Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.1332132116990.0
YDR090C31032310251e-140
CAGL0G08019g31631210071e-137
Kwal_23.65652492488861e-120
KLLA0D02178g2832858731e-117
Kwal_14.73991512011e-19
CAGL0L06710g32951992e-04
AFR605C31549983e-04
Scas_518.331049965e-04
YBR147W29641930.001
CAGL0I07689g30945920.001
Sklu_2437.130549910.002
KLLA0C03762g30649900.003
Kwal_56.2262330849880.004
Scas_628.230545870.007
Sklu_1971.229047860.008
YOL092W308103810.037
Kwal_55.2153829446770.12
AGR079W542104770.13
Scas_515.2887200770.16
CAGL0M06985g24931690.80
Scas_698.14118345701.00
Scas_658.1531133681.4
AER269C24736662.3
CAGL0I02090g113636662.9
YIL112W (HOS4)108374663.5
KLLA0E21736g31943653.5
YGR109C (CLB6)38045644.5
Kwal_14.754837100654.5
YDR352W31783628.4
YBR038W (CHS2)96369628.7
CAGL0A02508g31664619.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.13
         (321 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.13                                                           659   0.0  
YDR090C (YDR090C) [942] chr4 complement(625060..625992) Protein ...   399   e-140
CAGL0G08019g complement(756917..757867) similar to tr|Q03193 Sac...   392   e-137
Kwal_23.6565                                                          345   e-120
KLLA0D02178g 186452..187303 some similarities with sgd|S0002497 ...   340   e-117
Kwal_14.739                                                            82   1e-19
CAGL0L06710g complement(756297..757286) similar to tr|Q12010 Sac...    43   2e-04
AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH] (1...    42   3e-04
Scas_518.3                                                             42   5e-04
YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing...    40   0.001
CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces c...    40   0.001
Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement         40   0.002
KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyce...    39   0.003
Kwal_56.22623                                                          39   0.004
Scas_628.2                                                             38   0.007
Sklu_1971.2 YDR352W, Contig c1971 2812-3684                            38   0.008
YOL092W (YOL092W) [4728] chr15 (144203..145129) Protein containi...    36   0.037
Kwal_55.21538                                                          34   0.12 
AGR079W [4389] [Homologous to ScYDR117C - SH] complement(879423....    34   0.13 
Scas_515.2                                                             34   0.16 
CAGL0M06985g complement(710622..711371) similar to sp|P17261 Sac...    31   0.80 
Scas_698.14                                                            32   1.00 
Scas_658.15                                                            31   1.4  
AER269C [2771] [Homologous to ScYCR075C (ERS1) - SH] (1130115..1...    30   2.3  
CAGL0I02090g complement(177324..180734) some similarities with s...    30   2.9  
YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p c...    30   3.5  
KLLA0E21736g complement(1931058..1932017) similar to sgd|S000276...    30   3.5  
YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyc...    29   4.5  
Kwal_14.754                                                            30   4.5  
YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein contain...    28   8.4  
YBR038W (CHS2) [229] chr2 (311859..314750) Chitin synthase II, r...    28   8.7  
CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces c...    28   9.6  

>Scas_636.13
          Length = 321

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/321 (100%), Positives = 321/321 (100%)

Query: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60
           MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS
Sbjct: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60

Query: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR 120
           KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR
Sbjct: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR 120

Query: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180
           PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA
Sbjct: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180

Query: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKE 240
           SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKE
Sbjct: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKE 240

Query: 241 ELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSDDIGVPDISERATVLGS 300
           ELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSDDIGVPDISERATVLGS
Sbjct: 241 ELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSDDIGVPDISERATVLGS 300

Query: 301 VHAVHGVILKREPTTTGAITV 321
           VHAVHGVILKREPTTTGAITV
Sbjct: 301 VHAVHGVILKREPTTTGAITV 321

>YDR090C (YDR090C) [942] chr4 complement(625060..625992) Protein
           containing two PQ loop repeat domains, has high
           similarity to uncharacterized C. albicans Orf6.6869p
           [933 bp, 310 aa]
          Length = 310

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 248/323 (76%), Gaps = 15/323 (4%)

