----DVVKPLKIDDIIDQEVQ 466
            R            ++F    R   +S         + Q+    +V K L ++  I +   
Sbjct: 1464 RSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNLESEIAEGGS 1523

Query: 467  HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH 526
            + S G+ Q + +  +L     + L+DE +A +D        + IR+    N  T   + H
Sbjct: 1524 NFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVLTIAH 1581

Query: 527  DFIMATYLADKVIVFEGTPSKHANARAPESLL 558
              + +    DK++V +    K  +   P SLL
Sbjct: 1582 R-LRSIVDYDKILVMDAGEVKEFD--HPYSLL 1610

>Scas_455.1
          Length = 925

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 364 DFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLN------VSM 417
           DF L   + DF   ++ V++G  G+GKT+L+  L G ++  E    V  L+      V  
Sbjct: 727 DFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIVPSLDPREDLVVDE 786

Query: 418 KPQTIAPKFPGTVRQLFFKKIRGQFL--SPQFQ---TDVVKP---------LKIDDI--I 461
              T +  +      L    +R   L  SP  +   T V++          LK  D+  I
Sbjct: 787 NGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEARYTSVIEACGLKRDFEILKAGDMTEI 846

Query: 462 DQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 521
            ++   LSGG+ QRV++  A+   +   L+D+  + +DS   +          L + +T 
Sbjct: 847 GEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNCITGPLMDGRTC 906

Query: 522 FVVEHDFIMATYLADKVIV 540
            +V H+  +    AD V++
Sbjct: 907 ILVSHNIALTLKNADLVVI 925

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-binding
            cassette transporter, identified start
          Length = 1542

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 80/197 (40%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        GR  D   +   I Y +  +L
Sbjct: 912  KPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDT-SFSRSIGYCQQQDL 970

Query: 153  QNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLE 212
                  +    ++  ++       P ++              +E+ +E V+  IK L++E
Sbjct: 971  H-----LKTATVRESLRFSAYLRQPSSVS-------------IEEKNEYVEAVIKILEME 1012

Query: 213  HVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDL 267
               +  +G    G    + +R  IG+       + +F DEP+S LD +      Q+++ L
Sbjct: 1013 TYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKL 1072

Query: 268  LTPTKYVIAVEHDLSVL 284
                + ++   H  S +
Sbjct: 1073 ANHGQAILCTIHQPSAM 1089

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 28/165 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GVI  D              +    Q+ ++ +K  
Sbjct: 916  LTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDTSFSRSIGYCQQQDLHLKTA 975

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 474
            T+  + +F   +RQ     I  +    ++   V+K L+++   D  V    + L+  + +
Sbjct: 976  TVRESLRFSAYLRQPSSVSIEEK---NEYVEAVIKILEMETYADAVVGVPGEGLNVEQRK 1032

Query: 475  RVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1033 RLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKLANHGQ 1077

>KLLA0E19074g complement(1691643..1692623) highly similar to
           sp|P52920 Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 326

 Score = 33.5 bits (75), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 343 EDTKGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQ 402
           +  +G ANK       K    D  L  E+      +IL++ G+ G GK+T   +L+  + 
Sbjct: 37  DSCQGCANKEVCESLPKGPDPDLPLIKENLANIKHKILILSGKGGVGKSTFTTMLSWALS 96

Query: 403 SDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKI 457
           +DE+ + V  +++ +   ++ P   G VR+   +   G   +P + TD +  + I
Sbjct: 97  ADEDLQ-VGAMDLDICGPSL-PHMLGCVRETIHESNTG--WTPVYVTDNLATMSI 147

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters, represents a half-sized ABC protein [2322
           bp, 773 aa]
          Length = 773

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLL-TPTKYVIAVEHD 280
           LSGG+ QR AI  + ++   + + DE +S LDV+           L+ + +  ++++ H 
Sbjct: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645

Query: 281 LSVL 284
           LS +
Sbjct: 646 LSTI 649

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 72/325 (22%), Positives = 123/325 (37%), Gaps = 79/325 (24%)

Query: 224 GGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDL--LTPTKY--VIAVEH 279
           G EL R+ + +      D++   + +++ + K       ++ DL  LT   Y   + ++ 
Sbjct: 327 GNELSRYNVAIR-----DIFQVGKTAAFTNAK-FFTTTSLLGDLSFLTVLAYGSYLVLQS 380

Query: 280 DLSVLDYLSDFVCIIYGVPSVYGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLH 339
            LS+ D  +  +   Y   +V+G+ T  S + +G                 + +  F L 
Sbjct: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAG---------------AASRLFELT 425

