Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_636.1283783741560.0
YDR089W86991212481e-159
CAGL0C03696g8318739721e-118
Kwal_56.234108258839601e-117
AGR160W8368808951e-107
KLLA0F14509g8519168571e-101
YPR162C (ORC4)52943760.55
YIL047C (SYG1)90240731.7
AGR223W132145722.3
Scas_399.245580712.4
YMR066W89867712.9
Sklu_2202.8136745704.0
Scas_701.2315449664.1
KLLA0C11319g92350677.2
CAGL0K09482g64992669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_636.12
         (837 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_636.12                                                          1605   0.0  
YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing...   485   e-159
CAGL0C03696g complement(367135..369630) similar to sp|P38966 Sac...   379   e-118
Kwal_56.23410                                                         374   e-117
AGR160W [4471] [Homologous to ScYDR089W - SH] complement(1045983...   349   e-107
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...   334   e-101
YPR162C (ORC4) [5577] chr16 complement(866709..868298) Origin re...    34   0.55 
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...    33   1.7  
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    32   2.3  
Scas_399.2                                                             32   2.4  
YMR066W (YMR066W) [4025] chr13 (401540..404236) Protein of unkno...    32   2.9  
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           32   4.0  
Scas_701.23                                                            30   4.1  
KLLA0C11319g complement(971620..974391) similar to sp|P14242 Sac...    30   7.2  
CAGL0K09482g 935548..937497 similar to tr|Q12171 Saccharomyces c...    30   9.8  

>Scas_636.12
          Length = 837

 Score = 1605 bits (4156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/837 (94%), Positives = 787/837 (94%)

Query: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDAMFKEQFQNINLFVSLKIKEI 60
           MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDAMFKEQFQNINLFVSLKIKEI
Sbjct: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDAMFKEQFQNINLFVSLKIKEI 60

Query: 61  STRIMSVEASILQQTMRKGPSNFKIVFSHVNDCNEELQMLSRYLIVQKLAVKKLLRRLIS 120
           STRIMSVEASILQQTMRKGPSNFKIVFSHVNDCNEELQMLSRYLIVQKLAVKKLLRRLIS
Sbjct: 61  STRIMSVEASILQQTMRKGPSNFKIVFSHVNDCNEELQMLSRYLIVQKLAVKKLLRRLIS 120

Query: 121 SHDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLIVDVLNDLKLKXXXXX 180
           SHDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLIVDVLNDLKLK     
Sbjct: 121 SHDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLIVDVLNDLKLKVTTNN 180

Query: 181 XXXXXXXXXXXKHNETLNLRSNENPPSIQNNGEDIIRSAIDFDTIFMDKCLPLHRLIVSN 240
                      KHNETLNLRSNENPPSIQNNGEDIIRSAIDFDTIFMDKCLPLHRLIVSN
Sbjct: 181 NNDVSSTLLTSKHNETLNLRSNENPPSIQNNGEDIIRSAIDFDTIFMDKCLPLHRLIVSN 240

Query: 241 ENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVKKSMASIRSFQTFQSSTK 300
           ENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVKKSMASIRSFQTFQSSTK
Sbjct: 241 ENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVKKSMASIRSFQTFQSSTK 300

Query: 301 QRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTGVPRFMKDDAFNQSPTLLIHLQDTNI 360
           QRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTGVPRFMKDDAFNQSPTLLIHLQDTNI
Sbjct: 301 QRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTGVPRFMKDDAFNQSPTLLIHLQDTNI 360

Query: 361 SPNCILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNMALEWIMNQ 420
           SPNCILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNMALEWIMNQ
Sbjct: 361 SPNCILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNMALEWIMNQ 420

Query: 421 KLRHTGMKIDIKRTRLIFSTEEFTYLISIDEKICITFNDEKFYFPHSIVEIKLLSKKSPS 480
           KLRHTGMKIDIKRTRLIFSTEEFTYLISIDEKICITFNDEKFYFPHSIVEIKLLSKKSPS
Sbjct: 421 KLRHTGMKIDIKRTRLIFSTEEFTYLISIDEKICITFNDEKFYFPHSIVEIKLLSKKSPS 480

Query: 481 SMHANNINNPTKSMNEKLQHIFREVYEKNIQCFSLDRNWTLWKICYSICQLPNVNDNDLF 540
           SMHANNINNPTKSMNEKLQHIFREVYEKNIQCFSLDRNWTLWKICYSICQLPNVNDNDLF
Sbjct: 481 SMHANNINNPTKSMNEKLQHIFREVYEKNIQCFSLDRNWTLWKICYSICQLPNVNDNDLF 540

Query: 541 KLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPFQEEIRNKSQSQSTHSNFKPHPYN 600
           KLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPFQEEIRNKSQSQSTHSNFKPHPYN
Sbjct: 541 KLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPFQEEIRNKSQSQSTHSNFKPHPYN 600