Query: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60
           MISE+AATALAT++T+CWCVQLIPQI  NWK+KDCTGLPP+MMFLWV+SGIPFAIYFCVS
Sbjct: 1   MISEKAATALATIATVCWCVQLIPQIIYNWKKKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60

Query: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR 120
           KGNV LQVQPHLFMFFC ISFVQ+CYYPP  +   KI++IV+ IIA D+GMEVGFILWLR
Sbjct: 61  KGNVILQVQPHLFMFFCSISFVQSCYYPPISMARSKIVMIVAAIIAADVGMEVGFILWLR 120

Query: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180
           PLY +G+ WPDLIFGI A++LLAVGLLPPYFELAKRKGRV+GINF FLFIDSLGAWL+I 
Sbjct: 121 PLYEKGVKWPDLIFGISASVLLAVGLLPPYFELAKRKGRVIGINFAFLFIDSLGAWLSII 180

Query: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKE 240
           SVI+GNMD MGIILY+ +AGMELGIFASHFIW CRF++ +K    D+E  +      +KE
Sbjct: 181 SVILGNMDIMGIILYSIVAGMELGIFASHFIWWCRFRFLAKGNTFDEESGQA-----QKE 235

Query: 241 ELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSDDIGVPDISERATV--L 298
           E  EK + +I      V       T   L    + DD  SSF+DD  + D ++  T+   
Sbjct: 236 EPDEKIEQDISKSDRNV-------TNYNLDNCSIPDDA-SSFADDFNIYDSTDGGTLSRA 287

Query: 299 GSVHAVHGVILKREPTTTGAITV 321
            ++HAVHGV+++ +P     ++V
Sbjct: 288 QTLHAVHGVVVRTDPDRYSRLSV 310

>CAGL0G08019g complement(756917..757867) similar to tr|Q03193
           Saccharomyces cerevisiae YDR090c, start by similarity
          Length = 316

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 208/312 (66%), Positives = 246/312 (78%), Gaps = 7/312 (2%)

Query: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60
           MISE AAT LAT++T+CWCVQLIPQI  NW+RKDCTGLPP+MMFLWV+SGIPFAIYFCVS
Sbjct: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60

Query: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR 120
           KGNV LQ+QPHLFMFFCGISFVQ+CYYPP  L V KI+ IV  II  DIGMEVGFILWLR
Sbjct: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAVRKIVAIVVGIIVVDIGMEVGFILWLR 120

Query: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180
           PLYSRGI WPDLIFGIIAT+LLA+GLLPPYFELAKR GRVVGINF+FLFIDSLGAWL+I 
Sbjct: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180

Query: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKE 240
           SV+VGNMDTMGIILY+ IAG+ELGIF SHFIWCCRFKWF  +    D E+ +  S ++  
Sbjct: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNH----DPEETDAVSEEKSV 236

Query: 241 ELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSDDI-GVPDISERATVLG 299
           + ++ ++ +    K  +G +   +  +E++E D   D  SSF  D+   P   ER +   
Sbjct: 237 KDTQYDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSSFDYDLERRPSHMERFS--Q 294

Query: 300 SVHAVHGVILKR 311
            VHAVHGV+++R
Sbjct: 295 KVHAVHGVVMQR 306

>Kwal_23.6565
          Length = 249

 Score =  345 bits (886), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 156/248 (62%), Positives = 198/248 (79%), Gaps = 1/248 (0%)

Query: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60
           MISE+ ATALA + T+CWCVQLIPQI  N++RK+C G PP+MMFLW ISGIPFAIYF V+
Sbjct: 1   MISEKGATALAIMGTVCWCVQLIPQIIFNYRRKNCEGFPPIMMFLWTISGIPFAIYFMVT 60

Query: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR 120
             N+ LQ+QPHLFM F GIS+ Q  +YPP K   W+II ++  ++A D+G+E GF LWL+
Sbjct: 61  NANLILQIQPHLFMVFSGISYAQCLHYPPVKWNKWRIIQVLVALVAIDVGLETGFTLWLK 120

Query: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180
           PLY RG+HWP LIFGIIA++LL +GLLPPYFEL KR+GRV+GI+FLFLFIDS+GAWL+I 
Sbjct: 121 PLYLRGVHWPSLIFGIIASVLLGIGLLPPYFELMKRQGRVIGIDFLFLFIDSMGAWLSII 180