Query: 340 D---ATEDTKGEANK-----------TFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGE 385
           D   +   T G   K           +F YP     Q   +L  +    S    + ++G 
Sbjct: 426 DRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSS---VCIVGP 482

Query: 386 NGTGKTTLIKLL-------AGVIQSDENSEKVQKLN----------VSMKPQTIAPKFPG 428
           +G GK+T+  LL        G I  D  ++ + KLN          V  +P  ++    G
Sbjct: 483 SGRGKSTIALLLLRYYNPTTGTITID--NQDISKLNCKSLRRHIGIVQQEPVLMS----G 536

Query: 429 TVRQLF------------FKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRV 476
           T+R                + +  Q     F T    P   D +I      LSGG+ QR+
Sbjct: 537 TIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKF--PNTYDTVIGPHGTLLSGGQKQRI 594

Query: 477 AIVLALGIPADIYLIDEPSAYLDSE 501
           AI  AL     I ++DE ++ LD E
Sbjct: 595 AIARALIKKPTILILDEATSALDVE 619

>Scas_716.82
          Length = 675

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 70/160 (43%), Gaps = 35/160 (21%)

Query: 381 VMMGENGTGKTTLIKLLA----GVIQSD-------------ENSEKVQKLNVSMKPQTIA 423
            +MGE+G GKTTL+  LA    G+I  D               +  VQ+ +V +   T+ 
Sbjct: 61  AVMGESGAGKTTLLNTLAQRNVGIITGDMLINGRPIDASFERRTGYVQQQDVHIAELTVR 120

Query: 424 PKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIID-QEVQHLSGGELQRVAIV--- 479
                + R       R Q +  + +   V+  KI  ++D QE      GE+ R   V   
Sbjct: 121 ESLQFSARMR-----RAQAIPDEEKMAYVE--KIIHVLDMQEYAEALVGEIGRGLNVEQR 173

Query: 480 --LALGI-----PADIYLIDEPSAYLDSEQRIICSKVIRR 512
             L++G+     P  +  +DEP++ LDS+      +++R+
Sbjct: 174 KKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRK 213

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 76/186 (40%), Gaps = 23/186 (12%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
           PG +  ++G +G GK+T L  LA +   N+G                G  +   F +   
Sbjct: 56  PGTMTAVMGESGAGKTTLLNTLAQR---NVGIITGD-------MLINGRPIDASFERR-- 103

Query: 162 DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSET---VKGYIKTLQLEHVLNRE 218
                 ++ Q V      ++  +Q    + + +   D E    V+  I  L ++      
Sbjct: 104 ---TGYVQQQDVHIAELTVRESLQFSARMRRAQAIPDEEKMAYVEKIIHVLDMQEYAEAL 160

Query: 219 IGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNAAQIIRDLLTPTKY 273
           +G++  G    + ++ +IG+  V   D+ +F DEP+S LD +      Q++R L    + 
Sbjct: 161 VGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAQAGQS 220

Query: 274 VIAVEH 279
           ++   H
Sbjct: 221 ILCTIH 226

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
            factor, member of the ATP-binding cassette (ABC)
            superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 30/172 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKIL-------AGK------QKPNLGRFDDPPEWQEIIK-- 145
            + G+ +G+ G  G GKST +  L       AGK          LG FD   +   I +  
Sbjct: 1238 KSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDP 1297

Query: 146  -YFRGSELQNY--FTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEK-DSET 201
              FRG+  +N   F +  +D +   +           ++G      +L +++++K D   
Sbjct: 1298 VLFRGTIRKNLDPFNERTDDELWDAL-----------VRGGAIAKDDLPEVKLQKPDENG 1346

Query: 202  VKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
              G +    L+  +  E    S GE Q  A+  + V+ + + + DE +S +D
Sbjct: 1347 THGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVD 1398

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 10/83 (12%)

Query: 218 EIGK----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLT---P 270
           EIG+    LSGG+  R  +  S  +  D+Y+FD+  S +D +       I+ + LT    
Sbjct: 702 EIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRV---GKHIMDECLTGMLA 758

Query: 271 TKYVIAVEHDLSVLDYLSDFVCI 293
            K  I   H LS+++  S  + +
Sbjct: 759 NKTRILATHQLSLIERASRVIVL 781

>Scas_627.18
          Length = 533

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 34/68 (50%)

Query: 446 QFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRII 505
           +    ++K LK+ ++ D+    LS G+++R  +   L    D+ L+D+P   LD     I
Sbjct: 135 ELYNKLIKSLKLVELQDRYAMGLSNGQMRRARLTHTLLKEPDLLLVDDPFLGLDPTATSI 194