Query: 601 ESKANKQKERTFRYWNEFDDDQASINRENQHFYQDEDESICSQEDHGLVTFNRPFIDSMF 660
           ESKANKQKERTFRYWNEFDDDQASINRENQHFYQDEDESICSQEDHGLVTFNRPFIDSMF
Sbjct: 601 ESKANKQKERTFRYWNEFDDDQASINRENQHFYQDEDESICSQEDHGLVTFNRPFIDSMF 660

Query: 661 DKFKSIKSMIIPXXXXXXXXXXXDGTSIYGSTYVLGSRSTLTLSPGSESDLEALLEYDPS 720
           DKFKSIKSMIIP           DGTSIYGSTYVLGSRSTLTLSPGSESDLEALLEYDPS
Sbjct: 661 DKFKSIKSMIIPRKRKQRKKRQQDGTSIYGSTYVLGSRSTLTLSPGSESDLEALLEYDPS 720

Query: 721 NVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINFX 780
           NVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINF 
Sbjct: 721 NVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINFL 780

Query: 781 XXXXXXXXXXXXXXXXXXXXXXFSRFTLAPLWHYISCFVFFIMVTFTVCYAIVEIFF 837
                                 FSRFTLAPLWHYISCFVFFIMVTFTVCYAIVEIFF
Sbjct: 781 LAVIIGSLLVSLILIIVSLLLLFSRFTLAPLWHYISCFVFFIMVTFTVCYAIVEIFF 837

>YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing a
           SYG1, Pho81 and XPR1 (SPX) N-terminal domain, which may
           be involved in G protein associated signal transduction,
           has weak similarity to uncharacterized C. albicans
           Orf6.8826p [2610 bp, 869 aa]
          Length = 869

 Score =  485 bits (1248), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 330/912 (36%), Positives = 485/912 (53%), Gaps = 118/912 (12%)

Query: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTR--------------LETLDAMFKEQF 46
           M F   +L+KS+P+WK  N+ Y+KLK AI + T               L      F ++F
Sbjct: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60

Query: 47  QNINLFVSLKIKEISTRIMSVEASIL--QQTMRKGPSN------FKIVFSHVNDCNEELQ 98
           QN+NLFVSLKIKEISTRI+SVE+SI+   + + K   N       KI+ +HV+DCN ELQ
Sbjct: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120

Query: 99  MLSRYLIVQKLAVKKLLRRLISS----HDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLD 154
           +LSR+LI+Q++A++KL ++L++      +      E+VT +  S+  +NG++G+SF KLD
Sbjct: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180

Query: 155 LDPYLIEISLIVDVLNDLKLKXXXXXX------------XXXXXXXXXXKHNETLNLRSN 202
           LDPYL+E+SLIVDVL+DL+ K                             +N +L     
Sbjct: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240

Query: 203 ENPPSIQNNGEDIIRSAIDFDTIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQL 262
             P         +I S+++FDT  +DK   L R ++S+E+IE  KFMLL+  FRI+DD +
Sbjct: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300

Query: 263 ISTSKDIIVSTEQNRPNLNVK--KSMASIRSFQTFQ---SSTKQRNNSATSTSHGGLPS- 316
           ISTSK+I+ +T+    N+N    KS+ S +SF   Q   S +KQ+N          LPS 
Sbjct: 301 ISTSKEILDTTD----NINSAGNKSIRSAKSFNDLQHTLSLSKQKN---------ILPSA 347

Query: 317 LRLSQNMLSISLLD-LDPTGVPRFMKDDAFNQSPTLLIHLQDTNISPNCILMCHMGGLRD 375
           ++ ++  +SIS+LD +   G P  + DD  NQ P +++    +     CI+MCH+GGLR+
Sbjct: 348 VQSNEKYVSISILDTVGNEGSPLLLTDDNINQHPNMIVS---STAEDTCIVMCHVGGLRN 404

Query: 376 HLVTNNIPLEVINQVLSQDVKG-----------SIPPSNSNFNPIDNMALEWIMNQKLRH 424
           H+VTN++ L  +  +LS    G           S+ PS     PI  +ALEWI + +L+ 
Sbjct: 405 HVVTNDLLLRDVKNILSAMRSGNDTKNISALINSLDPS-----PISKIALEWIQSHRLKT 459

Query: 425 TGMKIDIKRTRLIFSTEEFTYLISIDEKICITFNDEKFYFPHSIVEIKLLSKKSPSSMHA 484
              K+D KRTR I +     YLI++DE I I  N     FP  I+EIK LS+ S  S  A
Sbjct: 460 IEPKLDFKRTRFISADNGDIYLIALDESITIG-NVSTLPFP--ILEIKKLSRSSGLSQTA 516