Query: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFS-KNKFVDDEEQKEGNSTQEK 239
           S+I+GNMD MGI LY  IAG+E+GIF SHFIWCCRFKWF+ ++  V+D++Q+  +S +E 
Sbjct: 181 SIILGNMDVMGIALYCVIAGLEIGIFLSHFIWCCRFKWFNDQDTSVEDDQQEVADSDKEL 240

Query: 240 EELSEKNQ 247
                 NQ
Sbjct: 241 SVQELNNQ 248

>KLLA0D02178g 186452..187303 some similarities with sgd|S0002497
           Saccharomyces cerevisiae YDR090c, hypothetical start
          Length = 283

 Score =  340 bits (873), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 164/285 (57%), Positives = 206/285 (72%), Gaps = 6/285 (2%)

Query: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60
           MISE+AA ALAT+ T+CWCVQLIPQI  N+ RKDCTG PP MMFLWV+SG+PF IYF ++
Sbjct: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60

Query: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSL-IIATDIGMEVGFILWL 119
           +GN+ LQ+QPHLFMFFC +S+VQ+ YYPP  L V KI++   L +I   +  E+GF LWL
Sbjct: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120

Query: 120 RPLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAI 179
           RP+Y  G HWP L+ GIIATILLA GL+PPYFELAKR+GRVVGINF+FLF+DSLGAW +I
Sbjct: 121 RPVYDHGTHWPALVIGIIATILLAAGLIPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180

Query: 180 ASVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEK 239
           ASVIVGNMD MGI+LYA +A +ELGIFASHFIWCCRFKWF       D++     S+   
Sbjct: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEFDDDDVGSTSSSVG 240

Query: 240 EELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSD 284
            E++  +    E+     G+  G     E  ++D+  +   S  +
Sbjct: 241 IEINGIDGDSAED-----GIFAGPYINNEQDKDDIGSNNTKSMKE 280

>Kwal_14.739
          Length = 91

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/51 (70%), Positives = 45/51 (88%)

Query: 155 KRKGRVVGINFLFLFIDSLGAWLAIASVIVGNMDTMGIILYAFIAGMELGI 205
           KR+GRV+GINFLFLFIDS+GAWL+  S+I+GN+D MGI LY  IAG+E+GI
Sbjct: 2   KRQGRVIGINFLFLFIDSMGAWLSFISIILGNLDVMGIALYCVIAGLEVGI 52

>CAGL0L06710g complement(756297..757286) similar to tr|Q12010
          Saccharomyces cerevisiae YOL092w or sp|P38279
          Saccharomyces cerevisiae YBR147w, start by similarity
          Length = 329

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 2  ISERAATALA-TVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          ++ R  + +A ++S  CW V   PQIY N++RK   GL  + + LW+I  I
Sbjct: 8  LNRRTVSEIAGSISIACWVVVFAPQIYENFRRKSSDGLSLMFIILWLIGDI 58

>AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH]
          (1530918..1531865) [948 bp, 315 aa]
          Length = 315

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          SE  +    ++S  CW +  +PQIY N++RK   GL  + + LW+   I
Sbjct: 8  SETISGITGSISIACWVIVFVPQIYENFRRKSAEGLSLLFVVLWLAGDI 56

>Scas_518.3
          Length = 310

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          SE  +     +S  CW V  +PQIY N+ RK   GL  + + LW++  I
Sbjct: 10 SENVSGITGCISISCWIVVFVPQIYENFTRKSSDGLSLLFIILWLLGDI 58

>YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing
          two PQ loop repeat domains, has low similarity to S.
          pombe Stm1p, which is a G protein-coupled receptor that
          acts as a nutrient sensor for sexual diffentiation and
          stress response pathways [891 bp, 296 aa]
          Length = 296

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 11 ATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
           ++S  CW V  +PQIY N++R+   GL  + + LW++  I
Sbjct: 18 GSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDI 58

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 7   ATALATVSTICWCVQLIPQIYSNWKRKDCTGL 38
           A  L  +S I +    IPQI  N+KRK C G+
Sbjct: 208 AQILGYLSAILYLGSRIPQIVLNFKRKSCEGV 239

>CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces
          cerevisiae YOL092w, hypothetical start
          Length = 309