Query: 506 CSKVIRRF 513
            SK +  +
Sbjct: 195 ISKFLATY 202

>Scas_707.8
          Length = 294

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 96  RLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           +L  P   + L +VG NG GKST LK+LAGK 
Sbjct: 27  KLQVPWHTRTL-VVGANGAGKSTLLKLLAGKH 57

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 60/142 (42%), Gaps = 23/142 (16%)

Query: 381 VMMGENGTGKTTLIKLLAG----------------------VIQSDENSEKVQKLNVSMK 418
           +++G NG GK+TL+KLLAG                         +D+ + + +   V+  
Sbjct: 37  LVVGANGAGKSTLLKLLAGKHLCLNGKILVNGLDPFSPLSMYQDNDKTTAEDKDWQVTTY 96

Query: 419 PQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDI-IDQEVQHLSGGELQRVA 477
             T         R +   ++        ++    K ++I DI I+  +  LS G+ +RV 
Sbjct: 97  LGTEWCHMSIINRDIGVLELLESIGLAHYRDRGNKLIEILDININWRMHRLSDGQKRRVQ 156

Query: 478 IVLALGIPADIYLIDEPSAYLD 499
           + + L  P  + L+DE +  LD
Sbjct: 157 LAMGLLKPWRVLLLDEVTVDLD 178

>YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative
           nucleotide-binding protein, has similarity to bacterial
           partitioning ATPases [987 bp, 328 aa]
          Length = 328

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 347 GEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN 406
           G ANK       K    D  L  ++    + +ILV+ G+ G GK+T   +L+  + +DE+
Sbjct: 43  GCANKEICESLPKGPDPDIPLITDNLSGIEHKILVLSGKGGVGKSTFAAMLSWALSADED 102

Query: 407 SEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKI 457
            + V  +++ +   ++ P   G +++   +   G   +P + TD +  + I
Sbjct: 103 LQ-VGAMDLDICGPSL-PHMLGCIKETVHESNSG--WTPVYVTDNLATMSI 149

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter
           of the ATP-binding cassette (ABC) superfamily, mediates
           transport of glutathione conjugates into the vacuole
           [4680 bp, 1559 aa]
          Length = 1559

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 79/169 (46%), Gaps = 19/169 (11%)

Query: 378 EILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIA------PKFPGTVR 431
           +++ ++G  G GK+T +K + G +     S       + ++  ++A           +VR
Sbjct: 666 DLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVR 725

Query: 432 Q--LFFKKIRGQFLSPQFQTDVVKP-LKI-----DDIIDQEVQHLSGGELQRVAIVLALG 483
           +  LF  K    +     +   + P LKI     + ++ ++   LSGG+  R+++  A+ 
Sbjct: 726 ENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVY 785

Query: 484 IPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMAT 532
             ADIYL+D+  + +D+E     SK I  ++L   KTA +     I+ T
Sbjct: 786 SRADIYLLDDILSAVDAE----VSKNIIEYVLIG-KTALLKNKTIILTT 829

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 457  IDDIIDQEVQ----HLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRR 512
            ++DI+D ++     +LS G+ Q + +  AL   + I ++DE +A +D E   I    IRR
Sbjct: 1441 VNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRR 1500

Query: 513  FILHNKKTAFVVEHDFIMATYLADKVIVFE 542
                  +T   + H  I     +DK+IV +
Sbjct: 1501 --EFKDRTILTIAHR-IDTVLDSDKIIVLD 1527

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQII---RDLLTPTKYVIAVE 278
           LSGG+  R ++  +    AD+Y+ D+  S +D +   N  + +   +  L   K +I   
Sbjct: 770 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTT 829

Query: 279 HDLSVLDY 286
           + +S+L +
Sbjct: 830 NTVSILKH 837

>Scas_622.9
          Length = 1657

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 86/197 (43%), Gaps = 19/197 (9%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFDDPPEWQEIIKYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  +     P  G  + DD       I     ++L+   T +
Sbjct: 1412 PKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVN-----IASINLTKLRRSITII 1466

Query: 160  LED------NIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKD---SETVKGYIKTLQ 210
             +D       IK  + P Y +    AI   +++V  + +  ++ +   + T +   K L 
Sbjct: 1467 PQDPTLFTGTIKLNLDP-YNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLN 1525

Query: 211  LEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTP 270
            LE+ +      LS G+ Q   +  S +++  + + DE ++ +D        + IR   + 
Sbjct: 1526 LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQ 1585

Query: 271  TKYVIAVEHDL-SVLDY 286
            +  ++ + H L SV+DY
Sbjct: 1586 ST-ILTIAHRLRSVIDY 1601

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 88/211 (41%), Gaps = 29/211 (13%)