Query: 485 NNINNPTKSMNEKLQHIFREVYEKNIQCFSLDRNWTLWKICYSICQLPNVNDNDLFKLLL 544
            N +N       K + + + V     QC  +  + T WKIC  +    N   NDLF+LLL
Sbjct: 517 INEDN-------KFKQLMKSVVTNEFQCSLIPPDLTTWKICLELVH-SNELQNDLFQLLL 568

Query: 545 QCDYTLPPNDSLSTEEFFALGHDGILE---LCYPPFQEEIRNKSQSQSTHSNFKPHPYNE 601
           +  Y L  +DSLS +EFF LG D + E   L  P     I N   S  +    + H  ++
Sbjct: 569 RDQYKLNSDDSLSPDEFFQLGKDRLEEEFDLTGP-----INNSQGSVDSGRRVRIHKKSK 623

Query: 602 SKANKQKERTFRYWNEFD-------DDQASINRENQHFYQDEDESIC---SQEDHGLVTF 651
              N+ K++  RYWNEFD       D+   I+        D +ES+    S  D+G + F
Sbjct: 624 QSDNETKKKPIRYWNEFDEQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILF 683

Query: 652 NRPFIDSMFDKFKSIKSMI------IPXXXXXXXXXXXDGTSIYGSTYVLGSRSTLTLSP 705
           +R FI+  +D  + ++++I       P             T+ YGS    GS+ST     
Sbjct: 684 SRNFINRTYDFCEKLRNLIRHDKKTSPDLFQNSKHPHCSSTN-YGSVASFGSQST----S 738

Query: 706 GSESDLEALLEYDPSNVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLALFRE 765
            S  D++  L+Y   ++++S+SIYE++HD+V+T  YL++LL SC+ + +CLGIVL+LFR 
Sbjct: 739 ASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRG 798

Query: 766 SENDDVIVFDGINFXXXXXXXXXXXXXXXXXXXXXXXFSRFTLAPLWHYISCFVFFIMVT 825
             N++ I  +  N                        FSRFTLAP+WHY+ CF  F  VT
Sbjct: 799 QSNNE-IDLEIQNILIAIIIISLLVSLILICACLLLLFSRFTLAPIWHYVGCFTMFFSVT 857

Query: 826 FTVCYAIVEIFF 837
            TVCY ++EIFF
Sbjct: 858 GTVCYGMIEIFF 869

>CAGL0C03696g complement(367135..369630) similar to sp|P38966
           Saccharomyces cerevisiae YDR089w, start by similarity
          Length = 831

 Score =  379 bits (972), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 261/873 (29%), Positives = 447/873 (51%), Gaps = 78/873 (8%)

Query: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTR---------LETLDAMFKEQFQNINL 51
           M F S +LDKSVP WK  N++Y++LKK I + T           E L+  FK+    INL
Sbjct: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDFEGLEVSFKQNIVQINL 60

Query: 52  FVSLKIKEISTRIMSVEASILQ------QTMRKGPSNFKIVFSHVNDCNEELQMLSRYLI 105
           FVSLK+KEIS++++S+E SI +         RK     K + +++  CN+ LQ LSR++I
Sbjct: 61  FVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVI 120

Query: 106 VQKLAVKKLLRRLISSHDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLI 165
           VQ++A++KL +++   +    + +++++ +   ++ ++GY+GVSF  LDL  YL+E+SLI
Sbjct: 121 VQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLI 180

Query: 166 VDVLNDLKLKXXXXXXXXXXXXXXXXKHNETLNLRSNENP-PSIQNNGEDIIRSAIDFDT 224
           +D+L D+                   K     N   N+ P  S   N +        FD 
Sbjct: 181 MDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFTTNQQ--------FDQ 232

Query: 225 IFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVKK 284
           +  DK   +  L+V ++N E+ KF+L++  F++ D  L   S+DII S     PN  V +
Sbjct: 233 VLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIAS----EPNSEV-R 287

Query: 285 SMASIRSFQTFQSSTKQRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTG-VPRFMKDD 343
           S+ S +SF        +R +++++        +  S+       + L P+G V   + D 
Sbjct: 288 SLRSKKSFYESDRPALKRLHTSSTEYLNNAEEMEQSK----CKAVMLTPSGKVDSSIYDS 343

Query: 344 -AFNQSPTLLIHLQDTNISPN-CILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPP 401
                 P++L+  +  N+  N CI++CH+GGLR  +VT+ + +  I++ L    K +I  
Sbjct: 344 KKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSNKQAIS- 402

Query: 402 SNSNFNPIDNMALEWIMNQKLRHTGMKIDIKRTRLIFSTEEFTYLISIDEKICITFND-- 459
                +P+  +AL+WI +  ++  G++I  KRTR   +     Y+I+IDE+  ++ ++  
Sbjct: 403 -----DPLAKIALDWICDHGMKECGIEIGFKRTRYFCNKHSNLYMITIDEEFTLSDSNGQ 457