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWV 47
          S+  +    +VS  CW V  +PQIY N+ RK   GL  + + LW+
Sbjct: 11 SQAVSGIAGSVSIACWVVVFVPQIYENFYRKSADGLSLLFVVLWL 55

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 7   ATALATVSTICWCVQLIPQIYSNWKRKDCTGL 38
           A +   +S + +    +PQI  N+KRK C G+
Sbjct: 206 AQSFGYLSAVLYLGSRVPQILLNFKRKSCEGI 237

>Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement
          Length = 305

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          S+  +    ++S  CW +  +PQIY N+ RK   GL  + + LW+   I
Sbjct: 8  SQTVSGITGSISIACWVIVFVPQIYENFYRKSAEGLSLLFVVLWLAGDI 56

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 7   ATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVSKGNVTL 66
           A A   +S + +    +PQI  N+KRK C G+   + FL+   G      F +S  +++L
Sbjct: 201 AQAFGYLSAVLYLGSRVPQILLNFKRKSCEGI-SFLFFLFACLG---NTTFIISVLSISL 256

Query: 67  Q 67
           Q
Sbjct: 257 Q 257

>KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyces
          cerevisiae YOL092w, start by similarity
          Length = 306

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          S+  +    ++S  CW +  +PQIY N+ RK   GL  + + LW+   I
Sbjct: 10 SQTVSGITGSISIACWIIVFVPQIYENFYRKSAEGLSLMFVVLWLAGDI 58

>Kwal_56.22623
          Length = 308

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          S+  +    ++S  CW +  +PQIY N+ R    GL  + + LW++  I
Sbjct: 8  SQTVSGITGSISIACWIIVFVPQIYENFYRHSADGLSLLFVVLWLLGDI 56

>Scas_628.2
          Length = 305

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 3  SERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWV 47
          ++  +    ++S  CW +  +PQIY N+ RK   GL  + + LW+
Sbjct: 10 AQNVSGMAGSISIACWVIVFMPQIYENFYRKSADGLSLLFVVLWL 54

>Sklu_1971.2 YDR352W, Contig c1971 2812-3684
          Length = 290

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 9   ALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAI 55
           AL+ V  +C+    IPQ+  N+KRK   GL P +    +++ I +A+
Sbjct: 177 ALSWVGAMCYVCARIPQLIKNYKRKSTDGLSPFLFINTLLTNITYAL 223

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%)

Query: 7  ATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGI 51
          + A  +VS I   +  IPQ+   +K K   GL P+ +  W+   I
Sbjct: 12 SAAAGSVSFITSFIAQIPQLIETYKDKTVEGLSPIFLLAWLFGDI 56

>YOL092W (YOL092W) [4728] chr15 (144203..145129) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [927 bp, 308 aa]
          Length = 308

 Score = 35.8 bits (81), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 1/103 (0%)

Query: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180
           P+    I+W   IFG ++ +L     +P      KRK    GI+FLF     LG    I 
Sbjct: 202 PVPELQINWMAQIFGYLSALLYLGSRIPQILLNFKRKS-CEGISFLFFLFACLGNTTFIF 260

Query: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNK 223
           SVIV ++D   +I+ A      +G     F+   +F  + +NK
Sbjct: 261 SVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQFFIYKRNK 303

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 22 LIPQIYSNWKRKDCTGLPPVMMFLWV 47
           +PQIY N+ RK   GL  + + LW+
Sbjct: 29 FVPQIYENFYRKSSDGLSLLFVVLWL 54

>Kwal_55.21538
          Length = 294

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%)

Query: 10  LATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAI 55
           L+ +  +C+    IPQ++ N+ RK   GL P +    +I+ I + +
Sbjct: 171 LSWIGALCYVGARIPQLFKNYNRKSTDGLSPFLFINTLIANITYTV 216

>AGR079W [4389] [Homologous to ScYDR117C - SH]
           complement(879423..881051) [1629 bp, 542 aa]
          Length = 542

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 10/104 (9%)

Query: 141 LLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIASVIVGNMDTMGIILYAFIAG 200
           L+  G +PP F    R+GRVVGI        S  A   + +V +  MD  G+   A   G
Sbjct: 109 LMLPGTVPP-FSSGTRRGRVVGIA-------STRAPGVVKAVGICEMDLEGVTTVADTTG 160