Query: 364 DFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLN------VSM 417
           DF L   + +F    + V++G  G+GKT+L+  L G +  ++    V  LN      +  
Sbjct: 726 DFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPALNPRQDLVIDK 785

Query: 418 KPQTIAPKFPGTVRQLFFKKIRGQFL--SPQFQTDV------------VKPLKIDDI--I 461
              T +  +      L  + +R   L  SP  +               +K LK  D+  I
Sbjct: 786 FGLTNSIAYCSQAAWLLNETVRNNILFNSPYNEERYNAVIDACGLRRDLKILKASDMTEI 845

Query: 462 DQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 521
            ++   LSGG+ QRV++  AL   +   L+D+  + +DS   +          L + +T 
Sbjct: 846 GEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLMSGRTC 905

Query: 522 FVVEHDFIMATYLADKVIVFE-------GTP 545
            +V H+  +    A+ V++ E       GTP
Sbjct: 906 ILVSHNIALTLKNAELVVILENGRVKDQGTP 936

>Scas_586.3
          Length = 1531

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 74/159 (46%), Gaps = 28/159 (17%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     G I  D              +    Q+ ++ +K  
Sbjct: 898  LTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSIGYCQQQDLHLKTS 957

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 474
            T+  + +F   +RQ F   +  +    ++  +++K L+++   D  V    + L+  + +
Sbjct: 958  TVRESLRFSAYLRQPFDVPVEEK---NKYVEEIIKTLEMETYADAVVGVPGEGLNVEQRK 1014

Query: 475  RVAIVLALGI-PADIYLIDEPSAYLDSEQRIICSKVIRR 512
            R+ I + L   P  +  +DEP++ LDS+      +++++
Sbjct: 1015 RLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKK 1053

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 82/207 (39%), Gaps = 52/207 (25%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  Q+  +G                G    N     L
Sbjct: 894  KPGTLTALMGASGAGKTTLLDCLA--QRVTVGTIT-------------GDVFVN---GCL 935

Query: 161  EDNIKAIIKPQYVDNIPRAIKGPVQK--------VGELLKLR----------MEKDSETV 202
             D           ++ PR+I    Q+        V E L+            +E+ ++ V
Sbjct: 936  RD-----------ESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPFDVPVEEKNKYV 984

Query: 203  KGYIKTLQLEHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQR 257
            +  IKTL++E   +  +G    G    + +R  IG+       + +F DEP+S LD +  
Sbjct: 985  EEIIKTLEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA 1044

Query: 258  LNAAQIIRDLLTPTKYVIAVEHDLSVL 284
                Q+++ L    + ++   H  S +
Sbjct: 1045 WATCQLMKKLAQNGQAILCTIHQPSAI 1071

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 76/165 (46%), Gaps = 28/165 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GVIQSD-------------ENSEKVQKLNVSMKPQ 420
            +  +MG +G GKTTL+  LA     GVI  D              +    Q+ ++ +K  
Sbjct: 900  LTALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIPRDKSFPRSIGYCQQQDLHLKTA 959

Query: 421  TI--APKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEV----QHLSGGELQ 474
            T+  + +F   +RQ     I  +    ++  +V+K L+++   D  V    + L+  + +
Sbjct: 960  TVRESLRFSAYLRQPAEVSIEEK---NRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRK 1016

Query: 475  RVAIVLAL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 518
            R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1017 RLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1061

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 47/98 (47%), Gaps = 5/98 (5%)

Query: 192  KLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-D 246
            ++ +E+ +  V+  IK L++E   +  +G    G    + +R  IG+       + +F D
Sbjct: 976  EVSIEEKNRYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLD 1035

Query: 247  EPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVL 284
            EP+S LD +   +  Q+++ L    + ++   H  S +
Sbjct: 1036 EPTSGLDSQTAWSICQLMKKLANHGQAILCTIHQPSAI 1073

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 20/131 (15%)

Query: 382 MMGENGTGKTTLIKLLAGVIQSDENSEKVQK--LNVSMKPQTIAPKFPGTVRQLFFKKIR 439
           ++G+ G+GKT L+  + G +   +    V      VS  P  +     GTV++     + 
Sbjct: 661 IVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIM----NGTVKE---NILF 713

Query: 440 GQFLSPQFQTDVVKP--LKID---------DIIDQEVQHLSGGELQRVAIVLALGIPADI 488
           G     +F    +K   L ID          ++ ++   LSGG+  R+++  A+   AD 
Sbjct: 714 GHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADT 773

Query: 489 YLIDEPSAYLD 499
           YL+D+P A +D
Sbjct: 774 YLLDDPLAAVD 784

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 89/201 (44%), Gaps = 31/201 (15%)