Query: 460 -EKFYFPHSIVEIKLLSKKSPSSMHANNINNPTKSMNEKLQHIFREVYEKNIQCFSLDRN 518
            EK    HSI+++++++          N ++  KS+ +K Q I+ ++    IQCF    +
Sbjct: 458 TEKL-MDHSIIDLRVVT---------TNFSSDNKSLAKKSQEIYEKIISSKIQCFPFQPD 507

Query: 519 WTLWKICYSICQLPNVNDNDLFKLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPFQ 578
           +   K+  SI +  N + + + +L+L+  Y L  N+ ++ +EFF +G D +L++C   F+
Sbjct: 508 FHPVKLLLSIHE-NNGSKDVIHRLMLENIYELNENNKITEDEFFGIGFDLLLDICSSEFK 566

Query: 579 EEIRNKSQSQSTHSN--FKPHPYNESKANKQKERTFRYWNEFDDDQASINRENQHFYQDE 636
           +    K +S +   N   K +  +++K  +  +   RYWNEFDD +   N     + QD 
Sbjct: 567 DNYYQKVESPTRTPNDWKKNNLLSKNKNTENNKPAIRYWNEFDDLEEE-NGGGGFYIQDR 625

Query: 637 DESICSQE-----DHGLVTFNRPFIDSMFDKFKSIKSMI-------IPXXXXXXXXXXXD 684
            + + S E     D+G + F++ FI+S +   +S +  +                     
Sbjct: 626 TDDLESNELQQERDYGFIHFSKDFIESTYSSLQSFRDFLGFKDNNRTAIDPALLDLSERF 685

Query: 685 GTSIYGSTYVLGSRSTLTLSPGSESDLEALLEYDPSNVQESESIYEFKHDQVLTVFYLAS 744
           G S YGS    GS     +   S  D+  L+E+    ++ SES+Y +KHDQVL++ YL +
Sbjct: 686 GNSNYGSISSKGS-----ILSNSVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLFA 740

Query: 745 LLISCMTSGLCLGIVLALFRESENDDVIVFDGINFXXXXXXXXXXXXXXXXXXXXXXXFS 804
           LL++C TSG+C+GIVL++F   +N D+ +  G                          FS
Sbjct: 741 LLMACATSGICMGIVLSVFN-GDNSDIEIDVGKTL-IITVILSLGISLGLITLCLLLLFS 798

Query: 805 RFTLAPLWHYISCFVFFIMVTFTVCYAIVEIFF 837
           R+T AP+WHY   F  FIM+  TVCY +VEIF 
Sbjct: 799 RYTYAPIWHYALSFAIFIMIMSTVCYGLVEIFL 831

>Kwal_56.23410
          Length = 825

 Score =  374 bits (960), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 276/883 (31%), Positives = 437/883 (49%), Gaps = 104/883 (11%)

Query: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHT----------------RLETLDAMFKE 44
           M F S + +KSVP+W+  N++Y  LK+A+   T                 L  L   F+ 
Sbjct: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60

Query: 45  QFQNINLFVSLKIKEISTRIMSVEASI------LQQTMRKGPSNFKIVFSHVNDCNEELQ 98
           QF+N+N FV +KIKE STR++SVE+SI      +Q+  R       ++ SH++ CN EL 
Sbjct: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL 120

Query: 99  MLSRYLIVQKLAVKKLLRRLISSHD-GSAVVEEWVTELYQSDDYQNGYQ-GVSFAKLDLD 156
            + R+LI+QK+A++KLL++ +  +    AV E++V ++    + +   + G+SF KLDLD
Sbjct: 121 RICRFLILQKIALRKLLKKFLKYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD 180

Query: 157 PYLIEISLIVDVLNDLKLKXXXXXXXXXXXXXXXXKHNETLNLRSNENPPSIQNNGEDII 216
           PYL+E+SL+VDVL +L+                  K + T     +E P  I+      +
Sbjct: 181 PYLLEVSLVVDVLQELE------------QAASGRKGSLTHETMKSEMPGEIEGAHSAPM 228

Query: 217 RSAID----FDTIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQLISTSKDII-- 270
            S  D    FD+IF+ K   L   +V++E+I + KF+LL   F +VDD +I  S+  +  
Sbjct: 229 ASHADSDLAFDSIFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILVSQQSLKD 288

Query: 271 VSTEQNRPNLNVKKSMASIRSFQTFQSSTKQRNNSATSTSHGGLPSLRLSQNMLSISLLD 330
            S+     N    K+  +++SF   + ++ Q  N A       +  +R SQ    I++LD
Sbjct: 289 SSSTSLTANGTSGKTPRTVKSFHDLRLASDQNENVALPM----ISDIRSSQQT-EIAMLD 343