Query: 201 MELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKEELSE 244
           + + +  ++    CR   F   +   +  + +G S + +E  +E
Sbjct: 161 VAVRVLHTYGDGLCRV--FKVQREAPEASEAKGASPEAREPEAE 202

>Scas_515.2
          Length = 887

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 77/200 (38%), Gaps = 32/200 (16%)

Query: 116 ILWLRPLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKR--KGRVVGINFLFLFIDSL 173
           IL    + SRG++ P++   II     AV     Y     R  +G + GI    L    L
Sbjct: 613 ILICTEVLSRGLNVPEVSLVIIYN---AVKTFAQYVHTTGRTARGNLHGIAITLLLPSEL 669

Query: 174 GAWLAIASVIVGN---------MDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKF 224
            A   +   +  N         ++T+  +   F  GM++G +          K F     
Sbjct: 670 TAGYILFKAMRANEKEKHDPFIIETLQGMAEEFEKGMKVGKYRLS-------KGFGGKGL 722

Query: 225 VDDEEQKEGNSTQEKEELSEKNQHEIENLKGTVGMERGGTTIQELSE-----------ED 273
            + E ++E   T+E+ + S  N    +  KG   +E GG   Q+ +            ++
Sbjct: 723 DNLENKREEKQTEERRKYSPANTGTSDASKGKTNLEEGGEVTQDTNSIEIPKLEYAILQN 782

Query: 274 LADDVNSSFSDDIGVPDISE 293
              D + +FS D+ V D+ +
Sbjct: 783 KNPDGSITFSADVNVNDLPQ 802

>CAGL0M06985g complement(710622..711371) similar to sp|P17261
          Saccharomyces cerevisiae YCR075c ERS1, hypothetical
          start
          Length = 249

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 10 LATVSTICWCVQLIPQIYSNWKRKDCTGLPP 40
          L  +    W + + P +Y NWKRK    + P
Sbjct: 7  LGVIYVTAWSISMYPPLYINWKRKSARAISP 37

>Scas_698.14
          Length = 1183

 Score = 31.6 bits (70), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 221  KNKFVDDEEQKEG----NSTQEKEELSEKNQHEIENLKGTVGMER 261
            ++K  D+EE K+G    ++ QE+    +KN     +L GTV M+R
Sbjct: 976  EDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDR 1020

>Scas_658.15
          Length = 311

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 23  IPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAI 55
           IPQ+Y N+KRK   G+ P +    ++  + + +
Sbjct: 202 IPQLYKNYKRKSTDGISPFLFATTLLGNVTYNV 234

>AER269C [2771] [Homologous to ScYCR075C (ERS1) - SH]
          (1130115..1130858) [744 bp, 247 aa]
          Length = 247

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/36 (30%), Positives = 16/36 (44%)

Query: 5  RAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPP 40
          R    L  +   CW V + P ++ NWKR+    L  
Sbjct: 2  RKRQLLGYLYATCWAVSMYPPLWINWKRQSARALSK 37

>CAGL0I02090g complement(177324..180734) some similarities with
            sp|P38853 Saccharomyces cerevisiae YHR158c KEL1 involved
            in cell fusion and morphology, hypothetical start
          Length = 1136

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 243  SEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDV 278
            +EK Q+EI+ LKG V    G  ++ + SEE L +++
Sbjct: 1070 TEKLQNEIDGLKGKVNHTDGEISLDKQSEEKLREEI 1105

>YIL112W (HOS4) [2564] chr9 (151592..154843) Component of Set3p
           complex that has histone deacetylase activity and a role
           in repression of meiotic-specific sporulation gene
           expression, contains ankyrin repeats [3252 bp, 1083 aa]
          Length = 1083

 Score = 30.0 bits (66), Expect = 3.5,   Method: Composition-based stats.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 16/74 (21%)

Query: 221 KNKFVDDEEQKEGNSTQEKEELS----EKNQHEIENLKGTVGMERGGTTIQELSEEDLAD 276
           K K VDD  ++EG    E+E+LS    EKN  E EN++  +          E S+ D   
Sbjct: 161 KRKTVDDFIEEEGLGAVEEEDLSDEVLEKNTTEPENVEKDI----------EYSDSD--K 208