Query: 382  MMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNV------------SMKPQTIAPKFPGT 429
            ++G  G GK++L   L  +I++ E +  +  + +            S+ PQ  +  F GT
Sbjct: 1304 IVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQD-SQVFEGT 1362

Query: 430  VRQ------LFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQ---HLSGGELQRVAIVL 480
            VR+       +  +   + L      + V  +  D +  Q  +   +LS G+ Q + +  
Sbjct: 1363 VRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLAR 1422

Query: 481  ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEH--DFIMATYLADKV 538
            A+ +P+ I ++DE +A +D E   +  + IR       +T   + H  + IM +   D++
Sbjct: 1423 AMLVPSKILVLDEATAAVDVETDKVVQETIRT--AFKDRTILTIAHRLNTIMDS---DRI 1477

Query: 539  IVFEGTPSKHANARAPESLLT 559
            IV +    K A   +P  LL+
Sbjct: 1478 IVLDN--GKVAEFDSPGQLLS 1496

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 46/91 (50%), Gaps = 10/91 (10%)

Query: 172 YVDNIPRAIKGPVQKVGELLKLRMEKD--SETVKGYIKTLQLEHVLNRE---IGK----L 222
           YV  +P  + G V++   L   R + +   +T+K    T+ L  +++ +   +G+    L
Sbjct: 695 YVSQVPWIMNGTVKE-NILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISL 753

Query: 223 SGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
           SGG+  R ++  +    AD Y+ D+P + +D
Sbjct: 754 SGGQKARLSLARAVYARADTYLLDDPLAAVD 784

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKY-VIAVEHD 280
           LSGG+ QR AI  + ++   + + DE +S LDV+           L+   +  ++++ H 
Sbjct: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668

Query: 281 LSVL 284
           LS +
Sbjct: 669 LSTI 672

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 458 DDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSE 501
           D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E
Sbjct: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642

>Kwal_34.15956
          Length = 714

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 143 IIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETV 202
           I K F GS+++N   + ++  ++ ++   +   +P   + P    G LL L      E +
Sbjct: 472 IFKIFGGSQIENLALQNIQARLRMVLAYLFAQLLPWVRRIP--NAGSLLVLGSANVDECL 529

Query: 203 KGYIKTLQLEHVLNREIGKLSGGELQRF 230
           +GY+            IG +S  +L+RF
Sbjct: 530 RGYLTKYDCSSADINPIGGISKTDLKRF 557

>ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - SH]
           (224562..229445) [4884 bp, 1627 aa]
          Length = 1627

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 4/110 (3%)

Query: 461 IDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520
           I ++   LSGG+ QR+++  AL   A   L+D+  + +DS   ++  +      L   +T
Sbjct: 806 IGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGRT 865

Query: 521 AFVVEHDFIMATYLADKVIVFEGTPSKHAN---ARAPESLLTGCNRFLKN 567
             +V H+  +    AD V++ E    K      A A E LL G ++ +K+
Sbjct: 866 CVLVSHNVALTMRNADWVVILENGRVKAQGEPLALANEGLL-GEDKLIKS 914

>Sklu_2062.2 YGL091C, Contig c2062 3197-4183
          Length = 328

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 63/133 (47%), Gaps = 4/133 (3%)

Query: 347 GEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN 406
           G ANK       K    D  L  E+      ++LV+ G+ G GK+T   +L+  + +DE+
Sbjct: 43  GCANKDICESLPKGPDPDIPLITENLSQIKHKVLVLSGKGGVGKSTFTTMLSWALSADED 102

Query: 407 SEKVQKLNVSMKPQTIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQ 466
            + V  +++ +   ++ P+  G V++   +   G   +P +  D +  + I  ++ ++  
Sbjct: 103 LQ-VGAMDLDICGPSL-PRMLGCVKETVHESNTG--WTPVYVADNLATMSIQFMLPEDDS 158

Query: 467 HLSGGELQRVAIV 479
            +    L++ A++
Sbjct: 159 AIIWRGLKKNALI 171

>Scas_552.4
          Length = 720

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 82/199 (41%), Gaps = 17/199 (8%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFDDPPEWQEIIKYFRGSELQNYF 156
           T  P   +G+VG  G GKST +  L     P  G  + D+       I     ++L+   
Sbjct: 474 TVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNID-----ITSINLNKLRRSI 528

Query: 157 TKMLED------NIKAIIKP--QYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKT 208
             + +D       IK+ + P  +Y D         V  V E +   +E +S + +   K 
Sbjct: 529 NIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKF 588

Query: 209 LQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLL 268
           L L + ++     LS G+ Q   +  S ++   + + DE ++ +D        + IR   
Sbjct: 589 LNLNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEF 648