Query: 331 LDPTGVPRFMKDDAFNQSPTLLIHLQDTNISPNCILMCHMGGLRDHLVTNNIPLEVINQV 390
             P  VP F++DDA N+ PT++++   T     C++MCH+GGLR+H+V+ N+  + +  V
Sbjct: 344 SKP--VPSFLEDDAINRHPTIVVNGSRTC---KCLVMCHVGGLRNHIVSENVSKKKLASV 398

Query: 391 LSQDV--KGSIPPSNSNFNPIDNMALEWIMNQKLRHTGMKIDIKRTRLIFSTEE---FTY 445
           LS                 PI  + LEWI +  L   G KI  +RTR   +  E     Y
Sbjct: 399 LSNKSLDTLETESETEVTTPIGKLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEY 458

Query: 446 LISIDEKICITFNDEKFYFPHSIVEIKLLSKKSPSSMHANNINNPTKSMNEKLQHIFREV 505
           L+ +DE I +  + +    PH++VEI+  S++S   +H           +E +  +  ++
Sbjct: 459 LVCVDESIVLAGSKK---VPHAVVEIR--SQQSGGMLHRKE-----GYKDELITTLIEKM 508

Query: 506 YEKNIQCFSLDRNWTLWKICYSICQLPNVNDNDLFKLLLQCDYTLPPNDSLSTEEFFALG 565
           YE +I C+ L  + TLWK+ Y        N  DL   L       P   S ++E  F +G
Sbjct: 509 YENHISCYPLKEDQTLWKLLYQA-----ANAEDLKSGLFSA--ACPSLTSFNSESIFEIG 561

Query: 566 HDGILELCYPPFQEEIRNKSQSQSTHSNFKPHPYNESKANKQKER----------TFRYW 615
              +  +             Q +++ +  KP      K+ K KE+            RYW
Sbjct: 562 ESELSRMIAA-------KGEQRRASFAGKKP------KSRKTKEQLISPQANSKPPIRYW 608

Query: 616 NEFDDDQASINRENQHFYQDEDESICSQE-DHGLVTFNRPFIDSMFDKFKSIKSMIIPXX 674
           NEFD+ + +    N+ FY+D +      E D+G + FNR FI++ ++  +S++  +    
Sbjct: 609 NEFDNGEEA---GNESFYRDTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRFLTLSS 665

Query: 675 XXXXXXXXXDGTSIYGSTYVLGSRSTLTLSPGSESDLEALLEYDPSNVQESESIYEFKHD 734
                      +    S     + S+L  +  +E D    + Y     ++S+S+YEFKHD
Sbjct: 666 DEPEKRPLLTDSQHRQSINSFTTSSSLNTTSSAERDYNRYINYTIEQ-EDSQSVYEFKHD 724

Query: 735 QVLTVFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINFXXXXXXXXXXXXXXX 794
           QV+T FYL+SLL+SC+TSG+ LGIV +LFRE  NDD IVF                    
Sbjct: 725 QVVTFFYLSSLLVSCITSGISLGIVASLFREL-NDD-IVFGAGPGLLTVIIATLLTSLIL 782

Query: 795 XXXXXXXXFSRFTLAPLWHYISCFVFFIMVTFTVCYAIVEIFF 837
                   FSRF  AP WHY+ CF+ F++V  TVCY ++EIF 
Sbjct: 783 SCASLLLLFSRFKFAPWWHYVGCFLIFLVVACTVCYGLIEIFL 825

>AGR160W [4471] [Homologous to ScYDR089W - SH]
           complement(1045983..1048493) [2511 bp, 836 aa]
          Length = 836

 Score =  349 bits (895), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 253/880 (28%), Positives = 428/880 (48%), Gaps = 124/880 (14%)

Query: 14  QWKHQNLEYDKLKKAIMRHT-----RLET-------LDAMFKEQFQNINLFVSLKIKEIS 61
           +W    ++Y+ L++ + R T     R ET       L   F+ +  N+NLFVSLK++EI+
Sbjct: 23  EWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLLGAFRAELSNVNLFVSLKMREIT 82

Query: 62  TRIMSVEASILQQTMRK--GPSNFKIVFSHVND----CNEELQMLSRYLIVQKLAVKKLL 115
            R+ +VEA I++   RK   P    +     N     C+ +LQ L+RYL++QK A++KL 
Sbjct: 83  ARLETVEAGIVEWRRRKVGEPGARALRLRRANGQLAQCSADLQRLARYLLLQKAALRKLT 142

Query: 116 RRLISSHD-GSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLIVDVLNDLKL 174
           RRL+  +    A VE +V  LY  D+ Q G++GV F  +DL+PYL+E+SLI+ VL DL++
Sbjct: 143 RRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTAVDLEPYLLEVSLIMGVLYDLEM 202