Query: 277 DVNSSFSDDIGVPD 290
           D +   SDD   P+
Sbjct: 209 DTDDVGSDDPTAPN 222

>KLLA0E21736g complement(1931058..1932017) similar to sgd|S0002760
           Saccharomyces cerevisiae YDR352w, start by similarity
          Length = 319

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 23/43 (53%)

Query: 13  VSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAI 55
           V  + +    IPQ+  N+KRK   GL P++    +I+ + + +
Sbjct: 200 VGAMSYFCARIPQLIKNYKRKSTDGLSPLLFISTLIANVTYTL 242

>YGR109C (CLB6) [2068] chr7 complement(705361..706503) B-type cyclin
           appearing late in G1, involved in initiation of DNA
           synthesis [1143 bp, 380 aa]
          Length = 380

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 30/45 (66%), Gaps = 1/45 (2%)

Query: 234 NSTQEKEELSEKNQHEIENLKGTVG-MERGGTTIQELSEEDLADD 277
           +ST EK+ LSE N ++I++L+   G ++R  T +++  +  L++D
Sbjct: 41  HSTNEKKVLSEVNSNKIDSLQLPRGKLQRDSTHLEKTRKRQLSND 85

>Kwal_14.754
          Length = 837

 Score = 29.6 bits (65), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 34/100 (34%)

Query: 122 LYSRGIHW-------PDLIFGIIATILL---AVGLLPPYFELAKRKGRVVGINFLFLFID 171
           L S G+H        P +I  +IA ++L   A+G +P Y      K  V G+N       
Sbjct: 35  LLSNGLHLFLAKLRQPKVISEVIAGVILGPTALGQIPNYTNTLFPKASVTGLN------- 87

Query: 172 SLGAWLAIASVIVGNMDTMGIILYAFIAGMELGIFASHFI 211
                      +V N+   GIIL+ F  G+E+ +   HFI
Sbjct: 88  -----------LVANL---GIILFMFFLGLEVDV---HFI 110

>YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein
          containing two PQ loop repeat domains, has low
          similarity to S. pombe Stm1p, which is a G
          protein-coupled receptor that acts as a nutrient sensor
          for sexual diffentiation and stress response pathways
          [954 bp, 317 aa]
          Length = 317

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 9/83 (10%)

Query: 12 TVSTICWC-------VQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVSKGNV 64
          TVS +C         + L PQI   ++ K   GL P  +  W+   I   I   ++ G +
Sbjct: 10 TVSNLCGSLSFFTSVISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSLIGAKLT-GQL 68

Query: 65 TLQVQPHLFMFFCGISFVQTCYY 87
            Q+   ++ F    SFV   YY
Sbjct: 69 LFQILLAIY-FLLNDSFVCGQYY 90

>YBR038W (CHS2) [229] chr2 (311859..314750) Chitin synthase II,
           responsible for primary septum disk [2892 bp, 963 aa]
          Length = 963

 Score = 28.5 bits (62), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 5/69 (7%)

Query: 150 YFELAKRKGRVV-----GINFLFLFIDSLGAWLAIASVIVGNMDTMGIILYAFIAGMELG 204
           ++++ K K  VV      + FL+ FI  L +W +IA+ ++      G +      G  L 
Sbjct: 620 FYQIWKTKHSVVRKFFLHVEFLYQFIQMLFSWFSIANFVLTFYYLAGSMNLVIKHGEALF 679

Query: 205 IFASHFIWC 213
           IF  + I+C
Sbjct: 680 IFFKYLIFC 688

>CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces
          cerevisiae YDR352w, start by similarity
          Length = 316

 Score = 28.1 bits (61), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 24 PQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVSKGNVTLQVQPHLFMFFCGISFVQ 83
          PQI   +K K   GL P+ +  W +SG   ++   +  G +  Q+   ++  F  + FV 
Sbjct: 29 PQIIETYKDKTVEGLSPLFLMCW-LSGDITSLIGALMTGQLKFQIALAIYFLFNDL-FVC 86

Query: 84 TCYY 87
            YY
Sbjct: 87 CQYY 90

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.141    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,234,576
Number of extensions: 439396
Number of successful extensions: 3394
Number of sequences better than 10.0: 91
Number of HSP's gapped: 3397
Number of HSP's successfully gapped: 99
Length of query: 321
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 219
Effective length of database: 13,065,073
Effective search space: 2861250987
Effective search space used: 2861250987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)