Query: 269 TPTKYVIAVEHDL-SVLDY 286
             +  ++ + H L SV+DY
Sbjct: 649 NSST-ILTIAHRLRSVIDY 666

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 85/220 (38%), Gaps = 38/220 (17%)

Query: 382 MMGENGTGKTTLIKLL-------AGVIQSDENSEKVQKLNVSMKPQTIAPK----FPGTV 430
           ++G  G GK+T+I  L        G I+ D        LN   +   I P+    F GT+
Sbjct: 483 IVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTI 542

Query: 431 R-----------QLFFKKIRGQFLSPQ-----------FQTDVVKPLKIDDIIDQEVQHL 468
           +           +  F  +R   L P+              +V K L +++ I +   +L
Sbjct: 543 KSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLNLNNEISEGGSNL 602

Query: 469 SGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDF 528
           S G+ Q V +  +L     I L+DE +A +D        + IR+    N  T   + H  
Sbjct: 603 SQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHR- 659

Query: 529 IMATYLADKVIVFEGTPSKHANARAPESLLTGCNRFLKNL 568
           + +    DK++V +    K  +   P SLL        N+
Sbjct: 660 LRSVIDYDKILVMDAGEVKEYD--HPYSLLLNKKSIFYNM 697

>CAGL0D00946g complement(114552..115802) similar to tr|Q0670
           Saccharomyces cerevisiae YLR380w CSR1, hypothetical
           start
          Length = 416

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 48/115 (41%), Gaps = 5/115 (4%)

Query: 328 RFRSEALQFRLHDATEDTKGEANKTFE-YPAMKRTQGDFS----LTVESGDFSDSEILVM 382
           R RS +  F++H + E+ +GE    FE + A+K +  D +      +   DF DS +L  
Sbjct: 65  RPRSRSTIFKIHSSVEENEGEGISDFELHEALKNSNPDDTREEFWNMIRADFPDSLLLRF 124

Query: 383 MGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQTIAPKFPGTVRQLFFKK 437
           +          + +++  +    N  KV K+    +        PG  + L  +K
Sbjct: 125 IRARKWDLNKSMTMISNTLDWRVNDSKVDKIIYEGERAAYDGTMPGFYKNLELQK 179

>YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear
           protein that may act as a chaperone [14733 bp, 4910 aa]
          Length = 4910

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 32/45 (71%), Gaps = 5/45 (11%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQT 421
           +E ++++GE GTGKTT+++ LA ++     ++K+  +NVS + +T
Sbjct: 646 TEPVLLVGETGTGKTTVVQQLAKML-----AKKLTVINVSQQTET 685

>AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH]
            complement(61232..65434) [4203 bp, 1400 aa]
          Length = 1400

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 384  GENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSM-------KPQTIAPK----FPGTVRQ 432
            G  G GKT++   L  + + +  S K+  ++++           +I P+    F GTVR+
Sbjct: 1179 GRTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRK 1238

Query: 433  L---FFKKIRGQFLSPQFQTDVV--------KPLKIDDIIDQEVQHLSGGELQRVAIVLA 481
                F +   G   S   ++ VV            +D  +D+   + S GE Q +A+  A
Sbjct: 1239 NLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARA 1298

Query: 482  LGIPADIYLIDEPSAYLD 499
            L     I ++DE ++ +D
Sbjct: 1299 LVRSTRILILDEATSSVD 1316

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 4/40 (10%)

Query: 218 EIGK----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLD 253
           E+G+    LSGG+  R ++  +  +D D+Y+FD+  S +D
Sbjct: 649 EVGERGITLSGGQKARISLARAIYKDRDIYLFDDIISAVD 688

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 2/81 (2%)

Query: 207  KTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRD 266
            K L LE+ +      LS G+ Q   +  + +++  V + DE ++ +D        Q IR+
Sbjct: 1524 KFLNLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRN 1583

Query: 267  LLTPTKYVIAVEHDL-SVLDY 286
            +   +  V+ + H L SV+DY
Sbjct: 1584 VFDKST-VLTIAHRLRSVIDY 1603

>Kwal_14.1242
          Length = 269

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           ++G+NG GKST LK+L+GK 
Sbjct: 37  IIGSNGAGKSTLLKLLSGKH 56

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG+NG GKST LK+L+GK 
Sbjct: 37  VVGSNGAGKSTLLKLLSGKH 56

>AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH]
           (710017..710829) [813 bp, 270 aa]
          Length = 270

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           L G+NG GKST LK+L+GK 
Sbjct: 39  LCGSNGAGKSTLLKLLSGKH 58

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%)