Query: 175 KXXXXXXXXXXXXXXXXKHNETLNLRSNENPPSIQNNGEDIIRSAIDFDTIFMDKCLPLH 234
           K                        R+ E P ++       I S + FDT+F+ K   L 
Sbjct: 203 KDRSVE-------------------RAREPPNNVLGRP---ITSCLTFDTLFLGKYHLLQ 240

Query: 235 RLIVSNENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVKKSMASIR--SF 292
           RL++S +N+ E KF+L+  +++++DD ++STS+ +          +       S+R   F
Sbjct: 241 RLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDF 300

Query: 293 QTFQSSTKQRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTGVPRFMKDDAFNQSPTLL 352
              + +  +RN+S        LP    + + L   +  LD     +FM D+A+NQ P + 
Sbjct: 301 GAARPARMRRNSS--------LPDKLRTLSQLRTHMYPLD----KQFMTDEAYNQHPNIF 348

Query: 353 IHLQDTNISPNCILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNM 412
           +  Q  +    C+LMCH+GG+R+H++T N+PL ++ + L+   K      N   + +D +
Sbjct: 349 VRGQQDDA---CLLMCHVGGMRNHIITQNLPLPLVLECLT---KRQWSHKNIPLSALDKL 402

Query: 413 ALEWIMNQKLRHTGMKIDIKRTRLIFSTEE------FT--YLISIDEKICITFNDEKFYF 464
            L+W+    L  +   I +KRTR     +E      FT  YLI++DE++   F +     
Sbjct: 403 CLDWVRTNNLGLSDFVISVKRTRFFTKRDEVINGTAFTSVYLITLDEEV---FINNTLKL 459

Query: 465 PHSIVEIKLLSKKSPSSMHANNINNPTKSMNE---KLQHIFREVYEKNIQCFSLDRNWTL 521
           PH+ VE++ L+         N +  P KS N+   +L H+   + + ++ C+ L  + TL
Sbjct: 460 PHAFVEVRKLT---------NTVVTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPSNTL 510

Query: 522 WKICYSICQLPNVN-DNDLFKLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPFQEE 580
           WK+ YS+   P    +  ++  L   D+    N  +S +  F++G   + ++  P   + 
Sbjct: 511 WKMAYSLKDTPAEEIERSMYAALAAADFQDSSN--ISGDILFSIGRRRLDQMSTPTVPQ- 567

Query: 581 IRNKSQSQSTHSNFKPHPYNESKANKQKERTFRYWNEFDDDQASINRENQHFYQDEDESI 640
            R  S ++S+H +      + S    Q++   RYWNE D+   +  ++   FY+D +E  
Sbjct: 568 -RTPSLAKSSHKSQDAQSPSSSGETPQRK---RYWNELDEQNDADAQDC--FYRDPEELH 621

Query: 641 CS--QEDHGLVTFNRPFIDSMFDKF-----------KSIKSMIIPXXXXXXXXXXXDGTS 687
               + +HG + F++ FI + +              K  K   +            + T 
Sbjct: 622 TGDYEAEHGFIKFDKNFILNFYQYLHKLNHIFCYQKKPPKEYTVVPCSGDSEITRSELTP 681

Query: 688 IYGSTYVLGSRSTLTLS---PGSESDLE--------ALLEYDPSNVQESESIYEFKHDQV 736
           +        S S L +    PG  S L+        AL+ YD     E + +Y +KHD+V
Sbjct: 682 LIRQNSEARSYSALEVQSTLPGGGSQLQVPNWDDEAALVCYD-----ELDVLYGYKHDEV 736

Query: 737 LTVFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINFXXXXXXXXXXXXXXXXX 796
           +++FYL +LL+SC+T+G  +GI+ +LF    ND    F+G N+                 
Sbjct: 737 VSLFYLTTLLVSCITTGTTVGIMFSLFSALGNDQT-EFEGSNYITALILVSLVVSLMLSS 795

Query: 797 XXXXXXFSRFTLAPLWHYISCFVFFIMVTFTVCYAIVEIF 836
                 FSR+ +AP WHY SC + FI+VT  VCY +V++F
Sbjct: 796 FSLLLLFSRYHMAPWWHYSSCIIVFILVTLCVCYGVVKVF 835

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score =  334 bits (857), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 292/916 (31%), Positives = 444/916 (48%), Gaps = 144/916 (15%)

Query: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHT-------------------RLETLDAM 41
           M F + +LDKSVP+WK  N++Y +LK  I R T                    L +L  +
Sbjct: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60

Query: 42  FKEQFQNINLFVSLKIKEISTRIMSVEASILQQTMRKGPSN----FKIVFSHVNDCNEEL 97
           F+ QF+ IN+F+S+K+KE STRI+S+E  + Q  + K  +      K++  H++ CN EL
Sbjct: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENKKLRRIKLINQHLDRCNLEL 120