Query: 380 LVMMGENGTGKTTLIKLLAG 399
           +++ G NG GK+TL+KLL+G
Sbjct: 37  MLLCGSNGAGKSTLLKLLSG 56

>YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein that
           associates with Ccr4p, member of the non-transporter
           group of the ATP-binding cassette (ABC) superfamily [870
           bp, 289 aa]
          Length = 289

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 39  VVGANGAGKSTLLKLLSGKH 58

>Scas_167.1*
          Length = 279

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 68/160 (42%), Gaps = 23/160 (14%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
           PG +  L+G +G GK+T L  LA +   N+G                G  +   F +   
Sbjct: 125 PGTLTALMGESGAGKTTLLNTLAQR---NVGIITGD-------MLINGHPIDASFERR-- 172

Query: 162 DNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSET---VKGYIKTLQLEHVLNRE 218
                 ++ Q +      ++  +Q    + + +   D E    V+  I+ L +E+     
Sbjct: 173 ---TGYVQQQDIHIAELTVRESLQFSARMRRAQAIPDEEKMAYVEKIIQVLDMEYYAEAL 229

Query: 219 IGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLD 253
           +G++  G    + ++ +IG+  V   D+ +F DEP+S LD
Sbjct: 230 VGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLD 269

>Kwal_34.15770
          Length = 1436

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 91/229 (39%), Gaps = 47/229 (20%)

Query: 347 GEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAG------- 399
           G  N TF +    R   DF L   S +F   ++ V++G  G+GKT+L+  L G       
Sbjct: 476 GFENATFSW---DRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEG 532

Query: 400 -------------VIQSDEN-------SEKVQKLNVSMKPQTI------APKFPGTVRQL 433
                        ++++D         S+    LN ++K   +        ++   V   
Sbjct: 533 KVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEARYDAVVEAC 592

Query: 434 FFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDE 493
             K+   + LS   QT+          I ++   LSGG+ QRV++  AL   +   L+D+
Sbjct: 593 GLKR-DFEILSAGDQTE----------IGEKGITLSGGQKQRVSLARALYSSSRHLLLDD 641

Query: 494 PSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIVFE 542
             + +DS   +   +      L   +T  +V H+  +    AD V+  E
Sbjct: 642 CLSAVDSHTALWIYENCITGPLMEGRTCILVSHNVALTLKNADWVVFME 690

>KLLA0F14575g complement(1351796..1354351) some similarities with
           sp|P47068 Saccharomyces cerevisiae YJL020c singleton,
           hypothetical start
          Length = 851

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 386 NGTGKTTLIKLLAGVIQSDEN--SEKVQKLNVSMKP--QTIAPKF-PGTVRQLFFKKIRG 440
           N   +   I+ + G   S     S    ++  S +P  +T   KF PGT+ +L F K   
Sbjct: 566 NAPQRRPSIQTIPGAANSSPATPSSAAPQIPASFQPLRRTTTAKFEPGTIPELEFSKQST 625

Query: 441 QFLSPQFQTDVVKPLKIDDIIDQE 464
            +L+   Q D VKP K+  I + +
Sbjct: 626 WWLTKTVQADTVKPSKVKYIWESQ 649

>YHR074W (QNS1) [2363] chr8 (246194..248338) Member of the
           eukaryotic NAD(+) synthetase branch in the nitrilase
           superfamily, which also includes human FLJ10631, C.
           elegans C24F3.4 and S. pombe SPBC23E6.03cp that are
           responsible for utilization of glutamine as an ammonia
           source [2145 bp, 714 aa]
          Length = 714

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 143 IIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETV 202
           I K F GS+++N   + ++  ++ ++   +   +P  ++G +   G LL L      E +
Sbjct: 472 IYKIFGGSQIENLALQNIQARLRMVLSYLFAQLLP-WVRG-IPNSGGLLVLGSANVDECL 529

Query: 203 KGYIKTLQLEHVLNREIGKLSGGELQRF 230
           +GY+            IG +S  +L+RF
Sbjct: 530 RGYLTKYDCSSADINPIGGISKTDLKRF 557

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member, start by similarity
          Length = 294

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 38  VVGANGAGKSTLLKLLSGKH 57

>CAGL0G00242g complement(20428..24861) highly similar to sp|P53049
           Saccharomyces cerevisiae YGR281w YOR1 ATP-binding
           cassette transporter protein, hypothetical start
          Length = 1477

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 218 EIGK----LSGGELQRFAIGLSCVQDADVYMFDEPSSYLD--VKQRLNAAQIIRDLLTPT 271
           EIG+    LSGG+  R  +  S  ++ D+Y+FD+  S +D  V + +     ++ L + T
Sbjct: 715 EIGERGITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKT 774

Query: 272 KYVIAVEHDLSVLD 285
           +  I   H LS+++
Sbjct: 775 R--ILATHQLSLIE 786

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
           ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 96/239 (40%), Gaps = 40/239 (16%)

Query: 70  ITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKP 129
           + + NL      H +      SFK+      + G  +G+VG  G GKS+   I+A     
Sbjct: 33  VELKNLSLRYSPHSSKALDNVSFKV------KAGTKVGIVGRTGAGKSS---IIAA---- 79

Query: 130 NLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIK-PQYVDNIPRA--------- 179
            + R  D   W+         ++++   + L ++I  I + P   D   R+         
Sbjct: 80  -IYRLSD---WENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYS 135

Query: 180 ---IKGPVQKVG-----ELLKLRMEKDSETVKGYI---KTLQLEHVLNREIGKLSGGELQ 228
              I G + KVG     + L L  E++      +    + + L  V+      LS G+ Q
Sbjct: 136 DVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQ 195

Query: 229 RFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDL-SVLDY 286
              +  S +   ++ + DE ++ +D        + IR+ +  T  ++ + H L SV+DY
Sbjct: 196 LLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTT-ILTIAHRLRSVIDY 253

>Kwal_26.6702
          Length = 617

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 206 IKTLQLEHVLNREIGKLSGG----ELQRFAIGLSCVQDADVYMF-DEPSSYLDVKQRLNA 260
           IK L+++   +  +G    G    + +R  IG+       + +F DEP+S LD +   + 
Sbjct: 87  IKILEMQKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSI 146

Query: 261 AQIIRDLLTPTKYVIAVEHDLSVL 284
            Q++R L    + ++   H  S L
Sbjct: 147 CQLMRRLANHGQAILCTIHQPSAL 170

>Scas_720.7
          Length = 332

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%)

Query: 346 KGEANKTFEYPAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDE 405
           +G +NK       K    D  L  E+      +ILV+ G+ G GK+T   +L+  + +DE
Sbjct: 46  QGCSNKDICESLPKGPDPDIPLITENLAGIKHKILVLSGKGGVGKSTFTTMLSWALSADE 105

Query: 406 N 406
           +
Sbjct: 106 D 106

>AER091W [2596] [Homologous to ScYKL188C (PXA2) - SH]
           complement(809767..812172) [2406 bp, 801 aa]
          Length = 801

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 3/37 (8%)

Query: 380 LVMMGENGTGKTTLIKLLAG---VIQSDENSEKVQKL 413
           L+++G NG GK++L ++L G   V+QS  N +K  KL
Sbjct: 507 LLIIGPNGCGKSSLFRVLGGLWPVLQSFTNPKKPTKL 543

>Kwal_23.4045
          Length = 761

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 11/72 (15%)

Query: 356 PAMKRTQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAG---VIQSDENSEKVQK 412
           P ++    + +  ++ GD      L+++G NG GK++L ++L G   V++S  + EK+ K
Sbjct: 453 PTLQVLIPELNFELKHGDH-----LLIIGPNGCGKSSLFRVLGGLWPVMKSFTHPEKLSK 507

Query: 413 LNVSMKPQTIAP 424
           L   + P  + P
Sbjct: 508 L---IMPPRVGP 516

>Kwal_33.13308
          Length = 706

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%)

Query: 221 KLSGGELQRFAIGLSCVQDADVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHD 280
           +LSGG+ QR A+  + + D D+ + DE +S LD +     A+ +    T  K  I++ H 
Sbjct: 581 QLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVARALYSRSTRGKTTISIAHR 640

Query: 281 LSVLDYLSDFVCI 293
           +S + + S  + +
Sbjct: 641 VSTIQHSSRVIVL 653

>CAGL0H03091g complement(292976..293980) highly similar to sp|P52920
           Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 334

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 364 DFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDEN 406
           D  L  E+      +ILV+ G+ G GK+T   +L+  + +D+N
Sbjct: 66  DIPLITENLSGIKHKILVLSGKGGVGKSTFTTMLSWALSADDN 108

>Kwal_56.23638
          Length = 4922

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 30/44 (68%), Gaps = 5/44 (11%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420
           SE ++++GE GTGKTT+++ +A  +     ++++  +NVS + +
Sbjct: 649 SEPVLLVGETGTGKTTVVQQVAKAV-----NQRLTVINVSQQTE 687

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,191,927
Number of extensions: 917436
Number of successful extensions: 3715
Number of sequences better than 10.0: 184
Number of HSP's gapped: 3623
Number of HSP's successfully gapped: 441
Length of query: 608
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 501
Effective length of database: 12,891,983
Effective search space: 6458883483
Effective search space used: 6458883483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)