Query: 98  QMLSRYLIVQKLAVKKLLRRLISSHD-GSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLD 156
           Q LSRYLI+QK+AV+KL ++ +  +  G+ + +E++  L    +++ G++GVS   +DLD
Sbjct: 121 QKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDLD 180

Query: 157 PYLIEISLIVDVLNDLKLKXXXXXXXXXXXXXXXXKHNETLNLRSNENPPSIQNNG---- 212
           PYL+EISLIVD+L++++                  K   T N R+N N            
Sbjct: 181 PYLLEISLIVDLLHEME-----QDADQQPVDSGNTKTGNTSNSRANSNVGITSGTAPSSR 235

Query: 213 -------EDIIRSAIDFDTIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQLIST 265
                    +I S + FD  F+ K  PL   ++S E+ +E KF+L++  F + DD +I+T
Sbjct: 236 KSSVVSSSHVIDSTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIAT 295

Query: 266 SKDIIVSTEQNRPNLNVKKSMASIRSFQTFQ----SSTKQRNNSATSTSHGGLPS----- 316
           SK I+            K S+ S+R F+  Q    +S+ QR ++ +S   G   S     
Sbjct: 296 SKKILSGDALLSKR---KGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGSN 352

Query: 317 --------LRLSQNMLSISLLDLDPTGVPRFMKDDAFNQS-----PTLLIHLQDTNISPN 363
                      + N+L       +P   P     + +N +     P LL+    +N S  
Sbjct: 353 RSQQLSNSSSSAHNIL------FEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDS-- 404

Query: 364 CILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNMALEWIMNQKLR 423
            IL+CH+GGLR+H+ T+ I    I  VL+      +P SN     +D    +W  +  L+
Sbjct: 405 -ILLCHVGGLRNHISTDTIEYTDIKAVLNGCEPSLMPVSNR----LDEFCRDWCYSHNLK 459

Query: 424 HTGMKIDIKRTRLIFSTEEFT----YLISIDEKICITFNDEKFYFPHSIVEIKLLSKKSP 479
            T + I  +R+R I S         YLI ID+ I I  ND K   P +++E+K+L   S 
Sbjct: 460 TTDLVIKCRRSRFIISHSSIETNNDYLICIDDNIEI--NDNKL--PFAVLEVKILEATSS 515

Query: 480 SSMHANNINNPTKSMNEK-LQHIFREVYEK----NIQCFSLDRNWTLWKICYSICQLPNV 534
           SS+       P K+ ++K +  I  ++ EK    N+  +   RN+TLW++   I    N 
Sbjct: 516 SSV-------PNKTYSKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAGGSNP 568

Query: 535 NDNDLFKLLLQCDYTLPPNDSL-STEEFFALG-------HDGILELCYPPFQEEIRNKSQ 586
                    L C   L  N +  S EE F  G       HD    L  PP  E   ++S 
Sbjct: 569 ---------LAC---LDGNLNFESVEEMFGAGNALLKKTHDRYQSLLNPPTIE--FSQSS 614

Query: 587 SQSTHSNFKPHPYNESKANKQKERTFRYWNEFDDDQASINRENQHFYQ--DEDESICSQE 644
           SQ+T  N  P     +   ++K R  RYWNEFDD + +++   Q FY   DED+   +  
Sbjct: 615 SQNTAVNISP-----TVTEREKPR-IRYWNEFDDGEEAMD---QDFYSCLDEDDDEYTH- 664

Query: 645 DHGLVTFNRPFIDSMF---DKFKSIKSMIIPXXXXXXXXXXXDGTSIYGSTYVLGSRSTL 701
           D GL+ FN  FI +++    KF+ I   II             G S Y S  +    S L
Sbjct: 665 DTGLIRFNPSFIIAIYHLLSKFQ-IAFGIIDDVQARKSLLRDAGKS-YNS--IDTDTSIL 720

Query: 702 TLSPGSESDLEALLEYDPSNVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLA 761
           T S    +D+    E +  N   SESIYEF+HDQV++ FY++SLLISC+T+G+ +GI+ +
Sbjct: 721 TSSSSERNDVNKFWELEEQN---SESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTS 777

Query: 762 LFRESENDDVIVFDGINFXXXXXXXXXXXXXXXXXXXXXXXFSRFTLAPLWHYISCFVFF 821
           LF+ S NDD  + +  +                        FSRFT AP WHYI+  V F
Sbjct: 778 LFK-SLNDDTQLENETSI-LTMIFISLSISLILGAWSLLLMFSRFTFAPTWHYITGVVIF 835

Query: 822 IMVTFTVCYAIVEIFF 837
           I++ F VCY  +E+  
Sbjct: 836 IIIIFAVCYGFIELIL 851

>YPR162C (ORC4) [5577] chr16 complement(866709..868298) Origin
           recognition complex (ORC), 56 kDa subunit [1590 bp, 529
           aa]
          Length = 529

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 28/43 (65%)

Query: 66  SVEASILQQTMRKGPSNFKIVFSHVNDCNEELQMLSRYLIVQK 108
           S++  +LQQ     P++ KI+F+++ DC +E+  + +  I+QK
Sbjct: 51  SLQRRLLQQLYGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQK 93

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
          which truncation and overexpression can suppress
          lethality of Gpa1p deficiency, member of the divalent
          anion:Na+ (DASS) family of membrane transporters [2709
          bp, 902 aa]
          Length = 902

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 1  MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDA 40
          M F+ H+ + ++P+W+ + ++Y   KK + R+   E LDA
Sbjct: 1  MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYK--EKLDA 38

>AGR223W [4534] [Homologous to ScYPL110C - SH]
          complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 1  MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDAMFKEQ 45
          M F     +  VP+W H+ + Y  LKK I   T ++  DA+F+++
Sbjct: 1  MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKEITLVQ--DALFRQE 43

>Scas_399.2
          Length = 455

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 21/80 (26%)

Query: 513 FSLDRNWTLWKICYSICQLPNVNDNDLFKLLLQCDYTLPPNDSLSTEEFFALGHDGILEL 572
           F  D++  LWK CY I +                DY      S+S E   +   D ILE+
Sbjct: 104 FQYDQDTPLWKYCYPIKE----------------DYGFIN*LSMSVE---STEDDKILEM 144

Query: 573 CYPPFQEEIRNKSQSQSTHS 592
             P FQ E  NK+QS S+H+
Sbjct: 145 --PLFQHEQANKTQSASSHA 162

>YMR066W (YMR066W) [4025] chr13 (401540..404236) Protein of unknown
           function [2697 bp, 898 aa]
          Length = 898

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 32/67 (47%)

Query: 325 SISLLDLDPTGVPRFMKDDAFNQSPTLLIHLQDTNISPNCILMCHMGGLRDHLVTNNIPL 384
           S+ + ++     P F K +   +  +LL  +Q++ + PN + +  +    D +   N   
Sbjct: 596 SLQIQNMKAQNTPSFRKKEFKQKVKSLLKRMQESEVIPNAVFLREILNFYDSMYDFNSSF 655

Query: 385 EVINQVL 391
           E+IN +L
Sbjct: 656 EIINPLL 662

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 1  MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTRLETLDAMFKEQ 45
          M F     +  VP+W HQ + Y  LKK I + T  +T + + +EQ
Sbjct: 1  MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQIT--QTQEKLHREQ 43

>Scas_701.23
          Length = 154

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 311 HGGLPSLRLSQNMLSISLLDLDPTG------VPRFMKDDAFNQSPTLLI 353
           HG +PSL+L +   S S LD++PT       +P++      N S   L+
Sbjct: 20  HGDIPSLKLIETKYSYSFLDIEPTAEGHIIIIPKYHGAKLHNISDQYLV 68

>KLLA0C11319g complement(971620..974391) similar to sp|P14242
           Saccharomyces cerevisiae YNL082w PMS1 DNA mismatch
           repair protein, start by similarity
          Length = 923

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 25/50 (50%)

Query: 46  FQNINLFVSLKIKEISTRIMSVEASILQQTMRKGPSNFKIVFSHVNDCNE 95
           F++++   S   +  +   +     ++  T  KGP  +KIVF+H   CN+
Sbjct: 83  FEDVSKVTSFGFRGEAIASLCQMGKVIITTTTKGPKAYKIVFNHSGTCNK 132

>CAGL0K09482g 935548..937497 similar to tr|Q12171 Saccharomyces
           cerevisiae YOR147w, hypothetical start
          Length = 649

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 10/92 (10%)

Query: 298 STKQRNNSATST----SHGGLPSLRLSQNMLSISLLDLDPTGVPRFMKDDAFNQSPTLLI 353
           S K R+N + +     + G   +LRL  N ++I+ L+L+ TG   ++ D     S  ++I
Sbjct: 354 SDKGRDNRSKTIDKNENDGRFTNLRL--NAININELNLNRTGAFNWIDDGTIEISADIMI 411

Query: 354 HLQDTNISPNCI--LMCHMGGLRDHLVTNNIP 383
              D N   N +  L+ + GG  D LV  N P
Sbjct: 412 PNTDENNEGNGLKTLLGYPGG--DPLVNKNTP 441

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,359,585
Number of extensions: 1222790
Number of successful extensions: 4526
Number of sequences better than 10.0: 43
Number of HSP's gapped: 4641
Number of HSP's successfully gapped: 45
Length of query: 837
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 727
Effective length of database: 12,788,129
Effective search space: 9296969783
Effective search space used: 9296969783
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)